#@+P zHP tHP pHP lHWHqHP `HP THP ZHP THP PHP LHP HHP DHP @HP HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P HP ? HP @ |HP A xHP B tHP C pHP D lHP E hHP F dHP G `HP H \HP I XHP J THP K PHP L LHP M HHP N DHP O @HP P HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP PX;8;;;;; ;(;0H )@`  >X!  >X;8!7 >X,0+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >X 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->X %)>X t %"+/> ->X+cP> !p`"!p#t@> ɐ!;x ;"`;" @ٙ@Ҋ@@2 @ 0P -@ @ @"P/> P->X %)>X t %"+/> ->X+cP> !p`"!p#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Nt x ``-`Ё @B tx ǁ )>!4@! P->X %)>X t %"+/> ->X+cP> !p`"!p#t@;x;;>!<!@ ;`#h#l;;;;@x``htx ;`#h#l;;;;@+``htxf )>)"t@)>)" P -@ @ @"P/> P->X %)>X t %"+/> ->X+cP ;`@;h#t;x;;;;;`@;`htx />H->X+cPۜP -@ @ @"P/> P->X %)>X t %"+/> ->X+cP ;`@;h#t;x;;;`;;@ ;`htxف -?P -@-P -@ @ @"/>H/> />H6PP->X %)>X t %"/>H/> />HP;x> !x`"!x@;,/,;@ ;`,)>X!;h %)> 3! #p "`@ x  +?P`-@-?P- %0P -@ @ @"/>H/> />H6PP->X %)>X t %"/>H/> />HP;x> !x`"!x@;,/,;@ ;`,)>X!;h %)> 3! #p "`@   @@`x' P -@ @ @"/>H/> />H6PP->X %)>X t %"/>H/> />HP> !x`"!x?P * * ;`@;h09P -@ @ @"/>H/> />H6PP->X %)>X t %"/>H/> />HP> !x`"!x?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@0`h ?P `*  P -@ @ @"/>H/> />H6PP->X %)>X t %"/>H/> />HP> !x`"!x?p " ?P "  ;`@;h@ך`h ?p " q @/>  @̀->X $)>X t %->X+cP->X ZP @ H ,@`#>X`$` (08 @̀=)>X ,0+0;"+2+0 `# @ 05-" % >&u 8 >0-@0=`"-@-@0 `# @ 05-"Y  ->X%- +cP ;`@;h #t;x;`;;;;@u;`htx ->X& 0Ȧ! H,@` !`hpxX (08@HP @̀H,@`%>X $!>X `8 (0 @̀@ @̀  H ,@`#>X`$` (08@̀l2G?@ @̀='>X,0/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#>X` $`!>X `8 (0@̀ ->X  @uP->X"/> 44Ր  ! H,@` !X (08@HP @̀>Xt `?* `"" * `@">X  * `@&* *  ֊@* "``(  X`X X  c  mt@ >   >  @@   >  @@ #>%>|  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%b@>X"  *>X" (!`>X" ,H(  /  >P ==>WPH >X" 0> 5!> `|@"@!> $#H``> -"c  !>%#p!>'!`$ $ >%# 2> " > " > "!> "!@>#"">#"">#"#$>#"#L>$"">$"",>$"">$"">)"#\>)"#d0>+"!@@?@OGd#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP    "%>X> >X"  ">X>@ >X  >&b#  >&b,# J@*@ ` `*@ ?"@ 2"# @ "`*@ @ "`*@  "  ?J*@`8  ?"@ 2"> * >X >@ *>X >&"@" >X" >X"   >X4``6 >H` >X  !!`>O @g9> ",`"",> !|`"!| > Lj >X> !㘁`H2$j0>&@|#>&@y#>'@v switch rqswitch wchanswitch SRUN> >X: H> " (o!㘁`j> !8> :!H>*"2J "2 J    "2 J  J " > Κb+  @ #@"   *@ * HlH1 > "  `!㘀"I"j > !`"!j ` *@  ( !> !` (08 2㿠@ƚ>X`` Ъ@@>`€"Т@: H"  hH`>   >X>'" " " ?" ?> >X>' " " > >X>'" " > >X>'" " > ؀ >X>'" "" > >X>' " 2" > >X>'" 2" > >X>'" *" >X>'c" `2 `2`2" >X>'c" `2*`22`2"" @>'c " Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*>X`>)L` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >* "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a>X` """"""""""""""""@2?# * 2  `c  @ `> ?88 @ 3 >X!T c@  Њb@&""""  > c@ @> c ``44: " longjmp botch@" `&"`㿠>+@א" 6 0diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdrivevectoffsetslotluntargetphyleveladdrbpfilterlooprdkbddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKespFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100    2     2 out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d 㿘 H>Fa@"Ȁ 2"Ԑ  @i &""Ԁ 2"Ȑ  @i &""Ȁ >,"Ԁ 2">,@` 0D >]>, @X 0< D* ">,"@O " @ؐ  `.  . "*"@ *`"  *  , @Ǒ*  . . `&  @."" 6 f6 j>( `& |& t& @Y >X!P*"@ @\*`%s: unknown revision code, assuming ESP100 㿘 ` @!>] (!>," @!  ."`   (! >,"@!  ."   !"` W>,>-!*`     `  "` &"  "` &"   "    &". .    .     `   `   `   `  " @" `   `   `   `  "  `  <%s: resetting SCSI bus 㿘 `@>-!@J >] (!>," @A!g  ."`  [NCR_INIT(%d) %d] ncr53c9x_ecb㿐)>] ( >-""@@#!>] , 2"> 5>-!bX#\ L  @  $ ," 2  & & &  @" ""?07 ."6" "`, @Y Ȥ  "%   $ , "`, @H ,`  " `"  "`, @:``,`,   2 ٦@!&"&"  "  :    : `!`*"***@`  ." (!>," @!  ."`  0."@oregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS 㿐`   ,  #>]`(  >.`/!`I`J@_ ."`  2"`А"@ >X @ܒ#>XnaP!Pi @Ғ# @`" 2 `(!>," @5"\  ."`            + "6 @ ,`"* "@* &`"    2 "  " 2 "􀌠"?"  "          ` "n`I" T`/`@&"&"'    `  @2 "  ` "  `  " >] (!>," @"s  ."`  >] (!>," @"v  ."`    "`@@`/>] (!>," A@r"{ A ."`  A0  " "    `  ` .`,`@`,`I`*`J *`@  `..`." r 2q &"&"'    `  @2 "  ` "  `  !>] (!>," @"  ."   `!" @6"." (! >,"@"  ."`    (!>," @"  ."`   " "@  `@0H @ !>] ( >.@Ő!@ (!>," C@"Ɛ C ."`  C0+`!" @6".">] (!>," F@"ʐ F ."`  F0>] (!>," B@"̐ B ."`  B㿘H /d * % > 5!@'&` H 0㿘> #  `@? H / * % > 5@C!H 0` L@R>E`cD@r`  &`  [ncr53c9x_scsi_cmd] [0x%x, %d]->%d 㿘   '>]( >0@'"(( >0  @"@ @ *    @,``  [4$  @eL  2@$ > !8<$H /d * %  $"` $  $ ,`` " H 0c 2$ M  $  $ @ $  $ D  /]  $ @ $ < $$ D, HH /d4$* %$`$ `"%`  $ b  @{H 02  @" " @ @  @ [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] 㿘!>] ( >1@f!("!  `@ "`@ ;` ""   ( >1@L!@@(#贆2  [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure %d:%d busy 㿘/>]( "">1@""`" >1@"0``` `*     ` @  ` "`  @  !H /d* % ,     3 &> $  @d$   H 0@@Ғ$  < $  "` $$ , " > !8$   "$  `      `  H 0s@:,`I  2 H 0d@ * *@ 2  @  *@ 22 >1@"X , , * " ,`JH 0 `    , @``& `( @``"`& `@"@` ?$` & 0 "@>1`"@(`@`2`requesting sense 㿘``/  *  >] (  >2@ "@  .`/  * ,`,``  4   #&`@&`<&`D&` &` $,     9   2, @ , $  @2 b0 &@ " & &  &``  &` " [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%d sense=0x%02x error=%d 㿘` *  ,     ې+>]`( >3 ,@ (@``H (2  , `>3*`4  H2@p  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ (;0Q$ ( `( `$  (`" ,>3@F x ,`2>3>3 4@> @: @V @2  ," &  ."  , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@cĒ  `@%ncr53c9x_dequeue: lun %qx for ecb %p does not exist ncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p 㿘`  `*  ` 2,``  ,`  2  >3>3>3#@b2`I*"`I `J*`  "">3#P@J ?*`  ?&` @``"`& @`"[flushfifo] 㿘!>] ( >4@  (!>," @w$  ."   "   ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] 㿘``>40"&"""@@! @€ "` * ,` 6   @€ , &  % `   @€ , @ € "ܠ 6 " @€ , & "ܐ&"!>] (  >4`!>4!>4!"@  ( """ܠ : >4">4 @@!"ܠ *">4@ؐ!"܁[wrfifo(%d):㿘!>] ( >4#@Ȓ (  6 >4@>4@!Р &@>4@!ؠ  `@ " 2   `   & %s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d 㿘b   bb  b* *@>5 @[`!>] ? `.   @, `      `` `    ,bݰ `.@  >5 @"`!>],b$` ````+`b5`@ . "* b@* & b  ` 2 b b 2 b􀎠"?b  b `  `  `    !>] ( >5!@ @̔%X (!>," @Ĕ%X` ,b`   bbĐ @ ` @ ( >5!@ @%Z (!>," @%Z` ,b`   bbĐ @` ,b4b< $bD>$b ( >5!@ @%c (! >,"@%c` ,b`   bbĒ`@  ( >5!@ @l%g (!>," @d%g` ,b`   bbĒ`@ 4b,b [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET 㿘+>]`( >6"@g!"܀ 2">6!@_ 0`(" >6" @T "&"ܐ ."`( >6" @@H"X" `(!>," @=%  ."`  >6"ܐ"p"@/ @ 0"܀` >5!@ @$%`(!>," @%  ."`  ""Đ 6"Ē`A0.""2""Ԙ    `  ( `         `  `?``(`(!>," @ה%Ő  ."`  0!">6" @"@Ɣ " &"  ""2  "  *  `"K>; l*` `(">6@"" 6  @ ">6"@ &" ! " $D" ( ."`(">6"@""€ @"| `("M!2">6` "`@k `(">6@e#`(! >,"@]%  ."`     ,     +         I  ` J*  ",J" `?*`,J,I *`T"`>6` # `@" " ."  ,  "`     `   `  /">6` #H`@  ,`("!>6@#p"`(">6 #x@ "`(">6@#  $" ." !$ `(">6@А#"$<"$D`(">6@Ő#<&"D&"`(">6 @#" `  " `F`(">6 ` `@#" ` N!>] `,"  , ," "   ``|!@ >6@#"  , ,`( >5!@ @{&^`(!Z>," T&^d @  @!- @*`@*`" "@ ,`"* "@* &`,`"* "@ّ* ,@y >7 @C" 21  "@6 ",   ,  ,`( >5!@ @(&{`(!>," &{@  ."`  ""Đ @`."6"Đ ," ."  `+ "" @틒 ,`"* "@탑* &`"    2 "  " 2 ""?"  "          ">7 (@ "  2L,  @, +@ " @8 ,`"* "@0* &`"    2 "  ``" 2 ""?"  "             ,@ >7@g @!>]`("">7@^ p@ >7@X x!>] ( >5!@ @O& (!>," @G&  ."`  ""Đ @c`" 2>7"`2 >7   U"  >7 @! `(6"  C"@F >7!(@ `( >5!@ @ &`(!>," @&  ."`  ""Đ @` >5!@ @&`(!>," @&  ."`  ""Đ @` ."6""Ā >] (!>," @˔&ϐ  ."`  >] (!>," @&  ."`  " ."&"܁||4TTT[ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus 㿐!>] ( >;"Đ @`"" @" "=" (!>," @Q&  ."   6")&"Ѐ ">; ( >5"Ɛ!@@;& (!>," @3&  ."`  ""Đ @"."@ 6"Đ!( @&"Ѐ 2""Ě "ƒ    * 6"6"6"€&"@"""Д ƀ""""r  " """     "ȑ* *@"Ȑ *`"Ȥ*` "*  "* " &"  ,  +@ " @Q ,`"* "@I* &`"    2 "  ``" 2 ""?"  "          ]"Ȕ     "ȑ* *@"Ȥ*`"*  "* I&"" >;!X @n'"  "Ȑ 9*@ >;!X @_'+   I"* J"* (&"Д  "."*@   *    , , *@   "Ȑ  *@ *@  "."*@"&"" 2""̐T">] (!>," @'l  ."`  0W"@8  '"̔"П@  `   `  @2 "  ` "  `  !>] (!>," @ה'u  ."`   (! >,"@ǔ'v  ."`    @[ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %dncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting x>] ( >="@ 8 `@ 2   € . @€ " ` .  @€ .  @€  . `$`" @ 2! &"!>] ( >.    @  <  -& < @€   (! >,"@Ɣ'  ."   c " >= @ X^   >= p@T  0@Y  @( @€   (! >,"@'  ."   0 "  2  "`, @"-""  ." ">=" " @i" @€    (! >,"@Z'  ."    " ` ." @ "C  `@?2  >= @9 А   ` @ 2  2* " "& "`2"" >="   #\ @  2 >= !8  ?D#\@ B>=!@ "  ( >5!@ @(@ (!>," @(@  ."`  ""Đ @` >5!@ @֔(B (!>," @Δ(B  ."`  ""Đ @`."6" ` !>]6" ( >= ! @ ` @€   (!>," @(J  ."`   (!>," D@(Q  D."`  D"?`q>E!8*`  "`, `*    2  2 4  8 * "@`"  "`  "@ @W   2" ">=@v >=@B!  "*  `."  , " 2>=!@.  >=@("ѐ>=@#" @y  d"`,g& "`q>E!*` >= @ "8 "  >=@"h>=@"b""   € >="@  ?  € >=@ߐ"А ? ` "6"ƀ 6"6".">] ( >=@Ȑ"@y> $ " & &  $  $ & " `.">= @"hTX   $"" "" >=  ""#\@ ; ."#>]`( >=#@@ ` """ ."`(!>," @v)  ."`   " " "" 2"" ."" >=  @X#P ) 0ː ` 2B>>2>=@# ` * `+>E!*` >] (!>," @2)>  ."`  ! `2 " I 2">=d# >=_#` #>]`( >5!@ @@ )M`(!>," @)M  ."`  ""Đ @`@."6"  F ", , " ." I !>] ( >5!@!@)U (!>," @ٔ)U  ."`  ""Đ @<a ( >5!@ @Ĕ)W (!>," @)W  ."`  ""Đ @`!>] ( >5!@!@)Z (!>," @)Z  ."`  ""Đ @a."6"Đ w&"" " " @€  i @€  `>=`#  #`#\@o !>] (!>," @f)z  ."`   ( >5!@ @V){ (!>," @N){  ."`  ""Ē`@ 6".">] (!>," @6)  ."`  !" !"䀠*  >>` #\#`2 `@ !&"< &"D."w&"  X `@  >] (! >,"@)  ."   蝐 " X  `.">>   @  "܀>> @ے ""ܐ ?,H""Ԑ ?#>]`( @>> !@ɔ >> ! " $D" ( ."! @ &"`(!>," @)ː  ."`  0>>!@ @ K " 2>>2">>@:!X #>]  4`(| @ >>Ȑ"p"!>]! >>"p>>"p>] ( @>>@m!p&"!>] ( @" >>@a! /"  ( 2" (!>," @M)  ."`  " ." (! >,"@:)  ."`  $ >>" 2 ">> ! @# """@ ߀ ."˒`?   ! @  b&">> /"@@ @€  `(!>," @*  ."`  " X/@ &"&"`'"" @ `   `  @2 "  ` "  `  `(!>," @*#  ."`  `(! >,"@*&  ."`    @ @’/`(!>," @**  ."`    &"!>] ( @>>"@v"8 (!>," @n*0  ."   ""@8 " '" @*&" @>>@Q"P" 2"`(!>," @E*9 ."   ""@8 "' " @ &" >$     `  @2 "  ` "  `  !>] (!>," @*F  ."`   (! >,`"  @*P   ."   `   @O `( @>>@А"`" ."`(!>," @Ŕ*V  ."   &"@ b+  ."쌐% @Ґ"@4 2В@@@ '"@  ? `@ 2 @@@$  0|  l8 L   T@㿘` 'А @&`&`  @;" !'!>] ( >5!@ @]* (!>," @U*  ."`  ""Ē`@ 6"."А"@@ #@͐'>X_aP >X!PY'@’#`@tq0  DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled p  `` *``@   € ` @ >E"x>E" ">E#\ "#`#d" #h"#l"#p"#t" #x D#|@ HH /d4 * % @  >E@#焒 0!>E@#  $,5   " @ɐ>E@#(`  `*  $ H 0㿘> !8=H /d * %  ̠   "'`@6 2  2 4  8* $@`"  "`  "@ @Q  ֠ @H 0>X!P*"@  H@s{*`㿘 @€  . @€ " ` .  @€ .  @€  . `$`" @ 2! &">] ( >.    @ leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook㿘@  D r>J t>K>J?  0`"& & & 6 d& 0@,_@3:!p 8&!p!p @!  @ @"  >F@ @@@" >F@ " >F        &!t&!x@5# !>F!@2#H@!t>F!x@~#X>a>K"| @cW &!`>F@#!t *&!!x *`&!*  * &!&!&!㿘H o*@ g@ H 0h d! 77! !* ! ! + ! *! @  77ސ 0@7!l&!|!&!@!t07&!&!?* !l!!x 707?* !7! !t 6!x !:!l!@!0 , //7Ԑ 77֒П@ !t f!x  !, !l!@!00 /7̐7/7Βȟ !x f㿘!0  %s: controller failed to initialize 㿘!0  ^ d!4`"!d@!d!0 b!!l  !0, 2!04  A d!0  a" !,€ !"?!,€ !!0 !B d6 b @ ;6 d@А 0!8>G#@r !8`@%s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled 㿈!,€  ?Q !0  !0  @   & ( | & |>H @"80  >H @"P |`& |! $>H @"h `&   "!| @ 2  >H!x@˒  a>H!@Ē ] |  >H!@ T |,?@!*` ?퀢%I@   @M   = @ 9   0 $ $ $ ` ',쀢  @   쀤@k    쀢 ( ' $ 8 $ !$ %$@ج쀤 2 x |  & | X `& x @%z@/ 0! :/77 !t" !, !  h"&!|"o V!`@ ;<6 d @>H!@+  @>H!@" 0@Ah!<`>H@!@ @  &  >H" @   &   & ``  "   &   & !x " !?&!!  , ! ! `" d 0@)&!! "6 b %s: device timeout 㿘>Ic @  T`[& Tmissing buffer, no_td = %d, last_td = %d 㿐 4 $@ @ ",@$,*    `2L H /f * ' T > ߒc*`@ ?2@   @   "# 8@  <"`< < 8"`8>  $@   ( $ 0 , @M 4 $ 0 ?4 > "p@H 0R H /f * ' T > ߒc*`@ ?2@   @Ů   "# 8@  <"`< < 8"`8>  $@Ɛ   ( $ 0 , @L 4 $ 0 ?4 > "p@H 0 2b ;   <(" <  6 20 /77 0  Hx "   $ 4$'6 4,@   >J 4d6 4 H@    & & $  ?& 2 ($㿘H /f * '  0@,D   H 00\a2@a1@5a @a@"4G 0!5@70 !6@3 0<4 44  @J 0.@  244 ?#44 2 @0@/ @/ 4  !@ !D@1d H 0㿘V㿘 4!:<6`6`6`6@ ' @  +?      @;n # 222< 22*@  * @6@ 2  א 4 = 6 4 4<"6 46@6`6`6`㿐!h'u@㿐!h'k㿐!h'@ɐdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKrdramdisk: multiple attach calls? rd%d㿘> 6\ >L@ 0) $  4 %> 6>]`  " "\@"  @IƐ ؠ@~ ؕ,``" >L`$ @  @ `@ 㿘`@͒`>] `&`&`X@u`0 ? > 60\ 6 > 6`* " Ȁ" đ2 㿘?2  > 6 \6 6 > 6 `*      @  Ȁ "  а .  ? 0 2 > 6`(   Ё 㿘>L>#`  @MB㿘>L>#`  @M6 㿘 D? 2`  2 > 6* ``@`Ȁ 6  23 <`& $"` $ 4@g\ 00 T <* & @`Ā   0@"0" 8`  0   HU @  HO @" & @ <& @ 0 (& 4& 0@-? 2  @2> 6 `*`   m@T "@Ve e@ 0r "@V  k eg@gf@ e ``Ȁ _@f 6!V R`O  @e F e g@B? 2  `@?`4 # @ `* * >Lc`@ʊ,`Ȁ '& $    `ʔ   `Ȁ    0  @g@u RAM diskfictitious㽘'> 5Ȑ@ !@" "$ ($ 0`đ2 $ ,$ 4$ 8 d$ 8>Mbؔ @ڋ  4 >M b@ڄ  ,. (4 H2`  $ <4 J$ X$ $   aW4 $$ , @r? 2`  ?6  +  *4  >Lc`@L  㿘`>k `@O4   & & &   㿘@=`# @@ :$   ` $ $ @ $ İ$ $ rd_idle㿘  >N @dR @̀ >] $$ T$ $ <* $ @Ā   0@"    " @8  0   H5  H5  @"$ @  0$ 4($ 0@ɐ́diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUT㿘 \ @  *@F>] `  ̠? ܡ  h ? 2: \ 2  3  X* \  * \`* h>]  `Р?,  \v  h 렄? \ `*   $ \ h @2 h \ `*@&㿘 \ E >] `  ̠? I  h ? 29& 2  2  X .   \`* h>]  `Р?,  \  h 렄? \ `*   $& h @2 h&㿘  Ȥ >P$@j``8 8  *, $L"@  d  6 :&%L& * \ * `* h* t  h* `@㿘 \ *@ʐ! \ * `a*@ d"*@ t @۽㿘    `@@  @&  @ڐ㿘 `" @   & %P 2   \  ``*ۇ%P &%P@ `@ncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d 㿘H /d4* %  >O@#0  ` >O # @   &  2   $L * *`@"  @nH 0ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finish㿘    `d>P@!H /d`* %`   >P  !0@8 @  >P@ِ!X     Ȗ`8+ $ `?#  4`  `# #   #  $# # #  Đ $ 2$$H @    >P@!H 0ncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad state㿘 2 >P@c#` 2 >P@]#  @ " >P@P# ,  $,, 22  `"  #` `>P  "  $,   >P@#$,$ & &  $L *`*  &"  >P #@n  $, 2& >Q@  $L *`* @" @hԐ $ Đ& `@T$& ncr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? 㿘  ` @ " >Q@! "$H>Q@!&$H  *"  *     ̒  $L@ - ,   Ȗ 8   Ȁ    `@0& @ "-   x>Q @Ґ" %P 3`, $L"@&    &  `& &%L&%P&%T&%X``0  >Q"@@ $, &%L& & &%P&%T&%X   $  & <&%P 9b !3&%P@2  >Q"p@ &  "  "    @& € "   `" @   >X!P؇@# @g @ "H ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d 㿐 " h>R@! )>] @ Т`>Rؚ  h ɀ @2ؑ  X   >R" `   *@"  >R"0 @Δ 0.  \ *@ k  h "  \`>R"P@  \>]* h* t h `̠? M  h ֠? >R"x@ U 2  >R " d* X  />R" @ > ,* $L@0>R &  &  &  & @&%L&%P&%T&%X `*  ` $*@   `" @  0*!@L #0#"Д@E    \ & *@    &%L&%P@2 d * h* t  h* ?& 㿘`  `d*`\*``*H /f * ' `X *@`` *@`\ $`\צ `\? @ מ `\ @ 2 `\  *@ה`\ "```\*``*H 0֐T *`h*H 0` * `X*@`\*m `\ * g`h @'a?^ `h @?  `\*@Q `h @2`\`d *@`\ *`` *`h*`t `h*0`\ *` ```` $*@ %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT 㿘   d * \%L ` %p:" ?& %h&%p  h @ @ >] `  ̠?   h  ?   2   2 l " %P 2   \  ``*%P  `&%P&  2@ \`$ X%P 2   \  ``*֯%P  `&%P)& = ` `%p*  &%p%h `  (:%h`27%h`%h .`$  \%h 2 \%i @"$%h \* h>]  `Р? r  h Ǡ? 2 \ *@h%h` 9>U"X*` ]%P  %X \  ``*I%P \5%X "9 H \`   B %  =%  &  8& %j   >T!@ %P>T!@@z %P 2 %P \  ``*%P \ &%P @ 4( %P ` &  \  ``*%P &%P \* h>]  `Р?   h ܠ? 2 \ *@ޤT\TTTTU$U$TUTd%s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP 㿘 d   * \ @  *@%L` %d%\@z"%P%T &%P&%T%P%T  *  &%P&%T` 2&%X>V!*`  2 >U(" :     2  .%\       .%\ >U"@  .%\ >U"@  %]J&%d @M>] B  h @ ?  2> \ @2   28 \2 %d%P 2 %d \ *@# %d&%d X>]  * \*  h ?  2 \ *@ `4 h%P p` \ *@`"XLXX(XlX8XlXlXlX XlXlXlXlXlXlXlX0XlXlXlXlXlXlXlXlXlXlXlXlXlXlXlWĝ㿐   d*  /  *`// ///     @` $ , %P ` &  \  ``*ԝ%P &%P %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding 㿘 ` @`>V<#X d*@4  j   `>]`* @ >V#p@ 0[2   @>V# 4` `   h  h 2  ; >V#@ $ "  d & d @) `*  x  |    @ " $ $ %P ` $  \  ``*%P  $%Pncr5380_status: none? 㿐 d  *@   >W& @=!ȁ ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... 㿘 2 >W@}"02>W@}y"P m  h @ @>W@~Ő"p $,X` @>]`  Ƞ?   D>W -"V d h ? h 2   >X#ԓ,  ɒ/n+F'#!>W"@~ %P ` &  \  ``*%P &%P>W"@~n `&%L`") l   @ "   &  @ t `" l%P    \  ``*%P &%P l >W#@~: %P    \  ``*%P &%P`^`` >W`& #0@~ ```  `>W#X @~  &  H$(`2>] h `ҥ  h @" \? >W#x@} ǐ \ * ` * d`* h* t  h*  &%L&%X& & & & &%P&%T````````diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㾘> ax R "ax@Ɛ>  X2 `8 @y`Ho o)> !h a ?*a!h ` `, @В @   ,  , ,> ˄H( @ <`C B8 ,$8(H 0>X!P*` *> Ғ"@  8@`*`> ҁ x㿘> aha> a "a*a @ H a*a @ *@ a*@ B 8 @ 㿘> !h!> !`"!*! ` H ! @ *! `  * ! * !` ! `"!*! ` D ! @ *! ` (* ! * ! ! `"! `*! +  ! `@ `*!  * ! * ! ; ! `"!*! ` +  ! `@ *! `  * ! * 㿘%> , 0!>  T> >[ h`L@_> >Y  8@_a> ǔX  @ @" $ T $`> ː H"@Ϋ"> ̒$@Χ! > !h* ``> I  $,? 0     ;n vAMaX ֣d° x㿐> #, À > Ǔ. "X@ . @`  􀢠O@` `" # & & 4 4 :?  :?#: : ::2>]>] `ܐ" :  &  0 > ˔Hx`B j:x$`$`$@2 2 Ho o>]`> ͐!`@:<>]܀@  #`؀ > > ː H pB: pH 00<"" " "  H `+` B ; ` `ؒ`B  ;@ܛ. !! @  @8@B B; <@  >  T   > " @^ hH 0㿐> @_( h#> ˔`Hh`B :hHo 0f'` '`H 0  >  T `  T" 2 c* # T +`g T c᜘ *`  *1 # **  c*`  (     >Z!*` 3 # Ĉ `H @B <`H  & &   `   & @Xΐ Ho o>]>] ؀>   !@ <""ܒ `2` &H 0 0 )> 䀦`Z T@~H/` / @̓2`,"@$$H 0@͠@ X耤@/ //@ //  // /m$ f $ G T@ > ː H .`@ C : rndrd`  `@8? 2  @`e>\"*` ^ !>  T V #> ˖H X> ``C :X>\ `X!  @VM A T 2 @8> ˔H`B :?#H.`,`:`&ιη?c ?, ,` " ?# ,  0   ?#@M0 ` 2`ppqxqr`` 0> X@  ?  2  2`{  2`v @8*`2 ?# @L ]?` , * 2`  * , 2 ?#??@>  T ` @"  T2 c* # T +`g T c᜘ *`  *1 # **  c*`  (     >Z!*` ?3 # ?Ģ` ?` 2`? 2   > "!x㿘 "@$ "@ "c 8""@"G  @"u   "@"   b~@b}@ 0Ho o>  X&H 0o!2@A 2h Ho o>  T`  "`"`H 0Q!2@A 2J Ho o> " XH 0;!2@A 24 >  X ?- #Ho o> "!xH 0!2@A  Ho o> ː H@"H 0 ` diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map   `  ``\ ("  `X8 `@ "8 @"" diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe maph ?` @@ ''` ' '` '& ` @`   `X < @?  @' Y 2ذ `T@9.  @ @Ɣ !   @ @䴔`     @Z T @>   @E @ `&T'` '`N@ =`?'؀`Բ`'Ѐ  ("$ , X$ ,  ' $ , : @Z U> Ӓ`` ' "` X " ,@G ,  :@> 9 H   ,*w yu'  ! n7T A 2  `? ZԀN@ ."` 5 N! @uN! q@ ,@-!  @4' T* ' ,('耢 1$ , @'T* 'ܰ$ 0 0@p`2 'ܒ@$ U' ,̐$ , ,j܀%$ 0 ,耢 A:@:@ @͢ :` @  H $$ ,䀢  ( '$ , "`@͂`@@|Ѐq o?@$ 0䀢 > Ӓ`` "` Ѐ  ,$ (") 0@V @ܔ 0 @ `X@ @ `@i0= / ,@^  '@0-  @+@㎐&@ `X@ @ @  @Ē &`@@ 㿐  `@ `?@ @ '` H @ & 'diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>X!h>  9 @Iі`> > "c"0 㿘> #>  `> ґ6` @ cȑ* @ "  @2 @2  `@⒔ > 0 2  㿘>  ``3`  > Ґ cȑ* @@> ɀ`#` 2@` 2@ `2``2"`&& " 4 @1    2   " "cd9660_inactive: pushing active㿘 >c !    D >a h@挒$  @ x @  cd9660_reclaim: pushing active㿘 >c!    D >a!@g@і " @1$  @6 :&  㿐  '  6`x6``@     `.  :􀦠< H 26  @`x!6`x @2 `x @6`x  2 `x 6`x  2 `x 6`x  2 `x 6`x  @2 `x 6`x  * @&`|  * @&` `x&`!m6`x&`| @˘㿐'􀦠 `@   `*  :~ 􀦠' H 2! `` =@  @  @`p  ```d&`p&`t @`h  `p`t&`h&`l  `p@ `p`t&`h&`l&``&`d @E㿘 gl '    &`&@H đ*` * " * " `  @* @, : $ @  d@? * @,`,`* :`* $ @"?, * * "@*`@*`" 0*  ``d ,:`*`" *  * $&@&`   * ( Д  㿐 ?/  /  /  / ߒ / ے  //~   ( *  (` (diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map (@2 x  *   (@*  |  *   (@*    (@2`"`RRIP without PX field? 㿘>c@s 0@O ..RRIP with incorrect flags?㿘  `(`$G`0`2 `,6  /,@ ` >c p ` ! >c"4*`   $@ `$@   @˻> ">  !   >c@sd x`, `,   @`(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`tp$,8\RRIP with incorrect NM flags? 㿘N >c p`  >c#*`   > ">  !    ?>c@r"`, `(@2*``,2`@  ` ?`(&``$""@&`$2`$x`$&`$ `  ?&`40 DDDDDDDDDDDDDDDDDDDDDDDDDDDD㿐>c`$`pA N !   !`a`  #\ `$ `@`(0`( `( 2@   (  *` (` ( `"`JC  `( x0"`㿘  (  2 "@@`h  @_ h  @`` @ h l" `" d  -@`p.` 2  "@@`h  @9 h  @`` @ h l" `" d  @`p`@ h l" p" t` ?&` 㿘@    ( ` (  `*` ( ` * (?  02?  0?@ * @(@@ `  `㿘 `? @`@&`!\` ` `*   (* "`  ` *  * * : :`` $ `*  (* "`IEEE_1282IEEE_P1282RRIP_1991A㿘  2,   `  2% ` 2  >e` @Ɂ 2   2` >e`@t  >e`@m  `" =&`㿐 `!`' `!a`@ 2`  *`  *` *`L "\`!X  ` )&` `  "`L@L@2 L`L @2 €` 8 ` (`@`: `` .`+ ``# :` B8 2  + ?@V   H``@ Ӱ. @y  2  €   2 ` '>]''ܔ^X6  !` x`!7'' '''ܐ !@o>]` !PIJ` ?'Đ;`$  7>]'6'''Ĕ') SP`>f! "&a\@}     1&a\@t  2?"'>]'ܐ "? diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map *    ? * 㿐Lf ;) ;Z  А S, * @ ?Ѐ –.`@*`@ <$    ? ,"@ *"@  " . ; 0 ;   ??? 㿐`\    =. `.c  ;` .F6diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcd9660_mountroot: can't setup bdevvp'scd9660root_device > #> > 2"@ecİ  >g> 5!#> @]c >g@oI!h08>g>g!a@ٛ 0c'@   ?"@z@/ 0> ͔""` 2""@"`@ D@^@Ð    p  <`@| @   @ἔo @&(&&$&&,@ d< "@ܪ[ > - aH& @ܠQ   `@ @@[! @0; @<@@2  @8  @s ! Y1 Z`@$@ & Y `@$@ L, p@, D0@OCD001%/@%/C%/E㿀  '`< ''   'o @b j@ > #a `@  @ؚ V耢   ?@ K0c ?@L ('  7 V'(@Ú? >h Ha @&  2   " 4 :0 - ''&l '`X>ha@  " >ha @  " >ha(@  "  ` 2   @ā' c @w'? * b> ?   9@- !d@Œ!d$`P a( P* @ *@ *@ $` "L ` `* * `  *` $aL ` `+  * `@ *@ @ $aP$`9$a`?$`0`%0@*&a&`d` `< &`h&`<&`@$`$`$` " l %  ?aL`* ` @` O H $aXl l ?&l`0 "`0@'l  $@` $aT $aTaT #!`ݔ "` ` `*  *` * $aL  `*`  * *` $a`$aP0 %0$ @þ    @õ @ð   耢   @?`@- 9&a㿘@($`D  (`,$`<$`0$`T@ƭ8$`@@@: J>h`Ha @  B > c 5? * b ,( (@Z   8@V *"@"@ !W<  @&&&.6&&&&.&@V6 `0 $`0@6 㿘6` @2 a   ?" @ @E @-/ 9`<*@$`<$a㿘!!(R!T `?@v -㿘! D @ &`&` &`&` &`&`&` `T Z ` Z!La p&`8  㿐 `` &` x  &@k & F㿘 @1 isoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] 㿈!ې &  > "4 @.  & :@+  @ؒ >j 4 @' "`$$$  @ه "!2F'6@ @ F>j"@`!  @ F>j"@k0ْ , ?@  @հ@2>j#@k0 H @ @ " @ >j #(@kt@  F$  @t$ 6@$\@     @؛0 H    *`  * *` $T  *`  **`  $X  $\"`<T & "'  *  :Ė '&쀢 " @H "x@x< @>c!2`  `-" <>l *` @6 -0.>  " 8@' >  $ " a|" 8@ا@k$ 'X:  @x TL@`@ "`@ &TTD  2@ "`\"`㿘!@ݏ`  `0`4&& diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map `@, `2- ` 2) `$2% `,2! `?2 `2 <`"  < >l(      㿘  `x` /  @9`|`   `$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X: < `X .  < 2*   @)M$      $?'''''''''''@[耢 А$ < @*  $ <$ @`$ `X :< H <$ 㿀    0  6 @c 0 $   `@ْ ` ` @ %8X @:b   2q `; l ;  > Ȁ   >  ('`X* ) :`?#\#`@1" `X* `?'#\#`@ ?@Ř$@%8 H@#8 㿘"" N" =`?  " !!? 2!@Ӑ ""!  # ! 2%.!   # ". "   ?  6"#(!># I"  #(>#A" ..㿈`#P`  `  @''`  ,a,`,b,a,`$c0 $cD` 2 / @'ǔ $cD$cH $c@`nbbS `?,bc(8  b  4b ,bL!  ,b % 2 !TL! 2!T ,b   !``?#\! `b' ,b!T 2c(c(b c(?`c c,8^c(  !T  ,bȐ & `` @(^ cH'"@`" "c8@<c8>`` c@@(I"㿐    !T " V ? ?2@*@  @  +  H   (`@  :  $@ @& Ĕ  ` @( @ 0@`  `@" $` "@"  "@:8@' 㿘  @7 @j 㿘  @- @` 㿘   @" 4㿘    ` @"ِ 4cd9660_strategy: spec㿘` \<? >o@e# T P@2 T   T@Q "  T 0h$ 0@k$ 40?2 T H@ <$ @ T?>e ` $ D8*` @ 0@Q tag VT_ISOFS, isofs vnode 㿘>p@f  㿘  @" 4 >p( T     % $ "     diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘` `* @?2 "! @ "8! !0@! @ @@t @t`exec: a VTEXT vnode has writecount != 0㿘`&``&`` &```  &``&a` 2`` ``H  `@ c >p@d"`@I```@ >t@``>t*` ``&`* "`$ `$ ` $ @` $ $ ``@*`@``* @` &`*`" ` $ `$ ` $ @`` $ $ ``@*`@Ԑ``>t* @` &`*`d" `  "`` """ @"㿘`&``&``c  2 * &`` ` &``&a``@ >t@``>t*` d``&`* "`$ `$ ` $ @y`  $ $ ``@*`@``* @` &`*`" ` $ `$ ` $ @[``  $ $ `> `@` * @ "@ ``@ >t@S``>t*` ``&`*d"  " " " " " @㿘`&``&`` &`` ` &``&a``@*`@(``>t* @` &`*`d"  `` $ `$ ` $ @`  $ $ )> ` `@` * @ "@  ``@ >t@``>t*` ``&`*d"  " " " " "   `` *  , &`@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%d㿐a`? *?` &>ra0@  2# `  @8  @ L  2` ,  @ J@ 2`*@ @*L     J@ "` "` L %  J@    2`J@ "`*@`J@ "` "`J@ " ` `J@ *@`` , ` `!@`  "-`a ">r@b!8@ a a  &a2` >c"("``"`(2 `, ?"`,`0?"`0`, "`@AH`0` "` ?" a  &a@"   ?@"@\$@ ` ? @"$`@P`$ ?@" $a  >r @$   >r@b2!ha a@c $`&` `  4@А@ 2"`a  &a@@춒 @$ a&a  `&a`(2``" $- `*" " 4a   &a ?&aa@ 5 `@@쎒 `  4@#@  @# ?  @# ?@n`diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessary/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/exec_subr.cocnt > 0㿘 `>s@a# ,`>s>s>s"xc h@ag ^,`& ? @"*  j,   @ @#z ?& 㿘  :    " @{   `  & @#\ ? && 㿐`,>  ` 2( ` 2$  "`  @j  2` A`c  ` #`` #\@4*  `@ 0 㿀` .> Ƞ ` c*&` #`  * #\` ?@4? 2&  #`#\@ ` #d`` ` #h@#l 2`2`   ` @  8  @= @ 㿐`> Ȓ``A`#*&```   * #``#\ ?@3ƚ?  㿘<&`>&`>   4 * `&a`*```>t* bd` &`*"@ @ `a`" " "``"`"`"` "```@*``` * ` &`*"@ a@ "`a`" "`"`"` "` diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned㿀@> Ң!> @FL"#@>>^@ad!>u@aa @$#@K@@j@@:@Dn@W@6@%@n@{> `$``"` "$` > چ $a> @ $`8@`8"`<"$`<> @ # @" " > ڒ" $`D$`@> ˖   # >^"bؚ  $`,$`>u,`1,a a   >a `p@D1>bԐ`@D,> ! $`@)" `>^"@`'> @8҆ X2`  " 2 &2 $$8>    " " " $`$` Г(?@; :>X!l @ @< @4$!> Ƞ   8+@ 8  P< Ʉ8 <`#$> >   @B`>X   $`$a $` @% @>@"5@<@`@>] `    $ @  2 H /f* '@M @cH 0@;C@,> ɐ $`$@->a@4"x>^!Ԁ @ > >u@^ <%>  "<  €x x>u@^ 8 @C$ x @펔@^$ > !8> ِ!8 !> "##"`#``> ""`0`0" #!#`#`#`>wa`$`$`#\   @ ">>u@^ >u"В @ ">w>u@^ >u#L @֔ ">w>u@^ >u#4 @ʔ ">w>u@^!>u#  @ ">>u@^!(>u $8 @ >u@^{!H@ @z@@>  @!"b4/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d P>w 8 @ '''''@,  `>w>w@_ H0@_ p0@Sinit: couldn't allocate argument spaceexec %s: error %d init: not found no inith> "#Pɐ-> > " c'#`#\Ԗ ?@1 ?  >w@]! >^"bGb> "h  -/Ԁ@ِ s/ِڦ  * " $@  @y $@  ?H ?B?>'''@N蔒 >w!(@_  2> >w@_!@>w@]!X㿘> @#㿘> @#㿘@Tdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapP !2@'U J@  '''''ܐ@+ ;@ <    @@ , #> `( > > # > @<$!`(  > #@@ݒ > "#$`(@ @$`( 2  $`(@ɒ @>  (  ` $ @*$#?:  Ȕ@) @7@7`'H /i * * > a8ؒa8"'`" `'А"@@?''H 0 @a7Ж ̐"?' '?/!''>X!P1>X!T@" 7``` @ 7`0 `,@5 7`'` ,` '  "? l?' 3 /@ڐ  #`#\#d#h#l  ( @. @)$㿘@a . c   6  `  # (.` 6 `.` @.`6 acct㿘> ǔ!!   >y>y!@q Accounting resumed Accounting suspended #> c`"!> `< 2 `X  ?@Ŗ O$c P >`\"@. dd@1c> >y"($c$` (`$> `< 2 `X  ?@桖 +$ ( P >`\k"@  dd@  (>y$c$ (`@\ >X"!@A >X!P>`T#> !>ya  (@9 #> ǁdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘 > 6> 6" @tv"`> !t`> >X!P ""@> "`㿘> #`)>  @` >X  >X!T@?@ 2 @,  >X  >X!T@?/ > ɐ@,z > !t > @<> > "P>X`!T "> 6> aL "" " > 耢> # " " > a8Д b?" ?/!"a8 #a8> Җc "?/!"c #c@@ / >XH 0!@@t0 >  *`M  0{ 㿘H > !8!8  ""@ H 0  А"@? - (c(c' >X, "@*`" * * >XaT?@  !P1#@ #G>XaT@   #㿘  &- (c`(c& >X. "@*`" * * >XaT?@  !P%@4 >XaT@   #㿘 , (> " `& ,`!""> !t H /m * . >  > 6> > 6""`@s"H 0㿘 , &> " ߒ& ,`""> t H /m * . t > 6> 6"`@s"H 0㿘 @#> 6> # ,  @_ > 6`? S"` L! `B < > ْc` 1"`> c ,"c`? <"` > >H c >  ؒ`B < > ْc`  "`  >  В`B < Д "> ْc` "`> 6 > 6"  d> b8 ` $ d> 6`  "`@9㿀>X>X!P>XaT> > 'X'"'t`' ' @3 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapfileplfdescpl㿐!>a#> >{# c#\ 8  @OO > >{#\!c!@  @OE > ""< :((6(  6 *  ? * "?fd_unused: fd_lastfile inconsistent @*`2,  㿐`@ 2 0   $ 0 @  0 ,?`$ 0@7 0  @@ɘdup2: fdalloc㿐`@  ` 9 ` 5>X!l@ @. 2 0&)  $ 0@@  0 ,?`$ 0@7 0 @@ː@">|@X!Ȓ@zx@ @ m 2 0]  $ 0`` N>~ *`   `  A  (> 0>X!l@7@nܰ  22 0@ 0 ,?`$ 0@7T 0ːܐ@3%  &`  @ *@ @ ? *@ * :` ?* :  ` & ؒ 34 ` '  ̒@ 4   `'ؐ~ 2 0  `@' } ߒ~  ?4 '   0T 2  ( <& `wذ &T  ` ("`< "`@ "`D  @ 2!  &`   `v` PT  ` (  2 0W W䀒@耢 6 薠 ` ? @ b  @ B ?W "%   h 0 d 0  ",`$,   ,`$,   @@CT =  (`  26 0W W䀒@耢 6 薠 ` ? @ b  @ B ?W      @O @ 2  0`   0 ,?`$ 0@6' 0h0`D0,㿘 . `"` `0 $`0` #@2< "   @ ?*@`  &` `0`,?`&`0@5`0`> +   +@@"   ?2   3 * +@@"  4$ ` ' H@ @ 㿘.`"  @>`&  * ?2   2*`  * *#  `  * *"  @>|@Vǐ W& 㿘 .` `2`09  $`0"  * @>`$  * ?2   2*`  * *#  `  * *"  @>|@V 2 H$  H@@ -@'㿘@ >  8`/@ 2 0"  $ 0   0 ,?`$ 0@52 0  a2`@ 0 2'` `㿘 @ 2 0"  $ 0T "`  -`   "& @ ( - 0 ,?`$ 0@4 0㿘  >X al@8@ @&: <` ! <`  , "@ ?2 ?2,  2  2 *  ?, ?2,   , ?ڐ8??O `-   <  , "@ ?2 ?2,   , ?8?-  * @@6$<`+  ` +@@"  ?2 3 * +@@" @4$ @$$ &   㿘` "( @ o 1 2* .  ' @* [$@R@&  @_ '  :`: ` :`: @7 ',` @,` ' @ސ :  : * '@@$ :  : * @~$@ :  :  $ $@# '@  '$$$$$ @0 file㿐   2vy> >X!l@0  @;`&  *?2   2*`  * *#   ` * *" @>|@T͐ > \& >@T!= `"> ʒ @K# @ 8 $ , `" > @ $@" "@ $ b<b< $b<" "b<$   `@* "@$  $ @ "@&@& 0 $ 0 fdexpand㿘 > В @K!@֒!@  @$` $` @>`( $ @  >^!Ғ`X ` ``?4`&4`$$@$`$`$`$`$`H$` $` &0& 㿘 > В @K!8 X  " @™ " @“  `6 & X &&   @: `c*`@4`,` '@ & &`< :   '  &  &  @, & ,  '@ & & ,` < < ,  ,   H?  @ "  R 2  `@ ?& H& L& T& P  @` ` #ؒ "`  `@ 㿘  &?* `F4 & @`" `0 "`0$@ @H`&    @ '  :  :  $   @ ' @ '  " @¢ " L@œ L " T@  T "> @} > А!@Lrclosef: count < 0closefclosef: count: %d/%d㿀 ` " ,`, " ,V 2 , (   ??77 @4 @ , 0 0@2& 0^  ? &  0?& 0T 6 0>@S% ` & ,>8 0  @0E  0 > /*  @2  (   ??77 @    € `"  "` "@@  `> 0 "> > 0@R @`> ʔ"`@Kߐ# 㿀` @ 2R 6 3 -(  ?7  ? 7?А*@2     7 27   2   @ᗘ     @Ꮨ 0? 0 "\ 㿘P   7 2R " y #@2r .`"@ >` @+ *@ ` "    +@  "   ?2   3 * +@@"  @4O& N . .`" >` @+`*@`"   * (   "   ?2   3`* `(@"  @4&  >&  * ?2   2*`  (*"   ( * "  >|@R  2 &  㿘   @   4 `@$ kqeueplknotepl㿐!>a#> >!Pb#\   @G > >! @#\b   @G > Ґ "at㿘`4 €`4(R`  >`"`8 "`  4(2  2  4 ("  㿘@8  > ' #  @2 ,!"  @d2 "   & 4 6 ?Ȓ*  0 & & 6  & $   ( 42  2 㿀<@ ,    &  @  (  `  6 & (# @2  ,   ? .@  $ '77'''@   &  @ 㿐> !t  ,  . 2` 2` >`b"> !P@H> @V && " (& H &$ H& `, ?"`,`0?"`0`,  @/`0 㿈`@ p T` "`00j $`0`    2X`0&`` B`( ' ' * `* B쀦#    o4 @A ` 04 $ ` Ӕ `  ``?&` &` *`` `* "  &` &`   &``` @"&`0`,?`$`0@/F`0㿘V` `   `  ` 8 >`#D*` 2  "1`P@ 20  $0  $ @`HK*`L@ G 2V`T @>  : 2V`T @2/ `, @2 `T* @ " 2  2 *T :     2 2V`T @2 `   P 2,`> ΐ!@G!  2$  $ 4 $ 80,?`$0@.0`$ ,`  $ 0&`&`  @t@   ,$ ,` $ 0`$ $Ho o 8` €   (  $ (@H 0` " ` 8`@@3 "` (2`Ho o$ (H 0`  (Ho o  `$ (@H 0kqreadP (  B#@&'`' D?@2А  H /i * * > !8!8 @ В@ "?'@'?/!@''H 0` ''   `  Ȁ` H/` /` 2"' 6`  #> $`x!@, H 0 Ҁ? # " `'`"$``@ ` "` $`   "@H 0@0z (  ?   8` €   ( ?$ (`?$`     ( ?$ (`?$`H 0 8`@@mHo o " $  ($ ?$ ($ `?$`` $ `"$``H 0,,  Ho o ~`"` $`"@H 0` ,g*%'@   㿘 ( H /e`* &`     @c   $ H 0㿘 (@T `   :6`>`0&`@ 㿘`  H& ( L,@ @ @ 4`0 "`0 8 @ 4x> ΐ!@FӒ$`2  H& L P "?   T,@ @ @  8`@> ΐ!@F$`2  P * T> !P@F& ( 㿘   ?& @,o   ?& @c @ 㿘  8` € "   (  & (@  2 8㿘 @`@@S@ 2 8㿘 .``L@㿘 8 `P 2   @  @"R`P$`T `P2  %`T`H  ! (!  @ ͑, `H`L*`H$* @@|*``L "$`H@& $`H$`L `L* @@&&@& (㿘 8 ` L P2  T* @@2@2@@"@ ( " 8@e 8  >  4`0 "`0 4> ΐ!@Eߒdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0㿘 H/` / ( " & >>>"hbx@L#x & "" ( & ( "H 0  kn->kn_status & KN_QUEUED㿘 H/` / ( 2  >>>"hbx@LX#` "` "  "@ ( ?& (?"H 0 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapx`(D$($$@ &` <``  @@`䰒 24 X <  "`` 32`@@ @ 2{4`  I 2r @@ؽ  2k4 #\#`@ `#d` #h#l@֚ J)>^` !" &` @  >^  ,` €  2aa  <!`@ >^ >a@8 `@@  `􀢀   $   4` @D @54@  04@  @"execve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != i㽠> ,$ $,>^! 6@>^ ,  $ @8"$! >^@!> ''"$ ? '''@ '"$''''' '''(>^!ش'''ؐ .7> 3X@ 2>@K #    J@,@`J@`  @@  ? ` @  ?ؐ ?'`   2  ?֖ ! ? @?@%'   2`  ?  ?" 0 @`?@%'   2``0!>``4 ?#`"@   #`* "@ @ ` ` *  @ "  ?Ѐ@' 'А @->>  `&``` 2 &`&``` 2 &``` 2 &`&`耢  >@Jm#  @ €@ ` 䀦 a'$'>`$"  P#=c~  J c 0"@s ?֐1@2Ē @8  '?,2c 42@6 @q, `$,$ H@($,  , @,,*@$,, , "v,@7 p,! $,@"@,($0"`,$4 4/"`>@IА#@O@8 9@ֈ 9  `H "`H>c"( 22 " "(, ",0?`"0@(0``*h' '`   3+@ , >$,@ "`@ "`, (XH /i * * @.1$$$$ *@" " @"`"`H 0X@̒@ R  @@" ,€ S (,(@) Ԓ ? @ )$,*@H$,筐؀  ?'O @@@  X@@  ?,*@($, @R$>耢 "@  @   @ս@|X@c@  ?@ @?,*@$, 㿈`` ''  2V !,  *`* ` '&@'  .쀢 7  @ ?' 'є  ? &`ǔ   r쀢  ?  '   diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘@@ *` init died (signal %d, exit %d)㿘 4 'H> >`@H/` , "> ΐ>  @?g  , &!4& ,  H@&& ,?&! @,& \ ` 2!  @Q:>! `2"!` "&`` `|2``x  @ @mE` ` " &`@Ռ ` "&`@&`&`!@ 꼐 . 1 8`" < <"`< < 8"@ ` "`   "> TT & T "` "T&  T`> @&#P`#P`L@P`,( 7&`,@ 2> J H6!0 !4!4`@  !4@l`H & h  ,@>  H ,  > #P H@"`T 2 ,@&` ,@@  ( (@ H  @w @&N H ,@@@&G@[ > @"c@& 㿘>  & 8 8"`<"& <@&. reaper㿘> c>c   @$g>  8`" < <"`< < 8"@@  ,     H@,, 1@& H> @> wait㿐@ 2`!  &@`?" T    ,2 L@" ` 4  !  2y L`B ( "q L L 12L 1 ( 2h LL 1 E  4&``  !0' 2o` `"  X!4  H 2e X " `@ i $ X@[ ( B ,@  @@%J  ` $ `@ 8 & `4!0 !4@u H @[08 2 L , 2 L( " L 4$ ,&``  !0*  ' 2w , 2` 2&>P!  @# "a T  H > P@2 L " ( L P P P L `T" L`T L P"`T`T" P" H㿘!4> @?H @ Ő `"  "`   "@ L`" P P"`P P L"@  @ {? `?  "` @>  @?#! 쀢 "> @7> "@?>`ch?"chdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐#`#\    @< 㿐#`#\    @0 㿐@` @ @ "  $@ ` `@   `@2@` 2#`#\   @  procppwait㿐>X!d'>`  h\ ` 2> >@E# #@ ߒ  :   p  >k t>k@ Β? #>k `@  >  "@< > "4#> р cɓc@c $@kc > h  $h, 1c$ ($ 4>  $  "` "$ $ $> >  4" @*` $ 8  8"`< 4" * "@ 4 * @$ < X@    $>a  p@)> b@) $ , $  , " ,ꈐ ,! , @ $ ,> ɒ @@"C  <>@"> 6 `$! >#Ԁ`#\#\@& > cc "c   @(" > ؔ "   @"  "   @ "> ؔ  "    @"H /m * . > !8  !8"  "4!2, 1@NH 0 > Ȑ?`& ` "`` "` ` "` 4  " 4  ,   @!(  , > 4 %%㿘@  2 @  2 > #T`" `4"  a 2` `2`4 㿈#`> 'T'X#\! "  @ b ,"& ,! @EHT2& WARNING: thread `%s' (%d) exits with status %d 㿘  > #`4>#@Da > #]. unable to allocate kthread_q㿘  @&  2>@C~#@ْ $ $ $>`#p "@" 㿘#>`#p`"#p" @ @p cp 2㿘@ 'p?& & 6 & & &P  2 lockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: draining against myselflockmgr: unknown locktype request %d㿘 ?4  @@  'p  `>@BƐ `> >@B  *@& `  &   !@!@2`>@B!`>!̓*`  +   @  2 M @  `&    *` @:` & 逎 b  & 0]  &  >  >@Bh!8  *`:` & 6  ?* & & 0 @  ?& 08 >  >@BF!` ?&   @2$   4    2   &    `&    *` @J:` &   M *@&    & &   " >@B!   @ ؐ  @֠ >@A!  6 0΀  @Ǡ   " 02 M @  `&    *` @:` & 逎   & 02 M   @ `&    *` @͓:` & 倎  *@&  }  & &   "n >@A!   @>> !Ȓ@Az ?6    * & ?& 0   ?&  J@ ?0F >@AW" @9   5 1 @    &    *` :`@b 5 24 M @     & &  6 0>"0@A  @" 0@2  2  2   *@& @ K<MLL\KOPL lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pending㿘 > @B*!   @> "V @B  `>@B"@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map Ndiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKtemprp_addrip6rrNDPip6_optionspacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRaidFrame dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey dataEXT2FS nodeadosfs bitmapadosfs anodeadosfs mountmiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostMFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pvmapVM pmapVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqmountiovioctlopsnameisysctlsooptsifaddrfragtblroutetblpcbdevbufmbuffreemalloc: out of space in kmem_mapmalloc: allocation too large???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) 㿈h` ` `5 3 `@0 . ba) ' d$ "  @@0@  @  @@@   @  , "@> *` @H /f * '  *   2^-> * @% `@ *  >`: cxL,@ @ 2> Ҁ>@>#XH 0ư #> &: T* @2@*` ?#@$2>@>ʐ#@"%   @7o"" 7o@2`"@# "`  "%  % * 2` >`#:` ># ]#>`cx 8 &>kh  @  > #`"  M">>>#Xch@>X!>>">#`#d c:`@?C& &cx` @  cx` > # `v  ?>#`>>#c`#\ @?%?"    6 7o"" 7o  7o"@ 2#\ *&H 0free: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated free㿘> #Ā > "$ > >`#.` >!`@=` & > cT: * R@@*" > * `  * H /f * ' `쀢 A>ah!`b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HP!*`  `>`#.` >!@=u* ``>`#x@* H 0067o"@   2  >!@>>@=O!؀  4   7o""@`@ 7o6  2"" & "H 0>`c|> & > 8: 4&"c|kmeminit: minbucket too small/struct freelist too big㿐'>`>  |#> !> Ǣct"$%>k> 6``#\  @>`"cx| `@œ*`> "cT%d,%s,`` \  " `"- `` -0`߰ ->` > "#> Ӑa0@   a0> *@>7b0   ?.@> Ӑ0(( "  @ 4> > G!E!4> > @!>"0 $!4> > 6"h4"4> > /"-#4 04> > #H#4> > ## @4> >   (  `4> >   РC 8''@} 8\#>aa P>a'> Ӑ  _ N %>`. @  @@ ``  Ő@|$a  . @a>"8@>"@ @=    a*? >a!J@ 2  _*@ >a  >a!@> Ȇ((6*   . ,  @) ' @"!"" !$($    @(0diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKphysbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy broken㿘> #`?  @H /d * %  `0  &`0>  @m `0 `0 &`0H 0&`D&`4&`,&`p `@,  &`0`*2 @ &`T`&`<@&`H`<6@>@;#$>@; #  $, 2`H@`H  @ `0&`4(&`0-@{D@H /d * %   @ `0">`0 &`0H 0@{|`H@d?$`0("`<`4 " `<`@@@>@:#$`>@:  @"  $`$@`;`` B# ?` '`@ ` s`&k@H /d * % `0?# @&`0 @+0 `0 @`0*@&`0@TH 0㿘> ђ @1#@ t!P#!& putphysbuf: private buf B_WANTED㿘 \ @ 0 @"> >@:G H#@3J <@4" <procplzombieplucredplpgrpplsessionplpcredpl㿐> "!> "#T> "#> !>X!d`""(`:`>  ) @)!d> "b:> Ӓ ) @(!d> 퀢"a:> ђ )@ > "`8!>a#> >#\"`ؒ!8  @/Ę > >#\ ` H  @/ > >"`#\ P  @/ > >"`#\   @/ > > Кa 0   @/#\> >#\!a   @/ chgproccnt: procs < 0chgproccnt: lost user㿘> "> `8 @* @@! 2   +" 6>@9"Ѐ`""`"@  )  > @9|" )  "" $""" > ɀ2 H 㘀2 4 > > @℅( "   4  8 2 4 > (> @( "     2  enterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curproc㿘 "!>@8!!`  `>@8!(O@  4>@8!X > e "@0! > ʒ @0 Р $$ $ $ !     ,> c ?& ,  $` >@8!! $` @ "@$`$`> (> !@*  $@ " (!@* @"@$`$`"% @Y !@U  @` D"`D D @"!` 2&!@# &!` & @` @"`D`$`& D 㿘 @` D"`D D @"!` 2&!@ &! 㿘  `"`x""`x`"  "` "@ @? "@>  @1S > ɐ"@1O㿘 H!@` ` 2 T` &`? &`@% T !@" L` 2 L 1?  ` "`? "`@  L 2!㿘  N 1 2 @`@  @   @ 0 2N 1 4 " H4 "! "㿘@`4@"~ 2!   `    &㿘@`4@"b " ! `        4&   "  " , ""    "  "㿘@`  R &R @:`   .  2& 㿘! 4  "  " 4 W  4 &㿘` @A  4"a "5  2a. ! ` 2( `,@"a! a   2`4`4ې " !`  @   㿘`@`   @ 2 / @" @" `@ @Ԓa2 `@ @ʒa2 2 @"$ .?+ $ $ @ݰ $" `,!$`,㿘`@`2  @"  @ @a2  @ $" `,!$`,㿘`@`   @ 2 & @" @" `@ @ra2 `@ @ha2 2$ $ @ $" `,!$`,㿘`@`2  @"  @ @Ea2  @c $" `,!$`,㿘`a2@2 2@  @K&``t,  22 `, !$`,R` `(@ :    *   ` @2@㿘> ߒ @-O"@g P &㿘@? "@> @/"㿘   P &㿘ՠԔ P &㿘`  &`! ` @㿘 !2   !  @` ?"  ,2  &  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘@  )  "`M "'`I   $ 2:N! 9 )` !- . )  * )N! & @ 2N!  ) >   &`> !  )  `@2 N! &  2  ) )?&  㿘@    "`R "-`N   A`@D; ` ! 1`  -``@. @ `"` >   &`> ! `  `@2  `@`  2 `` 㿘    `  4 &?Na 6 .a  !2  .a @ 㿈`  @@㿘`( `& .`  @ 4   @ 4  2   @(   !2_ " x` ``  `"`@v & `>a` `` >a ! !>X!l>X!d: ? 4 >2  (>@4  ` @`>`2,  @! 4   @ >> "@"  >"@"  >  8   @ @  << 㿘@ 4   * `0 㿘H o4+@n   ȑH 0 @D@B 2 > %%&&&&!t4`>X!P, @,`b2*@ *@ b 2`* @ *`B2*@ 8*@a Д @[@&Д @@6`.  .`@c3`+ +` b 2**@C3`+ +`&  @8 Д @2@%А @ߖ@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@ Д @ @&А @@&㿘@ `   M `  H`p H@Д""?`"?/""`" ` " ?/"" `&"  `@"` plimitpl㿐!> 6!h > >ac#\> a   @(  $!h> Ȓ @*! Д  $ $ 㿘`? "`> @+ѐ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map@ ?2 ,! 9 ,2>D*`@(  "$ @ 0`@  @"    "  @   888888888888888888888sigapl㿐>ac> >#\"ؚ`Ȓ!4  @( 㿘> Ԓ @)k"ؠ $!4 $!0 $"`$ $0 0㿘 $!0 @& $㿘 $a0? "a0> & $@+"؁㿈@   $` ` `2`Y ` F,` '@ $ $  *@ 2$  2  $  "   $  `  @$ 2  , " ,  $  ,@"   $   2   $  `* $  2`  ؔ "@   $( H*`"2 ( "?`  ," , 4" , 2 ,2 , ,(" , ( "@  ( "  ( " ( " >a2! 8 `" ! "!! !8 "!! "!H >a*`  `(!"!``>a㿘!   $! * 8 >a*&!!  " ! &! & $@ ! 2! $a $a$a$a ,*@& ,`P "$`P " H "`  "` "` ? "("?"H    "pause㿘 $?!b  $!$!@ & >x!( @  > 㿈 $! 2`!  $! ``! +@ '  "  !  ! ?$!$! #@ !!`$!4   㿘`` , @Ӑ 2`!  2` ` @#      @㿘 $ > !L4 $,"2J `@24/ " ! 2 (  !4 $@,"2@!  ` 1? @@24  㿘 I)a  B  >   "  "   2 @@ @ 倦0$    "  "   @k㿘   @ 㿘    , @L @ 㿐 ,  $* /!",$( 2($( .``< "`< '    & `!* &!>a! " $!&!$$(@ psignal signal number㿘 ( >@.!" ,o@  ,>a!.` ( * !   !   N!  .!  !     *@& 蔊 *@&  耣`  & 耣 kN 1 gHo oN 1  $> F# , O(K `"1 耢?`2>! A 6!0*  H& `,   @Ր02 ,h/` & `` * & "! l  . 1" l * & 耢 `@ Đ0 > 4  "al! 2 2.!@ H 0procfs debuggingProcess (pid %d) got signal %d issignal 㿘   ,*@ *{ $  .  !* $  ,("  , h(2# $@@4!0>@.   H @\@ 8 ,(" !0 "  .@ 2  * $  $* >a!` `- 6  4` >@/4    ,(2 !  2 H 2  H4!0`,  ͒ @@  2   2  ,(2 >@/     $ 㿘 ,*   H. 1@ & ,postsigpostsig action㿐> #  $>@-#@ ?*  8 . # @  @g0D> @-z#HHo oa  ?a#a`   # a !  #!>a! "#@ !#!#@ H 0 `< "`<a$ a(#a(' `  pid %d was killed: %s sorry, pid %d was killed: %s 㿘 4> @-H` 4> @.' 㿘 ,!2  6!2>a& ,a.`@  $@ "a$ "`ϒ%s.core㾈, aڒ2 ,!>a"t ܰ />  Ȓ ` *   @: @ ˰  D `8$`  >$`a@.J '''''ܐ#@! 0P@ <  T?@*@2 @  ?h @@2 42c!8 @d8' @u $'a$' a('$'(` *', Ė+'0 `+ + @m'4 H -( ('((  К 0 #\;`#h#l @ .`> ȑ* 0"#`(` * 4 #\#d#h#l @4ϖ  #`#\#d#h#l   @ @Ȑ @ "㿘  N㿘@a &&  & ` >"*` & &  > 㘄 2 " 4"    42  2 @*@   "  @ uiomove: modeuiomove: proc㿘  >@+#  `> #`>@+#U Q` `?&?&8  "'@ "@   2@@|| "@0# 2@@ @&@`@"$`$@@"B &>` 2ureadc: zero residureadc: non-positive iovcnt㿘` 2`>@+& ``4@>@+   2` &`&@  "  } 6 *  `?$ $```B >`&`hashinit: bad cnt㿘 >@*! 4< , $, < ,     @?*``@&?&㿘  h  2&  `&  && " $  &" $ & $hook_disestablish: hook not established㿘 2 2@>@*#``"`& @`"㿘@  2 㿘    2&  & >a & ∀&""`"∁powerhook_disestablish: hook not established㿘>a@@2@`2>@*J 0 ">a@ "` @"@G 㿘Ho o #>ab  €  b2 0 b€ b2 H 0diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapsysctlsysctl_disklocksysctl_kmemlock㿘> > !$ } > > @ !$ u > >!0!$ m X`    '`a2 z` u @*zȰ nȒ?`  > Г*` >`   > l>#> !`>J #>H L>",J -` z  A` >    曖 4`@   拔 0%````#\`` @>   p  ` `z} <d|pX㿈`\   ' , 1 3? ?`1>#*` > 5> 5ÐQ> 5> 50@j>XϘ!h>XȘ!d>X!l(> ""!> !ܐ'@ A ?!܀`?6   `4 1  -$!> ! @^! " > ""> ʐ!@N!  >  "! !> "l'@$"lξ> ِ0 @n @@a     篒>b##>b#>c" > ːHb"Ws>a"t@Ee ` [ V > #0 a@t  G> #0 a@" d   #\U> ِ > ɐ> ؐ @> @T5>X!|>a">`#h@& @&N!>`#`@Ș#`#```2 $#` 2 $#`>  * @$#`  -p,Hhh,@T(h|,Th| Hd|\ 㿘`\k ?` e>"0*` > :> 4tK E> > #`* <> Ȕ > #" 1* > -  @ />a">h@ @  >  ,>a* b#@++  >  ,@5 -(P\㿘  @     `&@x  w 㿘'P` @     `&@Pwݔ 㿘  @     `&@w”  w 㿐''` @     `&@w 㿐@#\㿐 #\@㿘\@ `  @@  `,  `% ` "&@@   ?*?@w[@@*&@wR  wC/㿘@   @     &@w.㿘  @ ` `&@w w㿘` @   ` &@v㿘@  >   ` *`" *  (&@`!> "&@"<vה  "<&&@   `7vĔ 8   8&&@   ` `2l   > d > !J "G``->!*` `4 "@a  @`, "1`a  "+` l @`   @`  @`,"2`H@1vd!8 a8v^! b``2N`1 > #T  $@& & hxܝ㿘&@!``  &`w  ` @w PN 1  1 8 &a(&a0&a4 &a8@Z&a( &a0 &a4 &a8 H "&aP 4&aP! &aT! 6aX , ?` `?`l&a\`x " #&a``|&ad&a\` @ &a|!  2 `&a| `ah> h @w `.ao`6at&ap6ax6ava@w .a a@w .a    P>a%s,㿘+> ِ`@  ᤖ )>  _#> bȀ    (@~   '>a␀  o %>a "> h >  , *"  * $$$  bȠ * )$␢ > (c> h@%  0@"@ 8: @: H: P"  T"$ X"( \", `"0 d"4 ܢ`8 >a"*?$% !> "Ȁ  >a" 0 "  8: @: H: P"  T"$ X"( \", `"0 d"4 8`@   diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘#> 6ap>b̐@M!> 6!>cĐ@F@@B㿘> #" H /m4* . "  "H 0  > 4>X> "al!P @u|"@,/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/kern_synch.cphz㿘> > "at* > " > >>>"cx@#Q ! a 1 ?` $   $ >a"x h 2 `I$ hH /m * . d h  d d* *  @~T* @$ h `$ dx@~L($ `@0 !`1> #" ! L 1 2 !  , 2` ! 2 @" ! @-- ! @- ,!0 ! ,!H 0  2 1@ 3> @!>X!P@㿘> "*  *  `& ``&  xa@~( "& ` ? & & `@ܐtsleep㿘> #aHo o>X > 3> " > 3!tH 0 H 0  >L 1 >  >@""`>  #> Д"$ ,!$ l$ @ @ "@ ""$ p@&`"  ,  ` $ ,( @ L   l  @ސ , 1 2     , 1`@ @"`@ ! > *#H 0 , d$ , {  $ ,) #`@ p` 2 $ 耢`"   ,( @  "   $?! *  ? 㿘H/` / l N 1 @Ȑ ,@} ,$& ,H 0sleep called with priority %d > PZERO, wchan: %p old sleepsleep㿘> #` >!@#A>@!!ؓHo o>X > 3> " > 3!tH 0 H 000 >L 1 >  >@!!: #> Ж",!$ l$ $ @ @ "@  "#   , 1$`@ @"`@ ! > *#H 0H l8> І 2 `""`" lH wakeup㿘Ho o> > В c"@7 > 1? >@!X# l2($ l"@`$`L 1 2@ ( ,G , , 1` $ @+0 > > 4"al"> @!`@ 2 H 0㿘?㿘> # ! ,!H /m * . @+  @`@9" @H 0preempt: cpu_preempt not yet implemented㿘> ɀ #>@ ! ! ,!H /m * . @*ѐ  D`@ " DH 0㿐> #'> @=F " "@ `` А"@ А"??/!`$`$`< (2   #X     X  @4  X  @X`B <X$``  " `La 2` ,a @p`> Ȑ ?$``q"@<ᰁ > Α*" setrunnable㿘Ho oN 1`*`>! >@ ? p ,( !0  * @&  , `. 1@*H 0 ( ," , & > !0 > ! #@ > > 4"al"ԼԼԼԼJ!  ( ` @8 *! >  > > 4 l" 㿘 ` $ @8& `! 1! .!diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐H /i * * > 88"  ' "@`'А"@@''"8 # H 0!> К"?00@ "0 # ?/!`"0# > ᰘ@ "ᰔ # ?/!`"# H 0@:㿈@  @;֐*`" * `*''p 㿈 !2' )@ % `po  #@q'> !܀ '> a8a8  0a8 e 㿐@   `  >X!P'@p"'`p? nanosleepp@p.  #@p'Р'@  ` H /i * * > ## ''H 0   $ > 6>!Ȓ!  ?"  #" ` PH /i * * > ## ''ܑH 0 "@'ܒ" `'А"@@''"@'"'А"@''Ѐ ''Ԑ*`" * `*''o  㿐@   @:ܐ@o   ``>X!\o denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds 㿈 !2 2F@ o^  =` oU  4@ & >  > !܀ > 88` 0 8 8>"@  @L 0 >` >Xa\"a\" 㿐 !2 W@o  O>a*"@ *`" *  * ⠰ >X!X*` * !X@vf @os0 & H /i * * >  > " "c H 0 ` !В"@@oz'"@@v:'`n˔   㿈@ O H  *  0   pc>  +88` &'08''88"`'" `'А"@@' ' * @`p2 H 0`nr 㿈@ 4q ` n]  2g`  &`  Z V@ 2Q @ J H /i4@* *@ +  @Ð>  > !8!8  В@ "?@''?/!@''ʐ $ @j oÔ 0 @x@ *  o H 0 㿘    & E& H /i * *   b? &   & ?/!& & >  a8a8 0a8n $ @ H 00H 00}x8   Є?  >XT &"  6  "@ @" "   "  "  " " "  `" Є@@" "   H(> #h#lH h #` l #dЄ@#`#d`@d` h2   2 h l""  #H(> #h#lH h #` l #dЄ@#`#d` ` h l##  "@ @   @4"@#> p p  > 8*` `c > ǁ  " " " timeout_add: not initializedtimeout_add: to_ticks < 0㿘Ho o ``>@^#6> >@Y#  @ `&  & @  "` "@& > #p &&  "@"  H 0 H       "  "  H>  > 8(  > p   ` ` " "` 2I> 8  > p   ` ` " "` 80> 8   > p   ` ` " "` 8> 0(  > p   ` ` " "`> pp@ 㿘Ho o> #p#p@ #p"`"@> "@@4@4:` `> *`#8> g #842`:` > g#8> *`#8@@#@   ;` `> *`#8> g#8@3`;` > g#8> *`#8@@ # 4@;  > *`#8> g #83 ; > g#8> *`#8@`"@# 4@;  > *`#8> g #83 ; > g#8> *`#8@"` ` H p@ Ho o#p#p@\#p H 0 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘 !2 @&@> ʆ > @ @ > dž  > ߒ">a"`""  >>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d 㿘   @%>a >``@ڐ"V` >>@Ӑ#V`@ΐ#2  @ 2 `>`@j#   >``#P@   " &   "& ] & &  U >>> %s probe won >>> no winning probe 㿀''''耦` `   @ > "' +'!  * 2  ( $ *`: * @*``  2wV  $  2V   2>a" 耢 " > >`@E @A 㿘` `   @ > "3) % * 2  (  $ *`: * @*``  2`@?`T@ @ $  2T 2㿀>\Rc'' ''''cV>Y* * `H  @pe  2V 6V unsupported not configured 㿘: @M"  !>a"ƀ * @ root device %s not configured 㿘  >@ X  @# 㿘?` .@pݒ  0?.@j ` `0?.%s (root)%s at %s㿘      `  @ `* @"@V   V `  6 6 > c@&```&``""`@ >>!(@A` > ߐ!8`@;  > """2 $V `@2 $V   6 V 2 $  6  $  逢2@config_make_softcconfig_make_softc: allocation for device softc failedconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %s㿈@ /`>@u"   2>@l#@jǐV`  && ( & V` V`@&  *`   V`@&   *` 2 0V`& @p $@ (>@1#H j#`j & $ *  , @$.`$.` ׹   &@> #p>#>#@  , *`@jb@ i  $ * @  >#@& ,config_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached 㿘  ?* 2   >@"  @  € - `>h "8@  ` >Y`$2`>@"h`2`$>Y H2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> "#D  "@@0 `@* "@>"@ @$` @ 6`@ 2 ``@ *` "``@ @J $`$@ 㿘`  ` `(  -   $`(`€ 2$`(㿘`  ` `(  -  ?$`(`€  2$`(config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structure㿘 $ !> >@ݐ!""  2>@Ґ!2  m  2">@Ő"" "" " "@" 㿘%>    $`"  $`"  " @ ׬ `2 㿘> #@` `$` ǒ  2`$config_activate_children: shouldn't get here㿘> #@ ``$```>0 +  ? @# - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,?  & ,  `@0 evcnt_attach㿘@n (&>@!@@r&> ǐ  & "@"  $2>"`$`@ @4 $"6"`$ $ @@:  $@** $2 `TT&# $  $2 $"`$ $2 $"`$ @@ * $2 `TT& $  $2 $ $"`$" $ (   @*`2 %s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)㿘 D? 2`  2 ?`a>a@b>#\>ֶ#, : > 0"@>#>#  <" T># ` >#( <> T#0: @ `' ` <`(@ `,` !>`8#8@o^`8@o`,!>@oP#P`,@o> ӆ > >  ,㿘 >  , >  "Ȁ "   (@k  2 ( 㿘 ! Ц @ , $ , disk_attach: can't allocate storage for disklabel㿘 ,   (ߐ  Ԅ!&  "  `& 2 >@Ӑ!@g.! @g+"H /i * * > ##& P & TH 0 &> Ӑ" &  "@" > ,>   ","disk_detach: disk_count < 0㿘 է  դ `"  "`> "" "> > , ?" ",>@#0 0" 0H(> " X" \H disk_unbusy: %s: dk_busy < 0 㿈 0??& 0> (@ HH /i * * > ## ''H 0  X"@' \"@`'А"@@'' `b? d& ` & d?/!& `& d`& X & \ H 8@ >`CB> H> 8 @ 얂B> @ג@ 㿘> #   㿘> #   H(  : @: 8: HH(> " P" TH " `" dH rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs +> 5a!?@լ a @4  `? 4 ` ,`* >”@",`* "* > -!L)> #  >a#@Q`e# `e@ >a#8@@# - 2@ >@1#h  2@ >g! >@z#>_"> 6aa> 6 "aa"   a " extentpl㿐!> 6!  > >Ð a#\   @Ș  $!㿘> 6! "  @i   2 extent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_create: storage provided for non-fixed㿘@ \`>@"X >Ð"x@>@"`+ >@"Ѐ  `>À @{#w @dѐ& ( 0& $`&   " " '  `" &    2&  & && & &  &  &   & %extent_destroy: NULL extent㿘 2 >@/ Ѐ " `"`"@@R  ` "`  "   㿘      @ 9"'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@@ @0 '` '` '@" ''`extent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extnt㿘 >@=# >Đ#(@ >@2#X:  >Đ#x@>@'#@ * (> @q#>Ő @l>@ @@ 2 >@a p/      &  !>Ŕ ! " @! # ``(` Ӛ extent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignment㿘\ `d>@#"`2 >@"@ *  @ > @c">Ő#@^>@#8&@ >Ő#`@P>@#>@# : >Ő#@>>@ 0@ʒ &@>@2 X ?         >Ɛ @>@Ő  ` `* X`  S" O*C` `>- ?`@  "@ @   @?      8`  ? g f```"" ~ :`  ` "  M `?`*? ?=, `@  "@ @   @?     ? ` ?  `" `-" * ` `` ` `  &  !>Ŕ - "'&@@-  #% extent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not found㿘  >@ " @  @@?>ǐ"0@>@ "h:  @1>ǐ"0@ߖ>@ " 2B @i 2= b 2  2 `""`"@@ B` 2%@   4@ @  ,@ (  $` $` "  $@" "$`   @*@@ؐ>ǐ"@>@ .""  "`@X  " ?&  㿘  ' #`(   & ` ! >Ŕ - 20  ꀎ` `"  "` !"@H /f  ` * ' `> Ґ @*`H 0  & 㿘 =` %  "` "@ " &  &"`H / * ' > @ H 0  "` "@ " &  "`    p& 0H / * ' > @ H 0extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx 㿘 2>@ Y#>   @      > @  0 2 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘`%`a> 〢 "0         @_` a& & > > "a">     > >  klog㿘> #0 Ho o   > H 0G #!>ɒ`"!(!  "  H 002 @H 0> a ?"a  `$  @&`$ ``     " 8㿘Ho o`> #0    > H 0  @![aH 0 㿘> ! > !@!a? ? ۥ? > ,#0? ?$? }@"/ ~@w@;?0=@: v@'?05H/ /> c0 H6!"c0 ">   >      > (" diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistent㿘` 2 @ Ā2 @>@ "p 8@:>@ "&  @ 8" & @@``"`& `@ "@ &@" &&"&``@ ߐ d @2 4``"``"```"@H/ /> 6!@H 0 4 ? `& 4 &  `"& ` "@& pool_init: pool item size (%lu) too largepool_init: too much uptime/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/subr_pool.cpp->pr_itemsperpage != 0phpoolpcgpool㿐\ 2 >a"     >  $  $ $ $   _$  ?`$ $ " ` ( `  ?@  >ː @@ & & &  & & > ? & \& H& 4& (& ,& 0& d& `& & & P& @& D& & & & & & & " & L>@ ې p  & : @:&  @& d ? &    "?@ez&@eu& $ &@@dӒ  & 8>>>ː!`@ !_%@dÐ&@_ > 6a& & & & & & & & & & & & h` 2>a >˚` (   `#\> 6>ː"a#\ L  V >a&b`& `""`& T  T& X "$ pool_destroy: pool busy: still out: %u 㿘 T`" P X"`X X"` X T"@@s   D`" >@ L   ``"  "`>a"" "> 6b""bpool_set_drain_hook(%s): already set㿘 ܀ "& > \@  & ܁pool_get: must have NOWAITpool_get: %s: crossed hard limit%s pool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistent pool_get: %s: page emptypool_get: %s: items on itemlist, nitems %u pool_get(%s): free list modified: magic=%x; page %p; item addr %p pool_get: nidle inconsistentpool_get: %s: nmissing inconsistent㿘> # `"`D>@!P`D`H@>`\@!p2!``܀ a`€`D`H@ a "S``` J`y` E>`a@ @` 2R `@" `\>@ Ր!>@|!@  `d @`H/ /> 6!H 0   @` 2`D`2```  z$``$```\  k`h`D@` $` 2`@>`\@0!耢 2 `\>̐"@ ~ >@%!7o"" >`\"8 @` "`$   "@`@`D?`$`@$`D    `Ā 2?>@"$`    "$ `8@">`\@"` "`$`  "@$` $ ` "$` ` "$`  "$```@ `( $`@pool %s: putting with none out pool_putpool_put: %s: page header missing㿘 P`@ D 2  d \>@ ">@" @"`  2 *  l`  `  ``2` 27o> \@""&@  &` `"``# #  &` ?#   @` D ?& & @& D&  `  ?& `   Đ & >0` `2C 8  4  0 &  P  "  0K` "`&  "@# #  "& H /i * * > ###  # $H 0   ""&   "& ?@` "`&  "  # " & &  # & 㿘B㿘 8@b \f@b :@   d @ @H/ /> 6! H 0 ` `@  ,@  , `& & ,ʢ , 0@ `& 0 pool_prime_page: %s: unaligned page㿘 P` ? $> \@#  d @2$ ` 2 *  l  & P 2 *  l"  P 2 * " l P 2 *  l&  & " & &  &&& &&& &$  Ĕ    & Ė@ & & #@  8 @ & @" " "& 7o""   "&  4  @& 4& 㿘 @ (@7 @4   d @ @H/ /> 6!O H 0 ` 2 `@G  X  @  ( & 㿘` & ( 8@`[Z 8@` 8& ,& , @ (@㿘`  8@`[B 8@` 8& 0& 0㿘 D@  & & & H& `&   8@`ǐ[$ 8@` 8& 0& 0㿀 ܀ € ''  @/ H /i * * > ## ''H 0'   2# " ' $" `'А"@@''>a" &  @ 8 ("   4 ,@耢` 1 ` "`' "@  d @2 `"  "`  "@Ho o> 6!&H 0耤 2 㿘 H /f * ' > 6b >a""bb "bR H 0pool %s is locked; try again later 㿘H &* @ H 0POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu page list: page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x no current page curpage %p no log cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p 㿘@ *   :  l"  p"  c" `@*  ` \> "  $ƀ d P>Пƀ" (> ," 0ƀ 4 8> @# Dƀ H > #Hƀ > #p  ƀ Ā 2` `>Пƀ#``#`` ƀ`$` "@7o">А#ƀ  2@`>  2 >Пƀ#`>џƀ ` >џƀ  d >џƀ (/  + > ƀ 8> , ` 0 4ƀ 8 `">` ƀ , ` @ >џƀ $, @`2> 2 %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) poolpool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) 㿐 `T  P` @ "` d @`>ѐ#x@>`\`#0` 4 7o"@`"`>ѐ#x@}`> \##\@t>@   `>ѐ#x@g`> \#\ (@]    Ц@`2 P "  " " " " $" (" " " " ," 0" 4" 8"`" ` "`㿘 @u` "`$  "pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULL㿘 2' , "  0 2$ 2 0 $ 0 @ < ( 6 1  , 8 $ ,$ 8  >>>Ґ!`p@Y&B ?>>>Ґ!`@O&C* "  2 " >>>Ґ!`@@&F "$ 㿘  2< 8     23&  2 H /f * ' > 6"v H 0 @703 @T L 4 & 4$ $  "  & &  8 & 8 ` `>>>Ґ!`@&R*`$  @ " "@ >>>Ґ!`@ޔ&U  "& 㿘 $"  (€ 㿘  q  @ 8?& 8   >>>Ґ!`p@&B ?>>>Ґ!`@&C* $   `2 " >>>Ґ!`@&F  2 $ "&  $"  (€ ƀ  2 8`") 4?& 4` "`&  " "& H /f * ' > 6"H 0 2 㿘>ΐ 㿘>͐~ 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' >a"L  ' H 0   2!     0 0@Z \   & \R/㿘 P@€ `. ܀"(  €@€  H /f * ' @/ H 02@ 㿘 P €      `  ?& `߁ T 2 `{  ?$ 㿘  T`X"`X& XT"@"T T"X "& ڐ  &T  &  㿘>`> ȕ6`#x @%b8㿘>`#x@9㿘>k> 6` ` @b㿘>k `@(diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapkernel %sassertion "%s" failed: file "%s", line %d㿘>Ր! @%s: table is full 㿘>Ւax@( panic: 㿘#> b'H'L'P'T'X !H !!> 6#@$b>@@!@W>@:!@ 㿘'L'P'T'XH/` /@L   @H 0> !   @ Y%d㿀  <@B >Ւb@1O   >L @4  L   > @+ 㿘'H'L'P'T'XH/ /H   @sH 0> !   @c  㿘> " > ""؀`  `> "؀ ```@+  ```> b؀""b؀`- + ) (`> !܀ #`> #0* `  " `"@ &" `  ""` > "؀  >a#4@㿘> #'H'L'P'T'X`,  a ` `   @H ,"  ! "  ! 㿘  @? "@>  Ё㿘'L'P'T'X       @'D    @LY㿘'L'P'T'X  @L㿘!>a#0'H'L'P'T'X$#0   @H> " 2$#03$#0㿘!>a#0$#0  @t > " 2$#0$#0㿘'L'P'T'X  @_L.㿘!>a#0$#0  @R> " 2$#0$#0. 㿐'P'T'X`?' @7P*@?㿐` ?' @$*@?%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad basex  '`'܀'ܮ   ܀ "  .MM % ꀦ`M خ ''?/M`X>ڐ!*` ` ? ? M ? ?L  >a  >גa= O>גa3O `  ܀ "  .L&L 쀦` @L * :   @ 1` ܀"n  < ,*@ < ,L  ܀ "U .L ` L 4LW`  ܀ "4  >.K >ɔFM 2QM M/K  ?F' 'B  +?/M`*  ?&5?4MЀ   ,* ?ФMЀ &#?"  ,* ?ФMЀ ' @M l2    ?/    ?    @?* : ?:    -`/  ?> :  @ ?" ?2    ?`` 2   @  ? ? ^  ?>עa '  S x ?>׬!0  @V, "@$/@V    ?00 2   @  ? ? # >!8>א! ' ?  2   @  ? ?   2 /' ?䀢"N' ", 4` 2, >>ו4`,  `4 0 - 402 0/- @U} `0- @U  ` `0-, 4`  ` 4  -'!P@U '?`Ь/ /&*``  2   "`  ܀ "  .D<` ` ܀ " .'/$  `  0܀ "  0.` ܀ "u . "`  0܀ "^  0."(`  0܀"F  0.ܔ2 M܀ "2  .Ɣ퀦` ="9` ܀   .#M`2&`f,f,af,f,f,f,f,f,aa,f,a$a8f,aaaaaaaaaa^Xf,f,f,f,f,f,f,f,f,b,f,f,f,f,f,f,f,f,f,f,bf,f,f,f,f,cf,f,d@f,f,f,f,f,f,f,f,f,^bb0f,f,f,ab0f,f,af,bbcTbf,cf,cf,f,dLdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘` @@`% 2 4  H /m * . `"` " @"`"H 0 㿘,  `@ &&@`   @Ro * 2` ` @  LLҒ@? $`$` ,  & ,> 4 "al㿐 , ,* ` @ $&@   @R< * 2`@   @` KT   @7KQ  ?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaadd>Y`H%   `H >X(#P >a>a aRD4"DR#`$`H  $`*` (>YH2 >a $>a @`>a@ @--- more --- 㿘!>a#H  >a#L@2 #H>Ґ#x@r>ې#$#H#H,`:` `q$#H`Q >aP>a>aX@"T> 0`( "T %d㿘> "@>ܔ``Ԑ@R1>a#T>acX !> #0@RL4@Rې#T@&#T>a>aTX > 0 ( >a"#P"T%d0%o0x%x㿘` >a#8 " >4 >܀  >>e!00>a!(0^!8%s*FOUND***UNKNOWN*㿘. > . @>Y*` H@ >`D!V `*`>ܐ"x >V 7!(0 >3!0>/!0>+!ȁr0rDrTr0rT%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x 㿘>a. #<> @ >a#@@>a>"0u#@*> @ >\#@#<#@ *`>\#*`>] > "ʒ 0Z#<>  $. >"0Q@>Y*` H@>ܒ"e>#T? ># T#TR | T?>T   4>>#>#('>X* R ?  T>X#`*`  >z#0@T?`>p#8㿘N -    N 02% N x  X2       ɠ  Mc  *`:   Ѐ  ? &@         `K*  Є 8K +`8 ( (* 8І `Ѐ`  K K "  "  " K"!?22 㿘N?  J@    `)>a,#D:  4-`>X#`,: @Q@,:  @@Tx "* #D:`@ -`: ? &@?%s [] ? Unknown argument 㿐 >ޒ @#> > c@N (LcL "  "  " L   > &@m  >ށchange (y/n) ? flags changed %3d can't change free slot count%3d %s changed 㿘>a#<#>a. O>`>?!@>9!, :  y Y n N>ޑ, :  y Yi cw>Y.  * H `      H  " H $ `$ >X,`R ? `R ?,  ; I+>X,`cR ?">ޢ cT>X*`#` `B*T?>ސ!8    , @Oɒ % v >ܒ">`h>!0Rc@ >\>ސ!0I#@ 4C>ܥ. <>!@>>!, :  y Y n N>ޑ, :  y Y'Ȑ c֐c@!>\& #*`>ޒ@!c@ &?* c@>\&?c* @>ޒg!r<؞a"؁Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device 㿘>a#<7 . @>Y H*`@R` "   "  >4 > 2` 2` >!>ܒ". Ƒ:  >! >Q d_~>!0>a#@ >\>ߐ!0#  >ܐ& ?>\c* @>ߐ!0"؁ enabled %3d can't enable free slot %3d %s can't enable pseudo device 㿘>a#<7 . @>Y H*`@R` "   "  > " >2` 2` !>ܒ". X:  >! > e>#0>a#@ >\>ߐ#0#  >ܐ& ?>\c* @>ߐ#~0{"؁command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know㿘>ѐ!8#>ac\n ,@@N@ 4 #>a>!h  >#>ac\* @ ?* : `*H*`>! >!pB>>!=>>!8>>!3>>" .>>"H)>>"p$>>">>">>|">>w#>>r#P >>m#x>>h#>e!c\,@J c\lpppppppppppppppppppppppp pppp p4Hp\㿘#>a $cH, : 4 >a>\#@c ?> ?$cH%s 㿘#>a  $cH#`,   > ">a#D?$ >X?$cHUnknown routine /%c/ 㿘/>a< ->a@ R%H >Y`H@ >X`*#R ?>`  #R. : @/`2@ @$.:`e sd >#0 >#0v ,`: :`# R?Ǥ<`@`$?%HUnknown attribute 㿐L?  L     2 LL "  "  " +>a,cD:  4->X#`,: @L- :  @P! "* cD:`@ -: ?2L>L 0   ֒ >ސH s08 Unknown pseudo routine /%c/ 㿘/ ?  c >a"#H>Y H a!>\  H@La 2R`$`@OӔ 2J`$.: `` `@R  `2:`$@R.: @23`$R  2-`$ .!>\,:` d e c >#0 f>#0`$`$ `$/ ב: `$Ɠ:``$ H  !>\# 6G,>\#/  @Ov 8#.:  3#,:` d">a e c >a#> f">a>#@ L@#>a#@ @##@ J@##B  * : #"H{:`# >\,:  c>a?"cHValue missing for attribute 㿐NN    2 NN "  "  " N >E!h0Ւ  >ޑ.`.: E:05 %s ? Not same device type 㿐?' >#> ""Pc@IT (LcL "  "  " L ? 2'L>a#<􀢀 *>"1>Y `H* `@`@N  .`:  a>"X ' ? q   f  Q>Ӑ  >No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')hА@D $>a#@->a<  >#0.:  >Y> 0`H    `H @J  `H`@N/ " `H  $ `H >\ @0> ` a+̀?* @>Y H*`@ $C> 77ڒ ì?| a.: -`: <̀̑.* $>Y HC $̴?7>Y*` * H C $>Xcд 6 >\>X#ԓ.R cд>X>\c  <>\#.R c>\<H %<`%? H`@J( `@M 2R ``R 4 $H H>Y`H ! `H@I 2 $`@Mq 2  $R`  2 $2` $`H `H * : Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command 㿐N  N "  " NN    2 >a\-`J ?\@Iz2 `@L "`\J `NN "  "  " ?  M Z >  U >a*`#\ ?* : `*F*`> T N > <  >>a2"#LN >ސ *   >W8W N \ 2>`` `>>a"#8>! N iB `  >Wo cN & + dڰ  GѰ _ >WK dN >p!8   e   6 >W" eN >G!  ֒  * H:   f>W fWx U 0tN W> 0mb q?0hN  0a^ N  ;>N .!>X$!\  *`:   2 NN "  " N  z !\" # t!>X!\/!\- L>X!\!\>А!X ̐  >a>倠`?ax ">!>!ﺐ  >ﵐ! @<<<<<<<<<<<<<<<<<<<<H@<t<<<<<<<<<User Kernel Config UKC> Continuing... 㿘R>u!>r!> ɠ!@E ( > ">>b!     N - diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿐@  " `  `0 "`0`#\`@  pВ '?'''' ' ذ  耢 ?  #' '\"0,?`&0y0㿐@ X " `  `0 "`0`#\`@  8  / $    @  '''''> /`'   '  `    耢 ?  #2$ $\"`9 0,?`&00㿐@  " `  `0 "`0`#\`@  p '''''''쀧 '!  ذ 耢 ?  #   '\"0,?`&0˰0㿐@  " `  `0 "`0`#\`@  8/   $[  I  G   '''''=˒ 5`'   '  `$    耢 ?  #  j $\"`g 0,?`&020 @    2`0b b> ` @ ?* ` @  *  ,2  ð  0 $ 0    x `=F 2 0 @?`   `$@ b|"9@"{"YT k b}b~2d @ 't    ?4    b~tc@ 't  @  ?4    b}tO'tT    ( "`<  "`@  ?"`D  N 2!5  't   `vt) 2  (  <!$@ `w@ $@  2  0`< 0 ,?`$ 0J 0`r select㾰 @ 4&@@`2 a- - @,  @>-  ','0''' '(8@> Xx'(','0?' ` (<^ 2,` , !8!8 @ В@ "?'@'?/!@''H 0, ,%>  @%,(@k@ 28, 24,`  $+,Ho o,`@ H 0,%,> >#(8!͘ H 0 ",,? ?%,  #" (``" `;” 2``; 2` ` ; 2(8@ v 㿘`  2 *   6< 4* )@-, 2 04  $ 0 >a#-     4`*  `-  & 0 ,?`$ 0  0?* " ?@Ѭ  &ʑ4  @'  㿘@ 4 "&@ " &@ l> #(@2&@` 6`㿘 3  > b  "b> 6 ː#( "&Ho ol> #(@2 ,J1 Ʉ 0: 0 @ ?",H 0㿘 @ @`76`} 2 0 .6` $ 0  >a#,V`@@>a c @  @ `` @  6`>a 0 ,?`$ 0h 0" IJ`&pollp>X al@``  * `   @: @`  `2@` `?>#@;/* "**% *"@ *`@ *`?ؐЀ h H /i * * > !8А!8 @ В@ "?'Ѐ@'?/!@''ԑH 0, ,->  @$,`E 23,?Ю $+,Ho o,`@ H 0,$,> >#(В! H 0 ",,? ?$,  #" @: 2@˒ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿈!>  # ې@v ֐@q G 2 >b2 `" "`(w& 2.2 2 " " (&$`@$ @`, ?"`,`0?"`0`, "<`0`, ?"`,`0?"`0`,  -`0 _ @4`@/pipespace: out of kvm㿘>k `@ & >* > 7  "㿘&  4& & && & D& @@& H 8  4& 0& (& ,& $@;k #& <pipelkpiperd㿘(  $ D>! #   D!" D !$ D x H M$ H  $ $ " $$ $ > T  ?$ DưM D ~b$ D |$ Dƥ $ # D> $ D!  2B H D$ D>! ՘   D!" D !$ D 2* H" D" D  " @ 8 @ 8   ߔ "  D ~b$ D |$ DZ 2 H@ $ H?  $ H D  ?$ DI !T@8   D  ?$ D: " ! D @ ?$ DS  D   <#@    Expected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewr㿘 ( @   D "Q  ##> `$ 4   8  2    > 7a>k" "a ` @p `$@$ `$ $ $$ $`$  2& H D$ D>!     D!" D !$ D  D ~b$ D |$ DŨ H $ H" @$ `u@ t D!$ D>! ט   D!" D !$ D 2 H "@@(  D ~b$ D |$ Do~@ "@ @4  ؔ 2, D@    " >p ؒ$Ɣ 2 D   $ $@"$ >\!  $>S!  D ~b$ D |$ D* 2A H6 D  ?$ D  3 # D @ ?$ D9  D   <#@ Ȓ  " D  D> $ D8! D 2 H D 2   " H D "I   H?  $ H D  ?$ Dݐ   D  ?$ DА    " 2@^ ,  D @ ?$ Dې  D   <#@ j  F  }@  ( ~@ @ 0@ @ 0D D    << "㿘 (`  @``"# D3  /  +  D '0"$  D 2   " !\  D @& D 2  "  D  J  D @$ D 㿘`(@8 `6`  &`@   @  C B?@8>`0>`8 $&` (*`" *  * &` ,&`  0*`" *  * &`$ 4&`( 8*`" *  * &`,` &` ` &`㿘 (@ $ (pipecl㿘 e D @ ?& D   D   <#@   " Hw  HҐ D> & Dx    H  @ "   D @ ?$ Dߐ  D   <#@ n  " DJ  D`ä$ D$ @   (> 7> `$?"`$> 7a>k" "a ` @& > ΐ#ݰ`4(R`  @2 >b$"`8 "` " >b 4"`8"`   4(R `@ ` "`22  2  4(@" D2  " D`  2     4(@`" `D" @  2 "    ` "   pipepl㿐>ac> >#\#a L   㿘 (   @# 㿘 (   @!I 㿘c  (J "7cE2I  "~ ""}2=  ##26  ! >3 E    p" ` p = 3 3 3 p1  L # < # @ $# D <  "  2  " i r   @   ` @   @㿘 (H /``* !`  ``"I H0[" x0X L \@   V 2  8 CH 0G  t"@  |"@@ 4  @         8  H 0# (   6   @ H 0  d p 6 pH 0 㿘 (@6q `06` `  @ 㿘 (  @&$ (diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘H /e * & `p &`l &`p`@6! `p =&`pH 0 㿘> b؀""bؐ@Y  & p 6 & x& | 㿘`l *`g}@`( `@a@ na > "`DB:"` &`D> "`$B:"`&`$> #p?`B :#p7` @ . 22X @  `x2` @2+`p" `!@ ! "!@!  ( 퀌@`@"`p@0`p @h 2?h2`@*@&`p!d=` 2  `` @ ^ @`p@ `p &`p ` `! @`*@&`@ @ ֒``( "`@ `&`6 2  ` 2 `@} @   `x 2   `@e @ `x b `p) 2 " `p2 `n> -*` * " L&`p*  €| d 0w 2i`  2X`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` "`p@-`@ `p2/  +`V``@` `"`p@`@ ` `p@ ` @ ``"6`@g`6``p>*@&`p 2C  ?d= b`@ ޒ`@  ?"`p@ ђ@ݐ?  )>b  @@ @̐?   `  @ @@f`p 2  d" @ R`p 2` d` `xS @2v`p@ *r`p``( # V``H 6d`p @{_`p@2 [`p`@& Sa @ @ [K`p   2`ހd  6`@`(@ q `p`ޒ`*`:  6``6``p@*@&`p /@9V`ܐ@ ) 2`p `"`pV`ܐ" 8  $ `p @!?  `p! 2`   ` `p* &`&`p@t 㿘` 2 > # `d``B ;# &`d`H@ ٰ? <  9 `5 `ܔ   "$ H /e * & >`H@"!h> c&`d > B;c&`dH 0`܀6`?  2?  > # `d``B ;#  &`d @H`H " 6`~  6`܀ 2`` 2 `` ? ` 2?0@`@"-`?`>!X*`   ' ! ^ ( ) \? "`> c \`dB:c &`d@`H =` @ > V`܀ "2?> # `d``B ;# &`d@ `H  >b  ?`V`>!<*` 4 6`` " 6`  ?6`ܰ?,$,/dev/console0 `@: `{@  ]`z@/`^@, D  r g@"%!`@`e@ `@0`@ . !   q > >ba!@ z !|   ,` x ` !   "  @4`o@G`^@ ` @z`@?0`a@Z`n@?0`s@"gH "@_`@Ű?0`w@ h@?0 `b@"p ~@   ] r@}@"?0w`@S`@}?0o  g@V `e@M`v@4?0a `@X`@ Z?0H /e4* &  p p ?$pH 0= @P8&H /e * & p$$pH 0# ` ` @ 3!> "؀  " > p ( (>  >!ؒ @ '''''@EŐ @i` !@j@lt @L $"> b؀""b߰ @  "ڰ 0ؒ0 ,԰  h0 ̰ ! |@2  , 2 x !2}  x "| z#H /e * & p ;$pH 0 H /e4* &#@  @   H 00 @2@  : Ѐ€ " pH 00ep2   2 $ࠐ ߐ"$p@B$$$($(  |   # @M  @"( ऒ ! @ ` $@(@ 1 / // *@$$ऀh$ ( 7&  @  $ऐ/ϔ H 0 >b" l  h  H / * & >b!ȓ*`  €.€  h*` €H 00,hH 0 H /e4p* &p  @  * $p$@ӐH 0  @   @   >b! |@  , >b h!ȓ*`  €v H /e4p* &p n> -*` * " L$p*  €H 0Q ! `K ` | "@ A  @ "@! $|!$x! "  , 0' ,! |(  , $`2`     $x@~ @5G   .ېx   ?  㿘2  *@ *`> -"@ L*` @H /e`* &` `"V 0@   @ p   0 H  H 0   H 0 㿘6  * * > -" aL* `@@V`? ?2  >b!`&`8>b!`&`8&`> -*` * " L* @ <H /e4* &   "`2`` "`H 0 㿘 `>> -*` * " L* @`<@Y$`   p@`  4`  㿘 >> -*` * " L* @ <H /e4* &   "`2`` "`H 0 㿘 >> -*` * " L* @ < H& R 䀢@   㿘 @" @ !  (    " 㿘 H /e+ * &$ @ H 2 p p - p2   @$ ̀  & p>bࠐ H!@@  H  p  2   @ ̀`H 0㿘 @ 㿘H /e`* &`  (`" @ ( `" p@  p>*@& p6 @6 @G`> - n*  p* " ~L& p* € H`@y H H H 0㿘>b h - 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @ H 2  p`@@5& p @@ Ԁ €   p @& pttrstrt㿘 >"H /e * &  p @ & pH 0㿘 ̀`@ 㿘`B 04 㿘 p"` @` & pސ4 21  n> -*` * " L& p*  €   & p  @2  | "   "a   & p@d 㿘`" p p & p ` & p  @2  | "   "; ڒ   x   p@ *& & p , & & & r@  p *@& p㿘 㿘> ɸ#     H /e4* &@ ŐH 0 | +,' x#      t > >ba!@}  H /ea* &a; >X!P.! @*    &1 p0x   )q   1 >a   [ U " p0O ( L ( p   @    H 0  H 0 # >b >b !@ H 0"  2 #  #p ,#m) H 0G 2  d$2  x  `<> >ba!@Ř 2 2 a'ʒ !  a     d  @s 6 H /e4 * &   @H 0Ò 㿘 p @%  $" ` "  @H H 2  p & p @@ Ԁ €  p ?& pttckoutq㿘V H /e`* &` > #   H`Ȁ@$@"`> # 耢"  pH 0 >XaP & p> H z  HH 0 0` V   H /e4 p* & p*   @%  H 0  >bH 0 # !@͘ H 0݀`H 0> # | 2`, "` x @| 2{` 2v` 2r`  r   > >ba!@ c  @2&` HbN d` 8  逤0? >b@3 ?6  6? H  @: H60" H@6 > ɠ$㐖 ܚ@  d< C 6 8㐒@& d $  @ H4 ː` 2 4 `A&` H?H /e4 H* & H  H 00" pH 0` &` #>b & pࠐ H!@ H 0`2`0 ttyrub: would panic c = %d, val = %d 㿐` h  *@`{&`V`ހ &`ސ> >b   ?f>#ȓ* @ w`` @"s`ސ@{ n`ޑ*`:  @0fH /e * & `p`@   V`ܤ``&`p&`6`ܐ@ @@h ` `p* *&`&`pH 0V``ܠ$  6`ܠ ?,%`ސ ? `>!0`ހ` `p 2 &`p \z@k``@f`ސ?6`ށ㿘`_ \  Y`㿐 @AJ H /e * &  (@! @*@  @ @@ؔ  p*@& pH 0 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^  @ ?㿘  p   x Đ  ` @2``@2@?㿘 @& 2`@: !4! & 6 6  (  h* h 4(  4@/ː 3* @*`@*`6 load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk 㿈 > "#>* , , $4 c  d@&G d@-դ | 2 x> c0`2`>cP  >cpՐ{6 ސ@z 2 @ L1>4#`    >#># q5 cЦ"? '?/!`''!>) #@%#P '?/!`''!>#@%ؒ#9h>*` * " *  * $ d@%ő2 L1  1   @  6 ށ W  1   `1?@ "G 3 ```*7 0`4  ?@ "( # `"`4` ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 @=H 0 㿘 g "V , : @ ?> ӆ > ρ 㿘&> Ӑ! &  "@" > > "b tty_detach: tty_count < 0㿘> `? "`>!x`"  "`> "! "㿘  >!@&I!$ @C $ @? ( H$@; 㿘@[ @Y (@W H >㿘`   >    -0   -0>  #p#> "> " 7 ?㿘 >D & @%`:   >3 & @% &  & & && &  㿘  " @%   >  " &  ,:`@%ʒ` w >& & ?H4(#    "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 % & " @@ &@&  &  4  & & H 0$@ H4(6`2     `- * a  #   8("8 `0    `H H4(@"'"`$     4   ""@ ""`4 "" H putc: required clalloc 㿘H /e * & @`@`2` ` 2&`>қ 0$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**/+@` `8@ + "@8*  "  ( @ ( (+@   @ * +@ @ *   +@ +@  &+@b_to_q: required clalloc 㿘`U H /e * & @>`5` 2/&>"Ȑ$  ."& " " 4#y  "  @@ &&@& & `@& H 0  > 7> 7 > 7᐀`   `@"  @" "  "@  8("8" > 7   "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &   H 00+@  `@ؒ" " " H 00H 00:1?diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘,     `@[}?@\@^ 0 㿘``,  a   `@[_?@\c@] 0 㿘``,  a   `@[A?@\Y@]Ē 0 㿘`,a    a@q @  a   #`, @\R?㿘 , !    @\U? diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘> #>b#>g" `>fH"` "`##` "```:` "`` 4* ``2`> b >  "b> b "<#> 7" > Ѣa> "">c8#"`!> 7!>b  > " "2  :  R  4 *R   > ") "   2   : R  R 2  4R2  42 4 " 4 *R  㿘`> ) #"% *`2 *8     P2404*P *㿘> #   @: `  `4@*`  2 㿘> # >X  @: `( "  `4@*`(  2 >X!P2`@ ;:`㿘> # >X  @: `$ "  `4@*`$  2 >X!P@h diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKWARNING: mclpool limit reached; increase NMBCLUSTERSmbplmclpl㿈'>Xp>k `#\ * @ۘ > %> p"`$>#\`h!    >b"#> #\`>`p  ( !>!  >b"Ж <p\>X!t.>X!x*㿘> > ȕ6` $ @b<㿘>  $@ޒ㿘H /f4> Ɛ* '> #    @: `, "  `4@*`,  2 H 0> ߒc` "`㿘@㿘@㿘@{   @ 0 㿘H /f * ' T > ߒc*`@ ?2@   @w   "# 8@  <"`< < 8"`8>  $ŏ   ( $ 0 ,  4 $ 0 ?4 > "pyH 0㿘 MH /f * ' V > ߒc*`@ ?2@   @)   "# 8@  <"`< < 8"`8>  $A   ( $ 0 , ; 4 & 0 ?6 > "p+H 0 㿘T @ϐ 2  `#V @6     $  ?4  $& `&  " ?@& & 㿘@+ 㿘@" m_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == 0 and not COPYALLm_copym0 overrun㿐` `> "H˶ `  2 `$@` 2 > ˥"h@:'@W $ #V @4    $ @沐" $$  "$ $   "8$   S '  $@$  $_ H /f * '    @4  8$ <$ 8& 8 8"  "  2lV 沐"> "  > c  "c > c "cm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbuf㿘`> "ϒ`> "ɒ&@` 2 > "0@:2 > ʶ"P" & 쀦 㿘 2`  2& ! ` @@ *` &~ `  @ & 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘  ` ! `` ` ^`  &@QV @Ȑ  K$`  `#V @4``   &  ?6 `$$```  ?$@*`> "<* 8 `` $ Ӓ ` &@$`  " &  & `ـ `$@  W> b0  "b0㿘`f  h ( h` h T`  $&@GV @P  A@ʒ ` ;$`  `#V @ 4`` s  &  ?6  ` 8``  e ` &@$`  " &  & `〦 `$@ > b0  "b0`&  (""@`2 "` 㿘X `U`"@`"q ` @8@`"j ` 24@"6``8 `$" ?ܐ?" 6  "   "@ & @`""`4@  @  2 " & p"   "`  & ` " &`   @@ 2@"@ @ 2@@ "@&@㿘$@ }  @8 v " 2T@ (#V @6   & @  $"& & $  % `& Ɣ G&$B   2T ;@#   " ?@&   "%   6 H /f * '    @6  8& <& 8$ 8 8" " 8$   $ $   $@ ˔$@&@m_zero: M_READONLY㿘 & ` `>  8> Ǵ"`` $ @v 0 $ @o   @i  2 m_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbuf㿘`> #`x `> #xr(&@` 2 > g#@:2 > ]#" @ & 뀦  㿘H /f * ' > "p  !vH 0  6 H /f * ' > ߒc.``@  2@ H 0  & && 6 㿘H /f * ' > "p  !8H 0 #6 H /f * ' > ߒc.``@  2@ H 0  $ & 6 && & & 㿘H /f * ' > ΐ ` !& $H 0 $ (  & 6 & 0& (& ,& <& 8m == NULL in m_pulldown()㿘 >Ƒ#HӰ`  &@`  (   "     ( 2  8` `"   "` #@  & $& &    @@ `1` 8`"   $ 0  @ "  ?&`````    < & l"6T```8 ``$" ?ܐ?" `T4T`2T""` "`  `͐  "& 3          2$ S     "&   ֖  $ * $&2&㿘&` T     B  쀦      `  cV 6   Z & @q $&  㿘` ` o " 2 2  㿘R o "@"   @ "  2 㿘㿘`   `2   2  㿘       0 㿘˒ ``     2 "@& "@$ @` "  @unixsockpl㿐> >#$b#\    㿘> #iE "S +  2VM +H )H /` * ! > ǐ#$ђ @ $  $ $  $ $4  2 4  $    $ $  @ 2  H 0&@  `@b4 H 0㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " ` H 00 `` 4`>b#@>b>b#>b#@&4`4H 0 㿘      @   @  t@n> ǐ#$soclose: NOFDREF㿘H /` * !     @ ɒ @X  2 @  @N   5  # 2 @ʐ 2   "   !!"   >X!P!>cV   6! "     `   @ `"  " >{"@6 |H 0㿘  `  @ soaccept: !NOFDREF㿘H /`4 * !   >M 0 ?(6   2  5 `  @ H 0㿘  , -H /`4 * !      2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐> ɨ  #'H`  'P  P :   U ```   2`  `4 "`4  *`*@Ր t0& H 0Y 5 8H 0O H 0G H 0?  5 H /`4 * !  Ϥ  8 Ԁ 2 t  $2 t 92 t 9H 0 H ° ' t x"  |"@@ 4  `'     @  (   (H 0 @ =D< )@ '$ ! ! # ? 5 ?5 ʐ @( tH 0 PR H 0P$ P n qoP     $$w  쀤 4&`#   (P > "`& @4  $h4( $4 $P 2 6  " ?@$ϔ$ %@P `  G"` ```P` 2``  5 H /` * !  `   P@HH 0`   ?5  'P  PW ? 5 ?5  P   receive 1receive 1areceive 3㿈 'H''X'`'&@ 2'X` @ ? !2``*   ` @  @  ,`2.Y*2& $"  p    @  p `  @ L  6 p H /` * !  ``2m  L@ :h  \@ `@"b  P8^  Z X 2  8 L " 8>p!  2H `¤6 8 ` 2=  p "7  "1 2V ` 2   " 9 a a #` p ? 6 p ?6 p p@r LH 0"| p V `>!'H   ! H"@  L T" & L& T H0"@& TH "& `K&H /f * ' V> ߒc*`@ ?2@    "#8@ <"`<<8"`8> $А ($0,4&0 ?6> & `"pH 0~ `    'n  L T" & L& T  0"@& T `" '  2'@'& `K&H /f * ' V> ߒc*`@ ?2@  @  "#8@ <"`<<8"`8> $X ($0,R4&0 ?6> & `"pAH 0 ` ' V }``"&V`'`!2a"2b   * 2  ( > ! ?6  H "8 "8!"@쀢 "@H 0@'H /` * ! 쀢`$& "p` 2``" Lz  T" & L& T 0"@& T%& `L%H /f * ' V> ߒc*`@ ?2@  t  "#8@ <"`<<8"`8> $ ($0,4&0 ?6> & `"puH 0 `2& H@ i % "@&&  L"& L H `2 @"  & H  @P6 @N`J`@0" 0  ,@q L " ` p ? 6 p ?6 p pH 0 2      " 8 V      `  ```2@w L`2"& ` "     @ @2쀢``   p ? 6 p ?6 p pH 0 p쀢 2X`" p@"@ p ? 6 p ?6 p pH 0㿘`  ``@`2      @ p L $  @ 4 $@0 4 $H /f * ' @ $ ? 4 $ ?4 $9 $В (G@ (  4 $$ H 0   `@@㿘?#@'P  "Ϩ * `  @Pʰ¨ *"1`">` 87` *"3`@.` **` *   1`` *4 *Q`" ` 2 ``L#@4 6 `"| ` (x `  _6 *\6 "k ` (g ``$ " x  0H &F  L t@V > L 7@86&  P@80& \"? ` 8`9 >X!P+>XaT@kc & !aT@]`` 06 6 r `  ` ` @P `㿘?#  " * `x@ vn  G&` 4 "CV @">V "9V 0X"6V 0U"3V  ".V 0M ")V 0H  ", \    "& P4$  "  x07 "`&  "V0- &`  ` "@V `(" V ` #"@ 8"@6 8`"2V rV >X!P &` `@ $@~>XaTK`$  *& 㿘 <  @ Dǐ d`4R`(2(  >b>b"`8 L>b"`8 tH4 ( "`"  $2 $H  4(H4`h(`h  "`h2 `h`p2`pH `4( L"`   "  8` 2` 8 "`"`,  " \`0   4(H4`(`  "`2 ``2`H 4(`x`t ``| 4" `   2`8"`82,`   , 0  `&  4(P2" P2@  2 㿘   ;  6 @Ғ @ @3 L    6O 0 6@# L   @ t㿘  6 `86 @  t@  L   㿘  6 h0o6 @ t@ L   㿘T 4T 2*T 0@ @  @O > Ǥ#$ 4 @ Ɛ6  6  6  `6  &  66 6 <& < &  &  @& @ D& D x@ P@+ `   @  @=? `@ L     6 6 soqinsque㿘` >!8&` 0  6 0 2  6 2&``&`(``(&`,`"`" `   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6 @? t㿘 ` 6 @6 L   㿘 $!  @6 $ >cR &ߘ 㿘 @4 $ $! >c Ϙ   $   $  4 $㿘Ϛ``$ ? 6`$ ?6`$k "  D < @`k 㿘 t@" @ L  \ 2  & \ 2 (&   x 8&  @* 7㿘`%>c   2* @ * @)2@   .`@&  & &  㿘@ː& & 㿘`  2 "@ 0 @$㿘`- " `  2`   a&& ` `0@& "& "@ &@`  ?6` 2 @㿘`2 ` R`  2 ` @`2R``   a&& ` "`0@& &`"@` &@`  ?6`` 2`@sbappendaddr㿘@  >#0 "  ` "@  "@@ 4 48  /  2@- $` ` a "$$@`   a&&   " 0@&  2   " &    2 $  sbappendcontrol㿘2>8    ` `"   "@  "@@ 4 $"#    a&&  "0@& 2  " &  2" semi-panic: sbcompress 㿘 `r ``  M@ 2R  R V`@?A =9  8` 0$   "  0$  ?&0VV`@    ``  @ & ` @ &"& &`   a&& ` `0@&  ?6& >6Đ!sbflushsbflush 2㿘 $ " >^ @  2 >  >N sbdrop㿘  Y W  " &&   &@  0"@& H /f * ' T > ߒc*`@ ?2@      "# 8@  <"`< < 8"`8>  $   ( $ 0 , y  4 $ 0 ?4 > "pH 0`m 2  > ( "$ $ "W& " &&    0"@& H /f * ' T > ߒc*`@ ?2@      "# 8@  <"`< < 8"`8>  $   ( $ 0 , x 4 $ 0 ?4 > "pH 0 " &  " "& & $ 㿘 `]`& `  " && ` `0"@& H /f * ' T`> ߒc*`@ ?2@ `  ` "#@`8@ `<"`<`<`8"`8> `$6 ``(`$`0`,`x0`4`$`0 ?4`@> "p H 0 2` sbcreatecontrol: message too large %d 㿘`  (>!P"  &     %   2 1   Ք  & `$ $$ 㿈 `˔ - 2` 2` >b H"``@` ^ΐb\0"`(`, ?"`,`0?"`0`, `0&㿐 @@ `0 "`0` @`  4 ( 0" 0`, Z`0㿐 @@ `0 "`0 (1``0?"`0`, =`0accept㿈`  `   @y@ `0 "`0H /`4(* !(     aT 2 2# 8 #  8 `  6! D T 2   8    >b 54 8 8 u4 8   2>  X  _찒  $` 2 4 2$` $`( `("`,`("``"`$`, 6k 0J쒄 h& gS  2` 2`>b H"` " ( a `` 8'  `   ]aH6`, ?"`,`0?"`0`, p`0H 00,?`$0b0㿐 @@' k`(  !!2`0c % "`0` @m` 2C 0 2=   !! 0" 0`, 0`0 $0?H /` * !     8  >b 6! ^ "   84 8H 0  ?4 `0?"`0`, `0 ??" x @`L` @`E` v^ h '2  2 >b H"`"(^ܒܰ 2K2 2 " "`('谒 3` 2 ` 찒 )`   "`, ?"`,`0?"`0`, "`0`, ?"`,`0?"`0`,  |`0 \`<'\`5'耢 "쀢 p`` ``'` @'''''И'@4؁8`  &䀢$# ( *  s 䀢*  `@@ 'uH h @d԰ }    ''? '''' ` 'd   `0 "`0`@    0" 0`, Iڐ`00E'`"' , @  'Ԛ ( !̰ 耢 ?  #   Ӓ &@' 0" 0`, `0Ѐ Lp`   "`0'`` `'` '`@''''И'@?؁8`”  1䀢$. ( *  s! `䀢 '* @'@  `' tf h ''@԰    '? ?''' ` '    `0 "`0Ԓ (  ̐    耢 ?  #  S$@'`"Ѐ2 ' ''6Ȱ ;Ȁ &+  0`,`̀ !  ` @:` &`@`  ?$@ `` 2` && 0" 0`, `0Ѐ "D̀ >㿐 @@ `0 "`0 (``0?"`0`, j`0㿐 @@ ?`(;  0`" 0`  䢐 ``ꤒ    7 2`  7 `  `$  ( ` `  0" 0`, "`0㿈 @@k'찒 E 0`" 0`  `d  (' (`` 2` `쀢 " 8' J `C  0" 0`, ڐ`0쀢 ?㿈M谒 ''@  ZZ㿐 @@ >`0 "`0`  $  (  `  @ ` 8'`` `  0" 0`, `x`0`*㿐 @@ A`(  $ 2`09 9 "`0`  # 㰐  `  @ ` 8'`` `  0" 0`, +`0㿐 @s@ B `(Ӓ  @8 -`0 "`0 l  2   7`  @ ` 2 - ` `Q ` J  0" 0`, `0㖐㿘8% "  ! $   2 0 7 $  $0$@ * 㿘V 2R`   && diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuipc 1uipc 2uipc 3uipc 4piusrreq㿘> # `  X -`     B - ``2< `6.`>'   1 8@W-@* @#    @@c    2  >c& 5`  e@ V  2>%>%1#H   T , t`"  &` T$ , ( L`x"  &`x L$ (ڀ #P @ Ѐ V < t>% ä 8@   2  9 ``>c `LG L`     7 @   "   >%Ð#X `L 2  `L `,`T`L " " &  `T", (`L x" " & x `L "(`  W #`@ 5Q  x&@V  ? "?`L@&@?&  2 0> b8$  "b8 0 &( 4&&&,& &$ 6&  "'&  &   "&   "&  &   H      &  =  & >%@#h Ґ͐(@Xxpx @punp_attach㿐 x "V P  8V ">c ">c >'>c 04>c 8< !X" 8 n  " 7@J 8& $@g * "@*`@*`$ 4$ 0㿘  " " @ &  "  @ @? 6  2 0" W > !  ?oÒ @Io   ` @?? `N `@,  'x'T'P't'|@P 2=` "d@;td@0@@) 0@ '`$ 8 !7@:dd`@:t 2`$ &  m & @<  P` D`  a '''''K?  (0I* @( D< > &@@: 5`"1 =TV@@, )  $`  2` =  `沔  $  $  ` $ $ $@ @unp_connect2㿘V@V@  )`" V  >(""  "  ѐ!unp_disconnect㿘 '& R`` 2  $  2 >("2 $ & ` ?2` $ 㿘R    㿘4 8   $  n 㿐>  ?2 ,m  `T@'$@@`?2@IVؐ @& D ,  V4@ `? `, @UU ?<, ` (π`  @*`" @> '`?"?"  ?% & n 㿐    ` ?#@2  @ 2 ,`   ?` "@` 8"   $ 0  @ "  ?&``f     ^ 7 @  ? $  & - Ry?#' #@ "    > `   "`  "`"    { > ` ??"` ` ?"" 㿘)>  #> b< > %  "a ?̐*@4  2 b< 7>   > ?Ȑ*4  " `"2  @" T  4  (>b #@2  >*`ch@Z  2 > ! b<>   &* k b<  ` @2  @2  $@` 0 $ 0  $  2 @R` 2 ?`( "?m?` @W ?`l &% 㿘 >*c@ 㿘 1 *R 2# ?#@2 2?2  @$@@`? 2R  ` R`  >   2`2`㿘 >  0 & 0 ?& "W diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapbremfree: lost tail㿘   > ɘ!P >     > ɐ!p >   > ɐ!p2 8>+&  8> `?"` 0@2 > Ȑ  >   :@ 0" `"> c|" "c|> a" "a ` "`#   "bufpl㿐> >+# a#\ t  > ɔ!P  %> 3""> ɐ!p*"%> 3> `㨔 ~ > "c)> 3` @!d!d@q``@X!d >  d t@> !!P,`c!?$ D$ $ H@$ p>  `>   $ 8 8$ 0> Ȑ  >   :@> #|  > ##"|aX>  > ɒ`" h $  "` ""$ > aa $a" "a$ ``@t!d 2:: > "b> ""t @C > Ȕ @ :@ !> ǀ $!$!!d` `!: 4$! `` : ! 4$!㿘 @  0"2' 0 & 0@8> # `, "`,'@ΐ㿘 @ `0"2``0 &`0@8n> # `, "`,``'" @ 2 @ݘ 0"0  "0@8K > # `, "`,@ې ޴@㿐\#`'P'T#\PT 㿘 0 2 \ \ " \ X "  \ < @" \@PL ``< 2`X` ` `"`p`t "`t "`p 0?  0a $ 0H /d* % @ 9  \> # `0 "`0 \`t "`tH 0 0@ $ 0@7Ԑ` @@e㿘 0 > - 0 & 0H /d * % @ H 0> # `0 "`0> -!H F> ,*"@ "p*`  @0  0 & 0 0b& 0@'㿘 0`& 0@7㿘 0  0`& 0@㿘 0  0 & 0@㿘H /d * %  0  0 7& 0 0"@" 8 0 & 0 8$ p 0@; p > "`@ 0 " \ 0 ?& 0 \ " 8@x@ 8 > >  > ɒ`" h  >   :@> #|  > ##"|aX -& 0  0@> !P> Ȑ  >   :@ 0 ` "> #|> ɒ@ "#|X> !> ɒ@ "!` 0 "&  &  "` ""&  & "" 0>ߐ# @& 0H 0!>  (  (@ $ (>   > #|> a?"   0 @ 0*@& 0%㿘 @W> c> ͐ c* @ "  P2  \2 0@ 2 P getblk㿐 '@0> c> ͐ c* @@ > P26 \22H /d * %  0  0  & 0>.H H p@ Ӱ 0Z 0@,H 0 2 P >  @ 2@@ &@" $@& & P& TH /d  0`0& 0fH 0Հ * % @H 0 `"`0 "`0@4㿐 @Ґ 0 "0>  "@"`"" @allocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsize㿐>  @ * @@( 8>/H ("& <:A 8 @ 0 "0>  "@"`""  8 8$@ 8  H H @ @#" 8& 8`8""`8`8`< 4"`<`8 >/  X  8 Œ  8(<& !h  'H 0$& <`0 "`0H 0 H 8`H@ڔ" 8""`8& 8" <`0 "`0& <getnewbufDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependencies㿘& H /d * % > !> bt> w $> #|> a#> > #> #@> "@> !>/`"!! H 0`O 0> !X > ْ " (>/  ( H 0耢` 0 $ 0 0 " \>/M" @H 0 p " >/;"?$ 0$ D$ P$ T$ X$ 4$ @$ <$ d$ `$ l$ h`"  "` "@&cleanerClean buffer on BQ_DIRTY㿈> #> ""> !> bt %> > >0 $@  / %> 88`?H /d4> ɐ* %> !` ߢ  0 $ 0H 0 0@֐H /dz * %s  0 2 p>0ː!H @ 0@;> #    . 0 $ 0H /d * % > Ȑ  >  8>   :#@  ##"$ > ɒa`` $ `""` 0 ?$ 0,> ]> !> bq> 88 "@'"'А"@''耢 \> H /d * % > !` n> K!biowait㿘H /d * % `  n  0">1H 0 0$ 0  ;$ 00  0(  4 " biodone already㿘 0">1!0 0 p"& 0`> "`@ 0@  0@*  \& 0@ 0 @  0  X& 0€4 0 0 0 *@& 0ɐdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>c @ 2*@&  > ɒc` "` * &>  T> b `* @  2  T@2L 2@ ! 2 2 > ɒc`  s"`2 > ɒc` D"` 2  T `;&> ɒc` "` `  "`   "@$ > Ӓa`$ `""`H   > ɒc`  "` cȐ "c `  "`   "@$ > Ӓa`$ `""` ?'&@ `"  "` > "!  "@` "` "$ > ȒȀ $ Ȑ "`  "`"Ȑ$  cache_enter: name too long㿘 $>c>2! @ [>X!h#> c  > >  4#P@L @c $c!Ȁ F! ` "` "  "@ ` ` 2"  "@$ `$ `T $ $  T !$ , *:$ > Ӓa` $ `""`>  T> b `* @@ $@" "@$ nchpl㿐> Ӓ!"!"`!> >X!h> ْ w >a$!`c> >2#\#Pc@ @  X > "" T> > `(@ @" `  2 `@:@"" T> Ȁ`7`"0`X""`*`"``"` `  > ` ` ` > @2 `@ "`> ȆȀ"`Ȅ` ` "Ȅ"` 2`diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcluster_read: size = 0cluster_read: DONE bpx`2>3!Ȓ ̘ ` "0 +``  @   0> c$0``,  "`,  >c H " &`@`  &`&` ?`= @8@' @0Y ?$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\Y]  ; @h$T8i@d  _@0 V?Q$`4 `` : @*&` @ `*` 8 &` &`` 4' `#`#d#\ @g  `0$`0$`T@`  > # `, "`, `0">3!@0B``0" `0?# @$`0ʐ`@0-`"` `<@`P@&`gcluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memory㿐X L\` d>4"  ; @<8@ y _  0& T& 00m#\@h 0"a.  +a  $ $$ $  L< $ @& L3   6 `8`@@ `H@ >4C#`0 &`05"  @;`0 5&`0`0` &`0&`T  *`"`$ @ ޒ "Ȓ2  0  & 0& L& Xb +㿘`   `0"\&`T\k`0>5 @bT&`T&`X&`0cluster_callback: too little memory㿘 0(  4 L& L  H??@$  H@ɔ 8$ <`$ 8 0$ 4($ 0 8"& 8  ??$  8"6 H>5"0$ @ޣ" @ޞ$ & <& Xa + 0 0 0 *@& 0~h㿐 P \&`&`&`&` ` " X` 2  X <` ;`  T "` X@@`L`?P' < `; `$@< @i  @ `' @` *`` @.F ` * *a9 + <` @| <  (a$ +@&` < ; @< @"  T@-  T? ϐ&` T&`&` !&` &`&`Ð&`&`&`    @5 &`&`o&` T&` cluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocks㿘 X L >6"x?\   2 ` b0͐ j `0 v0P0 Z `0 2`<d?͐`8@8?Đ?/  + ^ `<$`8>5$$$ `LbT$`0$`X`H @$`0@$`Lg     0 2 ,b   $ `8`T:  T@ >6`Pz" T>6 Pu">6" 0?a $ 0 0 $ 0H /d * %  \`t "`tH 0 p > "`" H@ H@`<- `8@$`<$`8 8@"$ 8 "   ``  `0 $`0$`L$`X_Ԓ +?"!㿘`` "  *  ^T +`  & @&  .` <f?`@  .`" `& diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapvop_generic_revokevop_generic_revokeall㿘> #  2 >8= x @(.! >8"& @  zZ 0%!(& @ " @  2< <@2 "@   @(2  @ >& @@ 㿘: 㿘  $_   㿘    Z  㿘   Y P >c 8 `@" "  2    -diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map -operation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operation㿘 2& !>  (  ]*  (@ӓ*`" @2@>c"H" @`>8>8#`>8`# * $  2vfs_opv_init: operation vector without default routine.㿘>cbH* @ > >9: p (    (bH* @"  (㿘%>cЦ  Б,``,` Ѐ   Б,`Ǣ`,` Ё>c`Ѐ  `Ѕ** *>e!\> Ҁ"( *!\@(*"@"(㿘@,>> @D >c>c `" Ȁ "`̢  @А?`(diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘W` Z  "@T @ B&M `` @2`?? DB?4> 289   (  7`/  \ 8`< < $ $ 4 $ $ $ $$ (\ 4   0@@2@]S (0]P ( 㿐V  $   (aa  @]> (  #"% @     @2`l]- ( `l>c`!@ >c!  @ @2`?*  @2 &  6 @ 6 & & , ( ,& 0 ("$ (>c x    ,` 0"`0"( 0 ,"@& \ (@8 2'  @K  `*`>;!0 `" "& V   R` @C   (\2~ V R 2\ (s  @   @  " `B  & :@@Z V  R` @  ``"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  "  '&  "\U (y   & "  B?:@'i`" "&  `B :@ 8㿐  2B'0I; @?`B>;"*`  ( "\04     @ @V $"  ( "[   B?: ' `B  : @T  $H㿘@( "  6`6` >@ ?2   ?2    @ b `B >` @?  4&`&`6` 㿐 '  R` 2`   @ 2V  lf_findoverlap: default㿘'` ` `@< "  `@4    ? 4 @2 "#   42  2     4   8  & '    @      4 2    ?  4 2i  c 4  @2 "U  @  ? @ 4 2I   C 4    @   424  @  ? ( 4>; 2 >; @ 4    >; ?>;  >;# - 㿘 `@2   ` @2 ``B > '&` `@ ( `@  (` B?> &`  Y  8m 8``B $ ,< $ $ $$ (`B?> &` & 㿘 $`0"`0& (0,"@"  v  $2,diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsp,$ `$0` ">=``2$>=!?"`>=! $>=!@`$ X $` $` $`ɖ  "  "``Y $@"$ `@ ? J? / ? "L /"? ""$, $  $ > "x$ `J /2S @Q``Y 0{ $ X; `'`  $  ?'''''''@%Ւа   (R`Y M`$ # ?( `a`Yu $`*@@$`J /@y @`$`@6$ @`@ @d`YP  $`   @@2  @%  `$  >`Y8 @I@$leaf should be empty㿐$`$ ` ` `"$ $`@*@$` `$@#`J /! J /"" " $$`< z J 2` 2$o $`  .$`$` $`@$`J  /2``"`$`U ?$" $J /2`J /"" "$$` $`*@$` J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @ @ϐ`@" > "x2@$$@` "$`!"X$$@"ܔ "8`   >>H!8?@ ?X`< ?'`@@`@"Q$` ` `X <  $@x  `*@$`` ""@$` "@$$` J 2`  $`  @u 2<  €@ 2k`@$< 2 < "<`!ߐ<` @@  @@"$$` T$``@ > ` @2 @$`@`@? `* X < %"  X < "` `@ @$2`@`  @$.  `   @@@$" @@ $relookup: null namerelookup: lookup on dot-dotrelookup: symlink found.㿘  @*& `@!hJ 2>@A @">@: @! "@@ ?>>-!8Q O  X < J@I @{E  < 2  @">@ @?  %  X <  `" X < 0@`@T`2@  @#     @@@# @@s&@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapvnodes㿐>ac#\> >@#   b y > > 7> """a"> Ғ""""`> !"!"`> "#4> ͐c"c" > @ Z"#Xvfs_busy: unexpected lock failure㿘 <@@` @& <r    Q   >@d#㿘  Q 㿘Q  vfslock㿘> #>c ̀``@ 2`$`2  T!@皒!>A p  Pۖ   $ $ @ $ <$ $ `> `$` <*  $ <` @  /,   Y8 &  %s_mountroot failed: %d 㿘> 5!؀ ">c  ̀ "  "  $ >A!B  $ 2  >  2 @`h 2@ @2`d 㿐 > - !> 7aH !Ȑ * & d`& h`4!!?# @ `> ͒ * @ ' '0!Ȑ `'4!Ɛ & dJ   *J8*` @ ???: H2 " X": " <" @" 8" 4" 0" ," (" $" D" " " " " 2 vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O's㿘> > 7>X##> !hb0*` #!#!̑H /d * % hb0 > !`!> "`"!̀ "H 0 >  g# @ b0 W$b0 2 DH 0 >A#&U  "  \>A#@S>A#` `"``" ` \"@ L ?$ LH 0  <  @ >B @1>B H /d4 t* % t  >Bѐ 8H 0 $ @$ E$ <$ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> &@!|  + &@$ <@  '@ &@ 㿘<> ɒ` #W @^ >` ?> ˑ* cX  !   @2< <@2 D `@: 逦      < "  RՔ $ " " " $"" @h$@ @h@& @ @ Ȑ@@ 8& 8& Y$<vget㿘@@ @! "& @>C  o$ J  D 3` L ". DH /d4 P* % P    \`2  ` `>  "" \`" ` `"``> "!  ` \"@ L ?& LH 0  D` & D@ې "  D? & D@  vref used where vget required㿘 D 2 >C#& DUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0㿘> ɀ #>Ca# D 2 ?>C#@>CV# & D@ 0P H >C#@>DE H /d4 D* % D  >C4#` L "  P>C#x@x>C)# `& L> "> ! < 2& \ & \ \"`` \""& ` \& `""H 0 @w vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0㿘> ɀ #>Dڐ! D 2 ?>D!@>Dϐ! X& D H >D"@>D" H /d4 D* % D  >C#` L "  P>C#x@>C# `& L> "> ! < 2& \ & \ \"`` \""& ` \& `""H 0 `@ @`L`P`D2`P`\"```` `> ```\ "`\> ҆`\"`` `P"`P㿘 `` `X `d@ 㿘> #@"2 ` @ 2* "  D H "#  < 2  D @ "` <?  @8 > !|& 8S    &`㿈>E''`'쀠`  vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drained㿘 D  & D @!"!>E͐!& @`@a@]` ? @  ` ?@@' @V@/  >E"O D? J& D P >E"(H /d4 D* % D  >C#` L "  P>C#x@ǒ>Cx# `& L> "> ! < 2& \ & \ \"`` \""& ` \& `""H 0 ϐ ">  @2 >E"@@ QM & > #, & 8 A @ @?c > "& & @ & @n 㿘 D  @ 㿘> #@vgonemissing bdevmissing aliasvgonel: not clean㿘 @! ">F& @p  l# 0  X 7  <? 8[ D "W D@"@  `2"`2 @>F̐!x @("6  !   @2 < <@2     @2< <@2 " >F!2 @ @ 7# @ @ 7& @ P &  D `:& < L 6H /d4 P* % P  >Fw!>  \` `"``" ` \" & \ \"`` \"`"& `H 0 : ?> ˆX(   2<@2"  㿐@?# *`@`@ * @ٔ @Ē `@?㿘 @(2 # D  @@   ` @2 < <@2  D  2 VBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT| VBIOWAIT|VALIASED flags (%s) X >G"@`<>c!*` `D>G`H"H`P`@ />Gb@`@ >Gb@`@ >Gb@`@!>Gb@`@">Gb@ڐ`L >Gb@Ӑ`@(>Gb@̐O >G"’` >G>G"0"@2㿐`->c ̀=  2$6 \#\`,-    `% ->c Ȓf} >c  ̀   2$ gP ( -kinfo: vp changed 㿐 > "0 ` *` * " * " * L&@$@&@H )> @## >> X j .  &'`X >c! >H.!x``d   2` '[#> $@&@     @" `" `  2``< <2`"`  㿘\`  <"z $`0`4n P $`4 < "l$ <`i d  @ 1M @Ē`Xݙ\ U `\@$d_,`d" \`݆ B d@$ g,  . 4 ` 2 > #``. @2`` `$€@. 2  7 @"  $`0`4 P $`4 N 1㿘 `  N  1㿘 ,` >Ia`   (M $` ,`㿘@" < <& <! H " <!& < 㿘 ͐  > # @ >J   > ɀ >J 8 >J hި syncing disks... giving up done 㿘H o@>Jk!> " > Ғ  @!@  >J>JX!00U!@softdep %d 㿘> # > Ґ! @  #  > 3!`+> *`" *  `d* @? 5  0  @`"  0 &`dH /d * %  0 $ 0H 0⍐   ?>J! `d? >J!' @㿘`  2 -> !܀  >cc!㿐  -\#\ِ 㿘  t   t L`$ L`g " tvwakeup: neg numoutput㿘  t??& t>KC p L`  & Li tvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failed㿘`IH /d * % >K  `p .H 0@  H /d4`t* %`t  `p >K H 0@S0H 0H /d * % `l ``P  ````P &````p` `0```P &``9 `P &-0 0  &0>K f "`lH 00+F0 &00 0 &0s΀``l` `p >Ki!H 0 vflushbuf: not dirtyvflushbufvflushbuf: dirty㿘H /d4 p* % p &  0   0 >L7 H 0 $ 0H 0 \`0V0Ҡ`` >LH 00`   p  H 0>L pL0H 0bgetvp: not free㿘`\ >L!w&`\ <? 8?  &`D l &` l`"`  l& l&` brelvp: NULLbrelvp: holdcnt㿘 \2 >LÐ"x!P#!@  `"  "`   "@& L`"& \p 2& \ "Lx`"||"`||x"@& \P`2L>L" "P`D \`"``"``> ""`\"@"\> a`\"``""`㿘 \  0"@`t`&`tt `"  "`   "@!P#!& 㿘 !P#!@   \`"  "`   "@&  0 2 L L`/ l p 2,@ $ L x` |"`| x | "  p <   >c!>c!2   :    >c!@ !@@ & @ "` $@& vfs_register called with vfc_refcount > 0 㿘  >MI!>c ̀  ̐ @   $  $  >c Ȁ@4"& $" (`" @ 㿘#>c`` $  @ߚ  2 $ 2     $$`̀     4 $ 2 >c" Ȱ  <  㿘H /d4 D* % D  >C#` L "  P>C#xђ>C# `& L> "> ! < 2& \ & \ \"`` \""& ` \& `""H 0 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘#>c!> 7a  \A!!> 7`"$a>c@4>c> 7 H4 L( L  x" | | | | x  L" L> 7*` " x  x | " |H sched_sync: fsync failedsyncer㿘> #> "#>c> 7!>ca)>  * !8@ #!#!H /d@ * %9  @ݔ  /H 0  @\ @RH /d4* %  p  >c < ">c>N"!d ǐH 0>ca ?"a!8>c> >N!8 ( c >c㿘H/` /> # > l!@f H 0>c!>c2 Ḑ :   >c!`""! 㿐> # ޖ /$  "`H> 7> 7aܒ `" <#a>c!@> 7!ؓ22   : :` ܀  #!>c!2`@:  #!!#a a$ 㿘  "X>c!Ӑ >  Xq  `< ?`$`< @    " `< @$`< } 㿘 D 2X  @} 0" x`"||"`||x"@L ?"L Y"H syncer vnode 㿘 >O " ">OD>O" diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapvfslockx>c"    2O\ \` ZU S D ''''' N G@`@5`@ 2`X; @ < v@ @$ < l@  O$2 "Ԑ0   `!* &` @ה`@@#(  0@  N2 "0  " `!  &`@  ֚ `< װ @ і >c0 ̀@ܴ 2$2`p -  i  Em!@%!>O   Af   :>$ $   <* @ $ <@ע $  $ l` " < < `@$ < <>ߐ# $ <`  ~ @  $ <` `@ 2 <@$ x <@@"&$` <@ $ < <@*@ $ <$ < <     * "$ F$ 0Aؐ 24  $> ͒$`$  2`""" @1 @ < 2֐   D ` E0 " F* mount: lost mount㿐 D 7   € "> >Q!`!`!> ` 2  T$  2 `J$ ``2`!> "x;$"xsP@ D'''''븐 . X`l   M2 "`<T0`<@ @ H D  $  `@ unmount: dangling vnode㿘 <@@& <- %> `X@ < $& <  " <` < 2   @ " @    "% < 2  <  2 < <@*@& <`X@q <@*@b# <*@& <0 "> ͐@ "` @"@ ` J"`  "   >Q#X`X@A <@aE  㿘%> ͐ @+> X  "`<` 2` ?$`< @@S`  @ "``< @$`<`@>  P@ @'''''꼐   X `` `@`㽨@ @'''''ꢐ $ X  D  > <* $ D !2L  Տ!','(`ϔ!L@ @ 3L`( X D`0 "`0  L`0?"`0L`,  aO`0 > <* $ D2LI  PT!'t'p`Ӕ!``@g!-> ͨ@@E > X  `5@.@,`D`` " `<@Ȓ!`<>* $2L  P !'t'pM! a@`@> ` @( &&홒0& 㿐`@@  @ (D`@ <   `@@Ē @m $ `  F  ` €\    @_а $EP@ D '''''@3 ` &`P !2 Kr 2@ D'''''@  "  $  $ 㿘T   <   `@@G @ 0@ Т`4,E0  ` @`  @$$`@+ 0'`8 '8$`\ '\'<'d 0   ; 8@    ?`\0.  ?4-0 &?"h g0H $`\4 2`4 02 4>c"("`4(" (  ?7 ? 77   0 @4 @֖ ;0`@ 4 24`@ @4  2`X  <  `<  @ 3 %4  ?@    @Q0)4-F0@F 0&4`, ?"`,4`0?"`04`,  _i`0 0 !2Jd & D@'''''` ؐ@˒  Xd'h' X$€ `ї 2J2'T ``  @`b̰ \+9X Ơ`@l  XM 2  FT` h "T'T`< ` -  !@  XdT`<  @  XT @  XdT@ T @ DT@ `\  ?T@  cXT@  [X`T`H "`H\ `2`\ 2 \>c"("`\`0T."`(  ?7` ? 77`  0T@] T\ @ఒ  TX(\,I0-`@ \ 2T@@ X&\`, ?"`,\`0?"`0\`,  ^c`0 X(\,"T `a2IQ %x@Н  ~ 2  Ft`  t@ t `Ѕ ` !2I$ 2/0@o  2'P 2   F` ,8 2, X P    <>*@`!'PN`a2H o` j @ 't 'P'x'T'|P ]` ( [`<``$ /`* `  7 '8    2  '' '  2d` @ dtd@ Ԕ  d@ Id0d`t@ Z@ td 5  -P@ @'''''r : <   ` ''''`'ܰ & "`@ В@톐   0 @ ` @ Ē@ '԰l  >$@$$ 2:`  'P't'x'T'|P -` d@ t`@A `춐 `: ꆐ` $ `8 !7@ [dd`t@ +@ P@ `'''''ݐ . @2`@ H@ s   D @ IJĒ@   @ )\āP@  '''''塐 (`@ @ ĀƐ0<: @  @   @ Ĕ@ S8 @$K  2T L 2I  (`<  B ``? " `  ( 05 2 2   ` B)  `@ V `` B`@ B < `2``   `<    >P`?@2 ` D $  ` $ @'''''ܰ 2$ ``*`` !``2`@`@ @ 떐$ $ @ D'x'P't'T'|ِP `@B}`  !2 F 2'` `@ 'x'P't'T'|䴐P `@X`  !2 F 2'` `P@ D'''''䐐 `@ 5(@ '''''z ! <  `` `  ?''''''''@ Œа `" &@ @'x'P't'T'|KP 8`` @ `@qX < & `?a2`F* `@@ > ?  袐``'@ >0@"@ K`0 "`0 ( @ a`@+`X < ' `?2E @@ ?  [`'@@   0" 0`, Z`0`?@- @ @'x'P't'T'|㫐P !` @ `@є`X <  ` /7@70`?@: @@ 3`0 "`0 ( @Ґ`@`X <  ` /7@@   0" 0`, Z<`0@ @'x'P't'T'|:P G` @`@`X < 5 `?2`?"<2E 2>c! <@@" ?Ð*@ <#煐`7`''@預@'P't'x'T'|P G` @B`@ X < 5 `?2`?"<2D 2>c! <@@Β ?Ð*@ <#1`7`''@ʐL0@@ Z`0 "`0 ( @`@X < 6 `?2`?"<2Dk 2>c! <@@y ?Ð*@ <#ې`7`''@t@   0" 0`, Y0`0湠`  @ '''p  D耢??'?2@?'@ @'h'@'d'D'l @ - P @i`@3`X <  + *" " * *   * *''''@@ 荐 ]`  @e '''  Q耢??'?2@?'@@  ?`0 "`0  ( @ `@ה`X <  + *" " * *   * *''''@@@B  0" 0`, Xk`0@ @'x'P't'T'|iP +` @Ő`@`<  @ @@N  ͐`?@i0@M@ ;` 2`05  "`0 ( @`@Q`<  @ 2喐`? @2@Œ  0" 0`, W`0㿐@@ ` "`0 "`0 (`@`@ @ `0?"`0`, WÐ`0@# `''''' 2< `,` '''h'l'୐h  @!ِ_x`|<``< `  `<  " "? # @ @Ā  @@ے` @ @ @ВĔ|@cx@ْ@琐``"@Ȓ瀐~p:h  "u:_ ? @ `'t'x'P'T'|*P /` "d@tdP0K 䗐` '`$ !* ` 7@idd`@t `P@  ''''' 2`<   " `@      @7  @1Ĕ@@=Ā0ig8@@ '` 2`0  "`0 ('`< "` l' `''''''''`@   ?  @'' @7:  E`耢@#>cb$  lb$@  )`耢@2`  @ "`  X`< "` ` '  # (o:` ȇ `'"@& 0" 0`, V`0 $ "`0$@ @'x'P't'T'|P " `@    @!2  `D `@(@ !㿘 2R`   & 㿈@  "  2R  (`< 2` ?0 "0``#\㿈@  "  2R  (`< 20  "0```?#\.㿈@ f "  2R  (`< 20  "0```?#\~㿈@ A "  2R  (`< 20  "0```?#\diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map8`,`d$b ;  $`(i$`$ L$`(  ` 2`⇐`'7@` ``@`$ {#`@h`$``@ `䒐 `h$`h }$`$a  D$`(Ԑ ]`<  T -bP d` !@ D`d< = @? 8 @ 1d"< 2 @^ @`@ǐ  ?@ @Z ` H &H$㿘 X < " @ <` >` *`    @ " @    @" @㿘` H?$ H@+pp`d hl`@a'\ '''?'쀦 '' '@W@dذ %  " @Ò 㿘( @\`@&@ > <  * @!@$ @ C >@@ 㿘 ( `<   2   2  2  `X  <    @`@@>@ @$B>@@\ 㿘 (@8@ "K&@&` <?`>a *`   ( 0&  *2 @ 2 >`86`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H؝8`( <?`->a!*` "@0@@1 8`$ " 3&"z@ T`@%!@    @T`@p  a@   "` U"`ttllt㿘  (@bV vn_lock㿘a`@ @! @ @p  "$ @>a0  P  .@@2 @㿘  (\V 㿘 (@Bdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdefaultvop_islocked㿐>c"t 8"t''*` @vop_lookup㿈>c" 8"''''*` @vop_create㿀>c" 8"'''''*` @vop_mknod㿀>c" 8"'''''*` @vop_open㿀>c#$ 8#$'''''*` @vop_close㿀>c#P 8#P'''''*` @vop_access㿀>c#| 8#|'''''*` @vop_getattr㿀>c# 8#'''''*` @vop_setattr㿀>c# 8#'''''*` @vop_read㿀>d  8 '''''*` @vop_write㿀>d , 8 ,'''''*` @vop_lease㿀>d X 8 X'''''*` @vop_ioctlx>d  8 '''''''*` @؁vop_select㿀>d  8 ''''''*` @vop_kqfilter㿈>d  8 '''*` @vop_revoke㿈>d! 8!'''*` @vop_fsync㿀>d!4 8!4'''''*` @vop_remove㿈>d!d 8!d''''*` @vop_link㿈>d! 8!''''*` @vop_renamex>d! 8!'''''''*` @؁vop_mkdir㿀>d! 8!'''''*` @vop_rmdir㿈>d"( 8"(''''*` @vop_symlink㿀>d"T 8"T''''''*` @vop_readdirx>d" 8"'''''''*` @؁vop_readlink㿈>d" 8"''''*` @vop_abortop㿈>d" 8"'''*` @vop_inactive㿈>d# 8#'''*` @vop_reclaim㿈>d#0 8#0'''*` @vop_lock㿈>d#\ 8#\''''*` @vop_unlock㿈>d# 8#''''*` @vop_bmap㿀>d# 8#''''''*` @vop_print㿐>d# 8#''*` @vop_pathconf㿈>e  8 ''''*` @vop_advlock㿀>e 8 8 8''''''*` @vop_reallocblks㿈>e d 8 d'''*` @vop_whiteout㿈>e  8 ''''*` @vop_getextattrx>e  ' 8*`\''''''' @؁vop_setextattrx>e  8 '''''''*` @؁vop_strategy㿐 \>ea'a'8* @@vop_bwrite㿐 \>ea8'a8'8* @@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map    dead_read: lock㿘@  " >epN X @   dead_write: lock㿘@y  >ep:  㿘@o   >d  8*` @  㿘  \ " @U    `0("`0 0m 㿘 @ *@&   2 @7 >d  #\ 8*` @㿘@&  "       tag VT_NON, dead vnode 㿘>eq+"H  dead_badop called㿘>eoȐ"㿘 @!  "& @M˒  @!  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘  @ `,@ ` `   "`` @3@S` 㿘`  @2`,!" `49L!2 `4 2`,> !܀? `,@ # diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map   㿐`X``  `<  <`>f#*` > 2" ` ?2, ` -> ܀  , * > -aL"* `$@ j ܀ , @t+?   `D 7 S@s N , * "> -* aL $  @ $@x```ߔ0.> -!H* > !܀ ` ?`  > ,, "p"@*`    , "> ,bp* @`` xxxlxxxxspec_read modespec_read procspec_read typex   >fnq# 2 > #">fne# 2 <  >f  > - L*` * " *   `a0 6  (` '> - `!H*"> ,*" bp* ` @`   `h@   `  ` " ``"È' ( 2@ N L=@*@ > @ &@ 8   ?'#\#`ĺ ?Ė " @"@8 HBŶ䀦 "0m#Ů 㿘   Z spec_write modespec_write procspec_write type㿈    >gm# 2 <> #"<>gm#(  >g +> - L*` * " *    ` 2 6 > - ( aH*"> ,*" bp* ` @`   `h@   `  ` " ``"« ( 2@  G "F> @*@ =`@' %@@ 8 @   '?Ř@%@8HAL@Ā쀥"l#8ؐ spec_ioctl㿘  < `  `0>h* * > -" aL* `@    * @ *> ," bp* `@ @ > ," bp* ` @    @ l"P㿘 `< 2 `> - L*` * " *    㿘 > - aL `$ @*` * " *  `(   € spec_fsync: not dirtyspec_fsyncspec_fsync: dirty㿘 < IH /d4p* %p   0   0 >il<  0 $ 0H 00۠` >i8 ẖ p  H 0>i H`0H 0 㿘  p   F> "`"> ,@> ,, "@"p *` @  "    "     2" spec_close: not special㿘`  <`/ `U>iݲ ` !  ߐ`! " ݝ 4 @!+4 * @*`> -"@L*` -```  `  u`A t 4 @!4 > ,* "@p*` k{"@``tag VT_NON, dev %d, %d 㿘 ?  ` >i 2 `#l  >j(   "      x㿐       #\ ύ  spec_badop called㿘>jk!(diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘`>j#.`   ..  . . . ( . Ӓ $&`  &`  ` 2&`  7&` `&` `"@&` &`?  `?  H0 HHHHH0$HHH0" `"`"` bpf: ifpromisc failedbpf_detachd: descriptor not in list㿘 4  . 4 @ d   " >jjw#`  " @@@ >jjj#x"@  2&   "& 㿘. *  * %> р $#> ђ@$b@@b    b " `㿘?> ё2 b  .  > ѐc* @@2  @ `>f  & @&  㿘?2  . > ѐc* @H /f4 * '   vH 0@ bpf㿘?2  > ё. c* @  2`  @~ H /f4 * ' ?   $ 2/$ $>  +$ $)$ $ >k $> `?  #!F  ? #H 00I     )$    6 "   " $  $  $ $ $ H 0 = H /f   H 0 * '  $ $ $ H 0㿀?2  > ё. c* @``2`5  `0 ` H ' < (`8ΐ  (  /H /` * !   H 0 "" 0" " " 0" " " ,㿘?2  . > ѐco* @@  5q@ "i@ "`"h@ f@rj@"` "@O s@t@"`8  w@n@>X  ~@" br@" "k@bp@" bu@}@"۰  bm@>X   v@bg@9 0 "l@x0"f@"` H /f * ' ` ``@H 0&` 2    8$` &$`@H /f * ' ;H 00|"z H /f4 `4* ' `4   @    ,`4H 00] "[ X ` "U  @0P@L!P>X!T@ @$`  < :$` !P` @&` @õ>XsaT-&`,&`0(&&,`66#6@ $`8 ?$` $` $`<$`D  $`H   $`L`D ($`@ `@&㿘`  (@ 2L H /f * ' & (H 0-@b1,`  (G`ג #@ H /f * ' & (tH 0)  )  㿘N@ .` ` @А ( `> Ҕ @    0.@ $@ > !p`"@ ` 7 @ 23@ 4 2 1 2  @U 'H /f4 * ' @   H 0 @`2` 㿘  㿘`2? ?2  @*` > * @H /4`* '`   `6 "` ` " ` H 0 ? `$ >  "`$|`TH 0 㿘   ,& , (@̖ >(!@H 2 ,bpf_mcopy㿘 2 >nf#  @㿘`! ` @`   ,& , (@ >n#,@ 2 ,㿐    @ 4   ? $" 6 `2  0 f& 0& & & & E'&  <   @` D H6 L|? T& T " E <   @` D H6x L|) T& T @$$@" "" 2 $%&  > `  ` & & & & $& D&  <   @` D H6@ L{ T& T㿘  & &   & & & &  㿘  " ('ߒ   " 'ْ  " ('Ӓ  ( "&'͒ &bpfattach㿘  &W  2> >oe"!p "@"!p""" "&""㿘> !p @!p 7$> 2" @ 6( > -aL>k ؀@   `@ ,aL  ؀@2`  `> "쀢@ > # ` 5   'q  2 & ( D"@ @6   @ " @ * ( (,  ,   % "  " @  @ * ( (  * ( (  * ( (  "  "@ @6   "   2" "   * H  $?? `>q"*`    `?2 w`  `H2 ؖ @ Y2 ` @ "@ @6  ` 2ذ A@ @ *  *` *    ` 2 r@ @ *`  @ 2 ` @ "@ @6}J {@  @ 2 ` @ "@ @6 @ b* ` ^  * Y@ * T@ * O"@ * J"@-  () '  *# !  2   "  (  *    2  "  * "  0   *2  "  X   @     * 2   ĬĴ TƜƬƬƬƬƬƬƬƬƬƬƬ(D\ƬƬƬƬƬŜƬƬdƬƬƬ4ƬƬ¤ƬƬƬtƬƬƬƬƬL,ƬƬƬƬƬƬňƬƬ8ƬƬƬp\ƬƬÜƬƬƬŰƬƬƬƬƬdƬƬƬƬƬƬƬƬƬƬļƬƬ|ƬƬƬƬƬƬƬ ƬƬƬƬƬƬƬƈƬƬƬƬƬƬƬƬƬƬ(0ƬƬƔƬƬƤƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬƬH 3*`2   6(  6#  944    Ӕ*``?㿘!> 7!>ubGM@㿘>f'>f "  6 0>f >f @6->f%>f@* @" *  #E@਀ " 4 $ $ਡ*   #1@%>f {4 $ $->f>f`* "@  >f & @ 9@(   , ( # @`(,`( , `0M>f 0*` 84 , , >u"  0$`$`  `$``"``&  $`& $@$`,  *@㿘>f  > """"` & & >  &  "` "`"& L㿘>f 2 > """"` & & & > b` & `""`2㿘 @     0@   @  *   @  *  㿘H /f * '  4>w>w>w ( ;`ܔ8@6 4& & &  > !(,  >s (a  > @# `"  "`> ""  "@`"`& "@   <`"@@"`@> ""@<"@ #  2H 0㿘> " , "%  `  2  @ @  4 "   "   " @    2  2  㿘> " " 4 "  "   `@2   `"   @@|    2  2 4 㿘      >f > >f . 9@> "`4` ",` 2#   @   @`* " @ [ "   2``2` >  "     22  㿘  C ` "? `26 `2 @ "/``"'  @ 2! # ``   @    @`  @  2㿘 ,`D ( `$`   `D` ?@ &`D"` &`D    $ >u 0㿘 4 t @|6 4 " G   2    `& & " & @ > , !( >sb$  ( > 㿘 4 t`@|r6 4@ > , !( >sbH  ( > 㿘p  & && 㿘H /f4> * '> "  T 2   2*` 4 2 `" @  2T 2H 0>X!PD:㿘> " "  @n 2    㿘0a@ a$@@ؒ԰ܐ 0Ͱ a@ M 4"aH a2@a1@:a@"Ja@"` a@"aI !F@" !J@aG@a@"(a@" @` a5@"x` 0 !6@"x a~@" <y` 0!K@"l r` |6z&x& 8\ Ds2( m 4  H /f * ' АH 0 " 4 4 2 4H /f * ' H 0 4?bR!   +4 40%2(  $ @2(    2   -@ x@  > " "f&@   @ `? ``   2 &@O > "1`. @ ` n    " ؒ  2    2  ? ``2@   ؐ C  2Ȣ@  "?@"&@㿘 ` ` & & "` ?& `   x`" $ 4`2 $ 2  & $a 6 4? & $ 4 > 6 4   4  a7ذ %s: can't handle af%d 㿀4 A A  r 2"8 4  @ Ȓ   8?$ 8 4 " 4 x "  0 4  @> 0@  $ x 2 4I A " \`> !8 :; A9 @ " >w! >w!@ 2`# ! (4(沔  (w7 0` `  `  ` @b 4(K H沔 p  "A````"`8```$"  `?ܐ"   ?"  `` ?`$`$`   `` `` $` `  `7     7^b  /`@|```"`8```$"  `?ܐ"   ?"  ``  &` &` ”    $2Z 7      H /f * ' ࠀ@&$;  7 2" $$ $ "`ऐ $" `H 00b $`h $h4$@H 00㿘` @㿘 4` @ +h>f  ` @"`  2` `  @  >f @  !"6 d & d \  & \ #  `  4! ؒ@w  , 2`"% 4 `0@ 56`0;> ̐ `"ߒ >X >  *`L  > ^ > ! |>  "̐ Ē >X >  *`L k >fC >fg" 4 `@0[2`X @ S  ` O*@"@J "= ?& & & 8 $#@"   "   ?`&&  p 8  &/k ^,  0&H /f * '  @`"0 & 2" "" "H 0> 7  >f0 :*@ `*@`*@`> 7*"㿘 ؀      . . . . . . >w " % . 9. :& <& . 8 "& "   2  * 9 *` 9 &  ( E 㿘 `""`"@  7 2㿈H o4 *@ g ` `  0% Ŕ   2  >f ؒ >f      ^//////  H 0Z / 耊 2 `H 0L  @  2  @  2      $ H 0.  7   H 0  7a  ]  $ $ ` $ ` "`&``$ ` &`H 0 4㿈H o4 *@ g ` `  0% ,   2  >f ؒ! >f      ^//////  `H 0A / @`  2  @Y  2  2  H 0$ ?  $ H 0  `"  "`  "@ 7`?&`H 0 4lo%d㿘-? g  *@ ؀ >{> "",b[;  !?>|>{`㠘  $ <4 4$ $ , 8, :$v, 9 (  ??Ԑ ؁looutput: no header mbuf%s: can't handle af%d 㾐` 2 (>{Y#h 4   ''' '&`4! @" P4c ` 3^ A P & P `` & ` >{ Z#L /> !H /f * '  @`"H 0. 7&` 2" "> "̒` ""̐  >X  > 䀢* L  Hw  H & H` \ & \H 0 ` "`T 2@  1@ @"  4 @" A2 4>| ""  /  /" < "  " " " "" " ifmedia_add: can't malloc entry㿘  Z  2"`>|X""` "`"@ "`"& 㿘 `` ``ifmedia_set: no match for 0x%x/0x%x ifmedia_set㿘@ 2 & >|#XY֔8 >|X}#㿘 } `zx0!50 !6"&o `@x `e " @2@2Y &@& P&M& ` `&`&`&`&`€`   *  є ` .$` &2 02   ` *`$E "`   &`  ifmedia_match: multiple match for 0x%x/0x%x 㿘 8   @  2  >}!Y0 2 㿘 2 @2 $ & "@ Ȓ 뀦>f耠"  @ 2` @   R`  ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @P  2  @>       2 `  @ ``> 7 ( @8@ @@   @  ` 㿘@V``  ` ` @"``V` 6` ``2 @ `    JJ@   ` p` 20j:   :  ",@8 ``V`4 `Q K``"` 쀊 `@ :@ `" ` T4. `2+ 0 @8  "       "   2  "  2  J    2 @2`  ` 8( :` 0 ?2"  "( * 㿘@`     JJ@ *J 5&&"  *`:  ` ` ``V`8`     $ $ &` &   2& & &  rn_addmask: mask impossibly already in tree㿐->  @ " @( > 7> 7"(b  Ғ`'> 7 @˔$ ?('> 7L?  '> 7 $@4 !>f>fa܀6"a>  r ,!܀ 6 "@@ $!*)>   `  @ 2 V`T  0;  K @`0 0  8` >aU  0/   "  $  `*`:; `>f!Г*`J:`@2 $ $* @8`6   .  @ 2  :  @ ` *  Mask for route not entered 㿘> c  "c    >aU2  @k  6 .  " & & & $Non-unique normal route, mask not entered 㿐  `    2  8`<  퀦`,T :   I  y   2 2`$  ` , `$ 2$$ $ $`? . & 6` $ 4  @,  ?`8` `T 60 ,T: @& 2 J &2` *`V:@ :V@&$@&`P-`T`:  0J  & E$ :T`@2"2,V<`@&!4* "  ` >aT? Ӑ ̐ 2<`V@&$ܐ&rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Mask㿘2 4  @@" 2 `ǒ       2  `"T O > $T aS հ >aS 8  ? 2" T `8V @4,  V @2 >  & 2> #c""c2 > S|a   ` 8 2 & 2& & `  ```" >`2``"> "`b(SN   b  `2"`"`" S"    `2"`"`&`"3 V  "*#2## & ? " > c""c2>>bHXR  Ɣ  "  " `2"`"`  # ` , , #㿘V  6   `2  "   V  6    @   2  "  㿘  t1  *  "+ @ t&> 7"$, \ , 8$ $ *` 2` c> 7"(>>>~>~>$` !bt̖"$$ $$$ $( rn_init: radix functions require max_keylen be set rn_initrn_init 2㿘> #` !> > `(㐀4"``> !> #`*`>``RM 0)  ʔ #> 7 $b$>R! #*@z@ #> 7b$> 7  "( "  +  *+> ΐ y >R 㿘  >f 7!>f{ "$    4 4 > bb $b" "b$  㿘  "``"  "` "@ڒ 㿘   > ف 㿀> "'T'X'P'H'L H  @@2@ `" `@28  "  @ 2.  @ 2$沔   L   ࠀ    2 LÖ 0 Őࠀ  0 raw_usrreq㿘 `  k -    \ -J`U.`>"l   M (I "F 9DC "> 9O0 <8 1 8$ + 9 `€"  $ 1b   2   2   9ٔ& >Pސ p0Lhx@㿘> #  "  $* €  2 㿘g> !(㿘` `@  `4  @ &`` 2   X > !(*` 'H / * &  `3 `€ .> +c`"' 4!" 8̒     @ ' 8 $ 8  4"  ` 8 $ 8> ƒc`  "` ` @ 4'Đ@  H 0㿘`  `@  `4  @ &X > !(*` 'H / * !  `F `€ "A  2= `5' 4!1    @} "' 8 /$ 8 " 4"( @0 4 ' ' 0' @ "  4 ' D' 4 @  0 8 $ 8  > ƒc`  "` `   @ 4'Đ@  H 0rtfreertfree 2rtfree: %p not freed (neg refs) 㿘 2 8>O#h?-& 8 4 )  > >Oq#pa? "a>#P0@  @- D`" ` ?"`  b _ ifafree㿘 2 >OF ?M 0& X&  j 3 @'  0 @2 @z 2  D  2 A`<" "4  4 * 24"p '''''' @``4> #4> Ɛ "4c  @ǔ A  ``'@D`> c "c􀤠 $@ 4''''ܒ@  -㿘   h /^ 큐 2} "   8 4?` & 8 `@2 D  D "  `@  "`@Ò 4''?Ȓ@[㿘 ,   `" ( ` 2  (; " (` & , ( 2  (  " (& ( ( 2& (    "  "   ,`" {& (`    $ $ n& ( (`" 3 , ` & ,rtrequest delete㿘H /` * ! `> a(* @ ԰ /`$ 2&` "  "T`(0=0Ô`` 2 `    " `x>Mΐ!F $`x  8 ?$ 8$`x`4`D ? $`4 > a "a&`8  $`80"  2 4  D >&`$ 0&` H &` ` &`$ 2`(0 n`(  %  d 7@ْ `$ $ 4$ `@b` | S 7`  `@ `V  `  2  x "  [ X /   $ $ D  $ @ P`P0 ($ | T 2 P 2  x "  T <$ T& 8 $ 8H 0㿘@ ?    ?    0 "  ?  @8  `(      2 & 6 _ & x & 0Ґ̔  x `8 ?"`8& x 4   & x P 2   T`T( & T 㿘@.@ @`.@ `     .@`@ *@ @"rtinit: wrong ifa (%p) was (%p) X ' `0     2 7 T " 8 D?@$ 8g 3e A L$ D@ 4 ' '''̒'9```   @W 8 ` $ 8`27`24 "0 8 D?$$ 8>#Mi D    D` ?"` $ D $ @  <$ T   &   @/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../net/route.crt_init_done == 0㿘#>fa耢 " > >>>"bXK#u""@!> 7"0>c0B>X!P0R $a㿘>f!耢    N   @ && &  & > @@`&  "`"@& "rt_timer_queue_destroy: rtq_count reached 0 㿘3 `"  "`   "@` "`&  `"@ "  €  `      h   ">?& L#  2  ` "`  " rt_timer_remove_all: rtq_count reached 0 㿘$ `"  "`   "@`"  "` "`  "@ ` ">?"`Lk    2 rt_timer_add: rtq_count reached 0 㿘H /i4> Ґ* *> #H 0  .  2&  `"  "`   "@`"  "` "`  "@ ` ">?"`L! Ғ  2    ^   7@ $ $ $ $  $   "`  & $ $ $  "&  `  "`rt_timer_timer: rtq_count reached 0 㿘H /i * * > #H 0H /`4> * !> "@`@ 1``"  "`   "@` "`$`  "@ "  €  `    ߚ  R ` ">?$`K#`` " ` @ & ``2`H 0>X!P.diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘`      & @X `( &   > `4?"`4 > `4`?"` > `4`?"`> `4` ?"` > `4`?"`H /``* !`  > # 2   n`=  :    H 003  > `4 "`4 > `4` "` > `4`  "`>f> `4`  "` >f"> $ 4`"  @6 H 0route_outputP'L'T'X'P'H  '      ,  2 ְ 7  2 >IH `K(' @'u   ܔ  'm 7 ~[ %> 'a + 4&@ 4 'L@Д`' ` 8K Ȁ "  8C Ѐ "   "9 7` @ *2 7@P` ", 7` '  `Βa2 " `>#*`  Ӕ   8 D$ 8Ȁ   Ô  $ @NP`8?"`8"`H> a(* @2  / ̲ "ݸ ` "׸  8 $ 8 T  0 0 ' 0' ' H' 0 @`"'` ' D'`4 "' D '`06'ض @ @     " 7N b @˖  4$& P< (~&  zȀ  ( m E " "` `؀` Ȁ   "oΐ -&`D؀  2 ` Ȁ ``4]` " ` `" `D " `D  `D` Ր?"` &`D`  '` &`@ $@u`P`D "   Ѐ 2&`H`P * &`P $ &`P - "& @& "6 @ >  D 4   {C1 @v  {3 "@}  `26`Ā  >f2" >f>f>fbĖ` 6`22X226662쀊  `" `" @`" `" ` "  `" `"` " 㿘@  :  *$ ?  @ *㿘 J  @*@  &@T`z\  3`8 " $@@` @4@@ 2@T`z:   " $@@$ ` "` @&ݲ    && rt_msg1㿘    Lh  T Lh$ >Fɐ"@y   `     z "0  & & & @  ,`  @*@&@ ?   k@,  ,4,z  㿘 &@   L  T L2 ,``  @*@&@ ?    M``,`)% $  &   "D  Ք  &&  & ,,4㿘>  D `: @ " " @>fb " 22>f>f bD`>  D @R 4   D` 0 84 V 4 $ >f"$ >f>f  3 `>  D ` c  @* 4        @' `'`''ࠒ = 0 2` `$"``"`"`  >f "( '0'' " 02`4`"` "`"` >f b 22>f>fb`@    4`@F @ 4 @  0' ' H''  D'@'4 "`'  ` "!`  P 4$  t ($ & $ @`04 $ $ $ $ d` "`&`&``@v 4> ""g ``" 0@2[ @ 'Ԓ ``E'` A804 T4 D$  $ `* 2=-`"@@ 2)`@ '`'` 'R`````  02` `"``$"`"``` "`&```р '''2` x  f `a  @ '   ''''H /`4ؐ* !؀ %   0 `` > !(.`  `@2`> (` `0JH 0 e 䀦@ '"  &  *` * " @( &route㿘H /` * ! >X!P>fx(> "`` \ @> !88@ `2`H 0arp_rtrequest: bad gateway value arp_rtrequest: malloc failed 㿘>f`0 `L> 8 `"8 "8!> 7"H>`(f>X!P(v`4` "` `0"+ 02 `4` ?a&`4`4a>f` `@> 8`0,`@ 04a8w&`\@" ` ``@ @m  > 8`@a` 8,`@ 0Z4  7  &`L>aC 0M> >  p`# p"@ߒ $``4$&`4> bb $@b" "b$``  `D`H. &`\`@ ,` ؒ Z >f"  > ",&`@> b?"b@`"``"``@"@&`L`4 ;&`4` "vN 㿈 vr  5  `%  % @% >f  (4  4`(  4 4 , ,  `  ` `   // arpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 㿘!>f = "  ^// /   / / r/ `"`L @ 2  `2 `\>aB vVZ ``0> !8@( 4  2  4    0C 4 2@  "$ v4$ `\ 2 `\>C!> !8&`\`\`"+ `4 ?&`4  > !8@"  > !8>f&`\ b @  $ `D@`4   >f"`4`\` &`\&`4$  arpintr㿘>f" WH /f * ' #>fb b $b"`"`?"`H 0 > 2 >B2 8  x  #b b   *   : w b h@@p bu b arp: ether address is broadcast for IP address %s! arp: ether address is multicast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s x`? `'غ  > " H2< `@2<"HͪH2< `@2<Hؐ@    >f`@  !>'!!>'!@A` 0 ܀!>'@"(AL ' @`? ~  z 0v  5 `@i L4@!>'"`@x巐A 0Y@#>'"b!>'@a"堐 A  $\@" ,`" , #>'c@D@ 偐@ 0"  `,  \ > >f!8b| $\4 ?$4 `%  % t70A    @c   } 0   vr ؒn  (55d ؒ` (4  // arptfree㿘 `2`8>@R P $``0" `  2`*& `4 ?"`4 `   Қ arplookup: unable to enter address for %s 㿐> 7 `*` @ , $ 4  28 4? dd"80  "L`   !>' @{@#   -㿘`H  `>aؐ!&`&`㿘      *   h@@0si㿘   /  >f0) '"0%"  >f" @#>fb > 7`ؐ @  > 7bt  > 7 bp  $b> 7}"ps2㿈 r̒  4  %  % @% >f y   54`  4(   ؖ 4 4 , , g c _   // revarp㿘%>f  - >f#>f "b$b??>X!P>2 > 7"pP: g #"? $b> 7"t& > 7"p!   3㿐Ȓin4_cksum: offset too shortin4_cksum: bad mbuf chaincksum4: out of data 㿀  `/ `8 >>!H 8>>!h@P /7  '  '@     $@ `  (  @? @#  "" &, 2 4 ?c 4$ * @,  ,&          ߖ ,  , "32 4 ?c 4$ , 2 4 ?#@ 4$ ,   #     ?2 * @ 2e >?~!, ?# , 2 4 ?c 4$ *@> > 7 H x㿘!> 7"x  @2  &    2  8     "x""" $"x&  ?㿘!> 7"x"  "  2  x 8  "x """ $"x  㿘> 7"x"x  2   "Ē 8㿈%> 'L'P'T'X'H    $ `  ``q7$`0  ` : sm 2 ` $` "& & @Dې  `q"0q " & & ` `` 0_  0\  $  4 V `2Mw  p0K"`"`8 @2D > "'' ` ``t`<`'`'`/`2` 2@8 ?   Y&`@ 2 &`> "!H `` ``t`<`'`'`2`0< 8 2 `p$ 0`" > "'' ` ``t`<`'`'``2)@8 "@@ 2`?`>!*` `( &`@ &`> "!H &` `` ``t`<`'`'`2`0 " 4 <` 8 2Z2V ?@> "` > ` 2`<`> `0& > "` ` 2`<```t`v ``"q @ 2``j &`` "`` "` ` ^ \&`  "W U  " 4 O<` 8 2" `o"0@?@> "` > ` 2`<`> `0& > "` ` 2`<```t` `` @ 2`` &` `" `?` >!*`  &`@!-eeeeebdbtbtbbt㿘H /` * !   ?8 &   4 2& ِ?@   & @ 2 & > "!H& H 0㿘    8 ?   4     @ 㿐#> aH QH /` * ! > "$aH'' `4 `t`< '+  ? $   2    @L   @G  $  $aH ` `t`< ' ' 2 H 0H(> 7x2     2H@ t)  ;> "` @ $` $`$` 2* *2" ""` ` ?$` $`*, $ @Bb4 4 ` `  $`$`   /'/  @@ > ڒ` `  "` >fȀ> `" `,`( " `<`2`, > `"  `4`0 " `<`2`4 <  8  ?     * H"*  "   " * `` 8 2`*  㿘@   . ``:` `*`?&@ #: . in_control㿈 !@  !@ 00!@0  " +@ > "   2 < a@"'a@"< a a@qa@2 a0a#@ a!@j !@  aa%@` a      2 < H@2 < !@2  "b 1  > >9 2a    x@K x$ <> b` <$ @`""`$  $ "& D T d $$ $ , d4   , T, U$ $ t4 5 > c /"c      "    H ``<` ` 2`<`H 2`<` ` "   1 a@Ȑa@"84a @g0ڐa@Wa@f00a"@"4  !@^a!@ 0Ða#@ a%@0@ D4 9: T 45 T2 d , T B>   1 0    $ 챐$  쬔  4  T   @n ~$ 4y$ h E    2 D   H@" 0  @I d0  h $ 44 "! 2 @7 T ۔   24`"4@) 4 6! 2 T  0-@ ` "`&  "@ <`" @ @"`@> "" @ <"@ ?$  - V invalid argument to in_lifaddr_ioctl2 >8#P!@ "!@"Ȱ -0!@2ð - @" 2  2  `  2  @  "  8  !@ 4t!@"  -0!@(t - @2 @ @1 - "%  // ai@}  @0t @@ 2Z   !@      2 t  2  08 1!@2x D Dݒ4  T T֒0@9!6 h&& @0 @Ŕ  D D4  T T d d aP㿘@㿀H /f * ' `D     a   ~ H 00UH 0 &@’&@ ?0  ??&`,`4``,&`h&`4 &`,`,`d`4 &`(&`0 @&`$ 4  `0`42`,&`X`(2 &`8 @  &``U   @U 4 8 '@Đ㿘 X H> " h` `h@ 2`<`  4  "`H`X 2`<`  `<`2`hꂒ    $ 㿘` 2` L 4  "`H`X> "`h 4 @  h 2- <  4  " H X @2" <  2 <4 ` ` K ` ?$`  4    >    $  2 h4 ` ` , ` ?$`?. ,`20`> , ")`` "%`2H"X" 8>f̀" 0" (2  2`@ 2`4 xH /` * ! %> ` ` 2`<` `t  $@      $ 2   $  [&  6ܔ  2 @H 0S  && &  2<2 & * 6H 09 t & t "`t"t&  ` @// ' a1؀  `"  "`  "@ 6H 0  H 0xH /` * !  ? &  `"  "`  "@ / '  a2 6H 0㿘&&     & 6 >(0 *`0 *  * 2`~0> ̄`( 2`~> ̆`0(@ ` *  㿘 ܒ   U 7@ɒ >g !>g>g>g, a$  , , , $ 8H /e * & $ `@$ &`"` &@ 4  6 `  `* @ $@ "  4  6 `  `* "@ 4  6 `  `* @$ H 0 ?$ &  㿐 8>  > " c  0 " 6 2  0 2  "  `   ` `T ` ` `< 8 `6`'@ F - Ѱ 1 2"- 4  0#a2` 2 ਀ > `l4  `@   >  8 ਀ 2 0> `l `@ " ` 8R 2` 0`& 0 26 6 `  >f>f"bހ a2`t #  "X  >f>f"b֑, ,2 5`@8, @+&@$, 4"4 \ 1?* 2`@45`: 4   > `l  0@ ڐ76 6, m@$@, 5$@4 & 1 * 2`@ 45`( 4   > `l  0@c ڐ6 6@) 㿈` `  \   " V / I> "`"`0  ? `H2 `0`  4 "`0`X$ `0 2`0`8R``@`@ 2 `0쀢 . 1'* `' '` @5`6 "`0 0 2 `6 2   12   1$`0 $`   @4`4㿘 8   "& @6 4 8  @㿘 8 o"` " @g @ @8 H /e  "@* & ` "` "  @ "`"`   @ "`H 0 ] 㿘` &` @  , , 64  0$ 㿘` &` @  , , 44  $ 㿘` *\``&" 2  8 . 42 @2  6/ 2 @2  0 ` @㿘` `` 2  8   ` @`& @@2 4 D'`0'` '`4쬖 `4  ``  X`008㿘 @ /& @㿘@ @9 `6/ 020``  `2'``4.02!``0`"`0 `02`     " `6` `@2`6㿘 @  @@Ò  8  `2   . .  2& 㿘@ ` @28 8 9?"8&@2@@ "  @ 2@  .`.` &`` @ @` `@ 4 "`D 2  4  2 4  4 > " 2  1⁐ &@< 8 2 D" D> "  2 <  D 1'  D`H(@"`` `@ `4` `6  ("@  ( `4` `6 ( `4` `6 ("`H in_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d 㿘@.6/  @7  . / 2' 4*2 @2! 6+ 2 @2 0 2@ ` "` "@ &@" #@&  2  >f"  *+ >#H223 internetdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘>g ̀ e>g"`Ёicmp_erroricmp len㿘 ` * > c "c?@ 2% `!  @*            > c` "`  #  @  8   @ @*  8  `(8' c  `  i    d< h`  $  ܐ"   ?@$ `( >0!h> # .` ``" *"` "*  `2 *2* "* >2*e   2    $?쀢 : >0a!x  $ $ $  @$ * @ "*  2* 2 "  "k4 kj@cА㿈'L'P'T'X'H  ` $> c` >"`@8 @ :  e 2 > c` -"` "@& & @7` > c` "`  "@& & (!> #*  `" `(>"l*` P>",.    A# <# 7#   j `# # *` @`8#` "`< 8 >g # >  >f*` *  *  0#` "`>g 2I.  # #B.>g  `  # #`Đ "`Ā`` @.&,& >g ` U# `>g >g"  `r>gέ 䒒 m .`h& 2  `  4 2`X " `X'   j  #7 ``  "`* `@" 0J  j >g Ȁ >#`#( ` *` @`8 #` ("`>g # >g`"`!>g "  ' ɚ쀢 >g ̀ >g > c@쀢  j a  @ 0b@@@@H@PXXPXPXXXX x`tx   ` *`' 2  ?  "b- >  $b >g H@ >g  4 " < X@2 <>g 䀤  "  `  2& Hؐ@˒ ܐ *` /"`C؀`2 `t> b`T z"`TԐ   H`D "`t`8 ?"`8 H $ `a,@    ax    % "@ "9  D 2     % $ $    (  `@ހ   4     *   % "4@* @ $  "`&  "&  `  |6 @  a*㿘   , "@& & 4`@5#"@4`  "@& &    @  㿐@J9T@^a* &. . @#㿘`@ ?`:> ,*` >g >g  >g >g 3>g`̰5>gЀ  `̀`  &ߞ$`̀ &а *Th|㿐K  "#  4 >g 0     P (: Pݿ>g!>b$> ݳ 㿘>g Ґ Ԗ : 2#P T `   * $ >g`!@ <>g! !*@(P`!'`@ <` "PT "Tp icmp_mtudisc_timeout: bad route to timeout㿈 2 4>,!  2  P  ː   0  h 4> >f*` *  *    0 "& T㿘>g >g> ΐ!ڒ`Ā`?icmp_redirect_timeout: bad route to timeout㿘 2 4>,#      ( 0 㿘.`    ,`. 2`2 .@$2`. 2 , 4 .@2` ,`6 㿘%?)> 7'တ @%"#c4 > 7 > 722b > 72b%""` 2 #> 7 4b > 72b 4bb @*   e%"@c4 %",2   >#,  ,`@ܑ2 *  2 ,` 2  @c ,`2` >g2  > a8 ?` > 7>g> 73""b023a0㿘%>g0!/@> !8> 7b!> 7!> 7" $""0 2 @/@ $"l 4> 7`!> 7> 7"D"> 7b @ma?4"`> 7"> 70> 7b" *40> 7b>g2@ . 6 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK%d.%d.%d.%d㿐>'1> 7"c-ipqeplip_initaeshmac-sha1deflatex>ga ~_>ga ~Y> >  cȐ!#\ !/   ]   >+R#>f" *"@ *`" *  *  * " * "> Ǖ:*$>g`   $>  2`R  " *"@ *`" *  *  * " * ":* ` 4*> "!> >g!"a > """"`>g!x >gL!|>g"a#> ̐``@~Y   (@``2*  * @#  (@ (  (> ̔~`2*@ ` ( * @ " > >cؔ @}!> >c @} > >#Ȓc@} ipintr no HDR㿘H /f * ' > ` ` """`?"H 0 ` ` >*"@ 0ց㿐'> ☀ !> " $"  "`O  2 `  $`  <@  "`X "`X2 <8 ` "` `. 2 "` "` ` "  ` 2    4 2 "`p "`p 2 ?  " t `" " t@1  "` "`& "`t "`t`@6 > b` x"` > b` o"` >g 2"@ & `& _>g"!@ \`'@Y "`  4 2>``< 8 #☀` `    ``<`" ` 2`<`  `t 22` > >g!h  > (`]K"(0@ 0`?@"`   _} 2 > b`  "` H /f+> ɐ* '+> ax   H 0  > %axH 0 > ! " ` @2`  @2 ` @2 ` @"` 2` ``"2 4`*` `*> b`` "``H /f4%ax* '%axH 0 0* 4`*  e > "'>g>g᠒`  $@d $dH /f4%ax* '%axH 0 0r> Ӑ! O d $dH /f4%ax* '%axH 0 0V `$" *"@ 2@H /f4%ax* '%axH 0 0; $@  @ * @H /f4%ax* '%axH 0 > "4`> b`4> ǐ "`4 `   *` >f*  *   0\5> =H4 4>g40 '>g`"#<`2< 4"<X`8 `0`(2 <`  `2` 2H 㿘`  ` *`  " & -&     > > aa &@" "a&` <.` .`  6` &`   &` c&`3 `2]` Z ` ` `@` ` @( :`    " 0`>  ]`2``"2` @ "@ "@[}` @`"``"``@"@> Ӓ ߐ!>ga?"a` `  4 2 ` $` " &` `  $ $" %$`  `  `` `@`@   n `? c * @  > h`@`"h\ ` -> \&@ '>gᠢ?`$  |᠒?$\ϐ2 5 `% `% @`"``"``@"@i   * @&   *  "@&    @& `Z"> Ӑ! >>ga ?"a㿘 "Z `"  "` "@> Ӓ "!>ga? "a`"  "` "@ 㿘H /` * ! H /f#> ɐ* '#> ax   H 0  > $axH 0 > ! ?  *>   `" 2 H /f4$ax* '$axH 0 H 0㿘H /f%> ɐ* '%> x "  H 0   $xH 0   "#> a  > a`R"! > H /f4$x* '$xH 0 㿘 2 `2"> !>g!*` >g : @?> attempted source route from %s to %s h  * ?   ` `  ? `@$`Dx``Q`Ҭ%`2ά%>g!p "   />g $Ě 2?`%   '@)%x `2 ı  Ր@'Ԕ H% xϔ  < , 8 @ @ ?  ? z>gaȢ x N  H`@'Ԕ Hx   b,x ꀢ`$逢` 2   *` ? ~'H% А?x   "   +$j $f   a>g!"  %Hxb   O!>g!ȒxU ?  /'̒ ̒xE  /% ``  >g!h @p 6 4 'Ԥ@8 !>'Ԡ %D   ?  ?  $   *"@ 5   > b`P  "`P㿘> ٠!?` > ـ`"  `8 ?"`8> "!  > $ , ,!> !   DV > فsave_rte: olen %d 㿘>g!  @>"h&`+ !> 7"w2 >g"a$?㿈   //'7Ԝ 2 8L   4 ?& 8 4 $$2: 8 0  > 3 8 4 "`"+ 8` "#` 0  @2     `@}Ғ 2   8 ?& 8   2``2`  8 ΐ?& 8 ip_srcroute: nhops %d mlen %d hops %x %x %x 㿘!>g!  Wt  !E %>g*`  & >% X!> 7b* ?  "@ >@%y x  *`*` `w  `   >@%c > 7$@"?`> 7">g! $@>%Q 㿘  @` * v"   "`&  "& @* @@$@forward: src %x dst %x ttl %x redirect (%d) to %x 㿈->g     >` "X`% ` ! > `' 2 `> (`WC"(0`  - > ْ> ٤!,`  `@    8 ?$ 8> "!  ,,`!> $^!!     i 0` D4 W}  " @ @ `Y>*` @ @2>g 4 0.>g  `(>g!l $`#>g >g D!4` 0 >g 4 "` 0    >"x $>g! > ـ`! !#\  @i > b`(  "`(> "`$ "`$`, "`, A>" *   > b`L  "`L  V0 ɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɴɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨɨ㿘`ǰ ?`>"L*` >g!h>g!l>g!t> !܀  >g!p>g!3>gaxax` 5>g ax>gִ!|&ax 3>ga ے ah {&a3>g{a|>gaqa|ֺ 0l>f[">fV">fQ">fL">gG!>gB!8>g=!<>g8!@>g3!D>g.!H>g)!L>g$!P>g!X>g!T>g!\>g!`> !> ̐ >g!d > ͐#  -Xlˀ@˔̘̬@$8L`t͈͜Ͱ` ip_output no HDRP'X'H'L'P'T   ''  >!"`@'!`@<`* @ &@6`@: `*`*  > 6`&@b`8  "`8 $&@ * '` \  @t̒ 4 "8 `@" 8 ސ?"8&    - -`%  " 2 4 >   .` 2`2 `t> b`T AѪ 0& "`t4`D `@0`< 8  H&` 2V`2@tp 4 "8 `@" 8 Ґ?"8&    - -`% `" 2 ؐ P>   .` 2м`2`t> b`TA A "`t4`D `@0` 2`H&` `< 8 2| W`!"7`   .` 2` .`` T4@ >  " ` 4 2 ` > b`T 3 "`T  > "` > ` 2`<`H&` > "` ` 2`<``t) `    2 "`   "``  @ @A` ?# @'` @ ` 4 "Sݐp'阒 "`4 t 1 2`o <@8k (`! >7`$"`  " `  P 2` ` 6``  @`| , "`@` ?# @'` "`| , "`@ݐ` ?'` `< 81`| ,  ` >  '` b`x "`x@'.6` 6` `  @`> aa, "a,> c8`0 "`0@`4   (`P 2> `T 8"`T> b`L "`L" ? 'ݮ (`  @ @` ?# @'` `` @o X~  > &"` @'`rm ` c 7` `@ @= `**` $@'` `$?Ȑ*:`@7 ` @ 7 ` "@'  7 @7 SS  B'@'`'`| ,  ` >  '` b`x "`x7 @&}7 > b`H "`H`  `T%@ & `  6`6`| ,  >  & b`x  "`x> b`< 7 "`<q 6@&G6` 6`   '`Ry > b`D "`D`` `8 А?"`8RZ㿘 ?` c @ I` 2$      $" & W  6  q` &  ?6 `> ߐ&`   & & &@⬰&    & qz    @& &  & qՔ   qh`& 4 malformed IPv4 option passed to ip_optcopy㿘  * ?쀤`(`  "%?쀢 `,  8 >G   >? q0$@` ဢ ?" ,   㿘`  Т r u 2ʰ`g>!8*` `@ "\  2W  `R>!$*` J.`eH.`l`` B&`` ??&```` 9&`` ?6&```` 0&`` ?-&```@2' "%  2   "``"`` " ``  ? &`` ?ߐ  &`` ? &`` - * ]PY`S> *`  PȒ '` "F$  $ ` p ? P ' `)$ > *` !`e`l`` ``2 ``2 `@ P ' $ ``  2    "  $ "@ - *\ߠߠߠߠߠ\0pppp(Lݘݬݬݬݬݬpppppވ㿘 `PJ`&`  `T P>P Ka`   E `&`  pA`@p= `$3`  "/` `  - )'  2$@` ?&` ,`o p`$@` א ` ,& O 㿀@   X 59 &@ ,$,4?`>#*` "  2 > $"`  `H2`<`2` ` T`4@"Ӱ 1$"ΰ  2ʰ  ,"ð  2  8 ,"  2 <8 @@ 2 >  /' * " " 1̣ @`"`  `H 2`<`2` `l T`4@h  6  , `2 @@2  g 0c ;剐,  "@ Z 7 V4"S  2O <8  "E `>  "  H 2<2 `"2 1  `,   2 ,   2  ,  1Ϡ 6 , ?,  & `?4 -  @@@@ݘ 5&@0\㿘 N   &0  # -0+ ``"` @`> "`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘    ,  @a  , A 5㿘沐 OD  ` 4 `@"w*`4  㿐  @ +   "  * ` 7 `  <c7 `   0 , 2      Ö0 2@ 㿘> #; 㿘 +> c->g (c"`@@ `m`"`0 @24``0`"`  @2,`` ` @2$`沔 NƖ  L(b N@ `8aࠀ  `8`c@2 `mL>gb(a N!0 `ࠀ  0     h > N > " 0 4" 4" 0㿈 'P'T'X 'H'L ` `J  ?`#@I ``" 8`  $"   ?ܐ"   ?"    ?`& &  N  "    "   &   .`6` m.`  6` 0.`&` /&` ?#$ M- (@@  "`  `@ 2 <@6`M  > 6`> b`\ "`\  $ @㿘`  C  ?M쀢" 5k3d1 0' `" ` 8`    `  ?$ ` L\ LԐ ' "  ``  "@  - Lݞ mrip_attachrip_detachrip_usrreq㿘``    ``2 `.`>"d  "`>a# >g "8>g<_ݐ x> cڐ q`n, m` "i 9^ >?#宐_ > " "U 1? 8O 1 "K$ 0 "F 1C$ 0 = > " 2 `6 1? (`/ /^/$ +_,'`   8 2 9    -坒 娒>ߐ#Lq( D  <  ( 㿘> p> * @*`"@ *`@ d"p"p$@4 4 $  tk! t@l! k (4 p @k (4 p㿘 x` 8+> ӐaΒ 2 > `L"ǰ   `    " $+> ``` " `#!@> !  #   ;`BK; aU0MВ"&`&`> ! #  Ȓ ;`B; K `"  "` "@a0 "$  ` " $$ 6 " "2 M $ 6` $ $" & $ $" $$V d $>  ":    @24     &   `  $` "  " Kn > ^ L> ӒՐ!䀤``  @" ^. L   㿘H /e  > @  0?* & > cc> ͘ '<"  Rd 2  .`62   c> ͘?2<> cc<" Rd  c2  | 'L'X'P'T $ |'H   2  ''7'''` `( Jސ0%`  M   $ +    " '@j4  2 ?߀ @ !( `" "!(@q* ` 4$` "`& a( "a(  2 * 䀤"> a` "`5' @ : M< > a` "`"   'ԒԀ `$ M 2 `@B @2  2   '' ' ` > '#'*袒 2`<> !!  $!> #  `2`<! $!>gVd Yd 2*@`8` 1  7>   Xiv (` $[ 2 [ 3``'4`6$`0$``< 6d`P@ A!> !Vd` &>X!P> Б2`@kǓ:`4Vd  #\Ԑ@(Vd 2`P 7 2`P@,`P2`P`"`P@2`PĀ@2`P "  !&&䀣 j"@ $`PĐ"@ 4`P@*`PVj 2`P!> !!` "!> !ؐ"@ @e`؀"ܐ" $> !@T"@ !`t" `` >`B ;`#`^I]&Ā@20` 2`>X!P2`@Vhk*:`E` \`t @K`P G`L"@`X`T"@@ 4 4<`P>  @  `L &: @  C K8\P[`  p >g"p  6p> "L6p|p@'`L"@`X`T"@@ 4 `& "@@ & Vd &  * &    @2  2  @〦  # ހ < 8 Ԁ' e耢 ̀ H8  ƀ$``!  $ ** " @hP2`0`$`0 $`0H/H+@ ߐ &t@  7' #\Ԓ@`&@ &>X!P>g2`@:`"Dp &&6p6d&&&&j"&=4> a` p"`  > aa  "a"@  Đ"@  yࠏ  "@  Đ"@   :@  =6 3  &&5 p `&6p&*&" $> `Yw"p  ` `6d..  ؀> !@"@ l &Ȑ 6d &@"@I > ! ؒ <  ДB; ؚ`'# и??&U& # 2"`܀ <> !" 4&>  !:  !B`#!# c; " >  &`?6?ߠ?䀤> p 6pa`` < B #`;` ?> !  < B`; # @'̐&"'"6?6` "Vd 䀢 " @ ݐ> `"" @ " ?> a Ѐ  ,# В : ؖ B ; Vd 2"  }@@ ' ဏ @܀ pa 6p` "` ؒ < B; ؐHے ?"' @  "  > !&&  @d?* : `>Ő!D*`  = 67`8> 6d `P" @ 7 6 2Vdp  Ҁ > K J `X&"p  ` `6d..  ^?&" T>g䀢 &  2"6j@E> !` $` >>gjb@ * :`@ +6jȀ  l2 @mے ( h5&&l&&``B@w<``Vjh$l@&@ g&e&l@ @d&]ڀ 6j"@Vj &6j̀ 8&6jĐ"@ $> a` "`> ! "@ >`B`;  # > !ؐ"@ @`؀" ܐ" > !@Ӓ"@ Ā@20  'Ѐ 2>X!P2`@Vhg:`א̀l g@mP?# * 8 &`t@  `t"@ &`tZܠ  `Zؒ "&` X`t &&Vd "$    0E/ 5 0@ > `  Wb>X!P> 2`@gf:`L )6d' 6d@ G>X!P2 :*"@ Lo*`WC   @ >X!P2 :*"@ LY*`6  2 @ @@ @# @ 䀢 2&@2 &@> aa "a&&耥@ && 'Ѐ ":"6Vd 42`L>c` (6-?ߔ " $&`L"  ? '`H` @7`U ?.怢@`!̐@"@ 4&䀢 2Vd XVd T@2C 2?̀2<p >g"p   6p> "L6p|> a &`L :` B`;`̘ F#`WWr``  Fdp`6pD? "A`Vd <  Wp `6p&Vd "    (` >X"`6d6d 6d@ )>X!P2 :*"@ LQ*`V% `!P2 :*"@ LD*``  `? `> ғ* :`X ֘ Ѐ`p q@W0m ND p`@L6p0b>g"H>g> ΐ#bL < 9  # 4 < 8 *' ٻ耢 #    @   '   @  #LӐ0x 8    > ғ* :`X g C`L    || |㿐\C7 "    8@ 4@22@ -`b )@2'@ "  p @6 p`@8. 2@ '`bڔ `b֔   >  p!6 pa@& & @&$ @   $  `    @~ @ڐtcp_pulloutofband㿘` > 8  &@># < `** " b ?& >  * (:   ( 2 2*`& (8"( 2 2((22+ 8"2f *`R(8882h2h  2h2㿐x)>g"`ʐ , (`@`T 2?؀ "` 4 2 <>g!x 2  <` ` )'  <?؀ ` <"`?ؐ * `44Ҁ 8 @*pb  ` 4а?2$l 6 4l@jd`$4l 㿘 x lj 8 ~V 2>dl ":dP @a @`* 2``6  ` 6 =`$@`6 p "*`z@iƒ`H6 2 :  : 6  V * :  :   6 h6 h 6 hd "x:?N`@ic>c` 8 U&t` "P?@ic>c` 8 UL` "hP@Dh ,` * & ́tcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlenh  Đ  x`?` `8> ! V h" *  l&   "@  Ȁ8>gV d"PN n ` t*  ؐ 6 ft  < l   ʐ  6 f 0 & @ l t  @* LP XT"@ 4  U`@ p @:N!N n 2J! 2` `2C!  Ā@,>!? #* 4 * " " 6-!* 6)! p2%!2"!  " 4!"! "!"A   2=  0 29 @=6 f4 !  + .& p `!&   //ѐ4 7ΐΒ`a   p   @"  p @#@'Ԫ  p ` `(`(  a`(> ! @B` " " "` `(( > 8 p"`(  !> "(> ( "^ pN n  2  > a`l "`l  Ā@ > ! X P <B`; X # P! H D <B`; H# D E  "!"F1 ` `@ `"(`"@"@ $`$` @  $@@&? 7A` $` t "87$` > a`h "`ha`x "`x  " > a`p "`pa`t "`t E  "Eݒ ` `@5 `"`$`  $`$` t`2` >  &@"`>  _{` t `  ? p    Ā@& 2  2  0 "  $  `$ В _U `2`<**` $ , P2 ? l& ? #* 4  "@ & 2 = 4   "@` @ 8 4  ,  & !  2N n`  @ $` *  2 ?c 8" 4 N n  0 2@  &   p `& 6 p  Đ"@ &  ؀  & > !> & & ܒa` "`  2   @>X!P 2`@V haR:`m 0 "  6 f Đ"@ 4&   V d` @$`!   `>g`2` x l*` x e*` xx`@ ` `  #> 퀧 7 ( x@  A  A x@  :  22 pV d $ p/6  > "L |(!`@ "`@ p  `  "` $  p  "@ 4&  p?  & 6 p 6 p' |23  tcp_output REXMT㿘 V * :   : > A x 䀢&V f>g"x*` `  x 4 x>X!P  2`@ `:`﹐V f  f`6 ftcpcbpl㿐> >ʚaX"l#\   !>g"t> `#42 > @"a㿘`t %`x >)  2aT  > ߐ & > "  (`@  & D   2a>%9 a 2%   @^-  4 , 0?$ * 2  2`  2* 2` *$ 2  2# `" 4  6* <*@44 $ 4 4 $ $ , 4 㿘   x 8 T P L X" " 4  @ =  T> " (  ]r& > (& &&``` &` &` `4 6` 4`  (`& && * <*@ $ $ $  ,  <?#4 4 @]4 4`  (4 @4 4`>g !w>g,`ax `  $ x x 㿘> ˤ"ll @ @]!$>g"b>4 lbx4 А |  >͐!,` `` >g"h   >g"d * :` * 4 p4 $ x4 4 䀢4 h4 h 4 h $!$ $ >g !w,l$<㿘 x 8V d  > 6 d> a`  "` a` "``<V  2@4 8㿘 x8x *  Ē@@ _@ [   V P @ V *"@ *`" *  l * ` 2 $ l$ l P  V *"@ *`" *  p * ` 2 $ p$ p P 2  d ̀`" d h 2 l d2 @ l* 2 2 @@d`(  ^ޒ`( h 2 $ h$ h@#@ p`?# @6 p | t "> <> ˒L"lN$<ղ> a` "` 㿘@  ` "` "< > Ӓ,!@  ?  *  * * * 㿘 ̀`P! M>g!ԓ.   >/#? >("Ԁ  >g!x >  `*`  #    >ۀ> #  > 8 0 >  `*`'  ##\h0#Փ  <l ȁ㿘 < `" `4 2 `Tպ  `T -? -$ 㿘 <    4 ՚?  !> ͆`(((0*`0㿘> ͐"i > "\ @> !8  ?`  @ > > "#3"\2H㿘1> "H!/@ > !8> c"H"H*``6"H2 /> b\? * .  7t:`;l<㿘> a 2>  @"a> c0 2> ɐ "c0> a !>  @"a"L >X!P@Y $"L㿘H /` * !  p`6 pH 0H(> 0> a> ("""aH 㿘  g? 㿈H /` * !  f`*`:  6 f > 6 fa`$ "`$V   < 0> a`( "`( V * :   :  * V f>g"x*` \Ӑ  * :`@ 6 h6 h`$>X 6 h>X!P 2`@V h\:`ِ>g!x "=V f x"9V fV d 5V f 3 8 t "-V fԿ " ! 4 "! P 2 V f!` @Zv  // ٳ' " V f P  $ PL ~V f $  " x  * : @6 6  & &   Ȁ 8  l2 @b ( \]& & ̐6 jH 0㿘H /` * ! > !`, $`, V * :   :  * V f > > ! Ԡ"@>g"\'  `0`$`0Ò <0W . ng. nH 0㿘H /` * ! > a 4 # 4V d`Ca x 8  +`*>X> " > !>  Ԑ "@ @-a 8`# 8 t   `?  4>X!P> 2`@0[Γ:`0 >X!P> Б2`@[“:`ݐ 4H 00 <`"<W "> ! Ԑ" >X!P> 2`@0 L[:`ꢐ0FH 0diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKtcp_usrreq㿐 `  oG  9e ; 0H /`4`* !`  ` H 0` ` 9A   А#   8@  ` " `T` 2` x4`` <m߰ 6  d ր  4 d < 8 'ο 2  'η   6  >  G  K $ tѢ 7` `P4` J[>X!P> >g "2`"D@  4 dZ:`鿐 4$ $ $ $  $ | -@\x` u K<@u n0`  h Аd `tKڒ[ 5V`x&@H 0_ `H 2`` @"D `!2@  쀊  :  6 #&  0*@  ,, `x`t"@``|"@@ 4 ~`t8X 7K`t  , n $ }, nc n >"(  `   ՚ H 0?TAH???CAHAXAAAC$ABBBCA@㿘 H /4`* !`  H 0 o 6 k7ᜀ `    / ,H 00S7 < I( *"%  (   "`p`p 6`p?# @6`p"  (  `$ `l@4 6`l7\ 0 7> ' " "   *`p "@`l"@H 0㿘`x >g`P  > >g">gJi > ͒cf `  "a2`d  ` ? :4`` 74`㿘 x 8V d 4   T  ̒  ILE L@  j㿘V d`>ѐ#*` 6 d  6 d V d  xH 8V d  >X!P> 2`@:`X L GlGlGlGGGtcp_ident: cannot happen㽈 2a 2^ @"X T" 2Q K H /`4 * !  >7 > 'c'ѝ蔒 > ` "m  8  ?'8 '?''H 0"&@T="㿘`P ?` J>Ґ#,*` >g<"h>g7"`>g2"D> А-!> (#0 '> ̐ `ܚ @>g">g"V>g"H>g"p *JJ<JPJdJxJJJJK J(JKdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘>g"> А#́P#> c8'L 'P'T'X$c8'H @2  _   /р`f   ` 8 2 c8` L"` ` 2 c8` :"``" c8 8$` ,"`7U `*c8 2 ?! ``("`(5"`0@Us ` 6 @ f* `7`c8`5"0& c8`( "`(`  "` р`2@US  //@7  @UI'//`7'< 8  #> ' 2 q#> c̐c̀@O `6`@2F``0`"` @2>`` `  @26``4@@21` '沔 5  " `870 LДI  57> c8`   "` H    `8  "  `c̀@2`6 > c8` t"`6 LДHՖ d Gِ iX  > 'c'@`Ζ (> #8 $`$ $@ `Ν    $   #   6$  T.7`   & 01  `` 7  @) 6`8А LH > `8G L`8   0 > c8`  "` 44㿘 4-    S `& $ $$  㿘 82 8 8GQ L 8    8GF t㿈>Ԁ`1"` -@ ) '>g!ԓ.  ? >"Ԁ `0 >  `*`'  ##\~0#̒ͩ  IPv6 inpcb to udp_outputx ` 'X'T'H'L'P a >#8?# @ (    0 8H /` * ! g " H 00 2  9``" 8`  $"   ?ܐ"   ?"    ?`& &  4   S 7     & J 7  @S  .` 6`  0>g&`  &` 66`b 4 6`6` /  & ` 2`* `2 `@2*@ 2@ 2 @*2`2?# 8"6`6`6` l> .` e8.`,`", 8 @` 0 *#\;$ 0$ `H 03i3dudp_usrreq㿘``  S ``2 `.`>֐!   H /` * ! > Ғc%H 0  >g">gF  >g` !w{*`lH /` * ! ^ H 0d  _ 8H /` * ! R H 0 H DtD  = 9H /` * ! ˖$ 0H 0` ?%4`ES" %D@9 ϒ  ڒ    - -> " 22WY<WY|XY|XY YYY4YYtYY|YLY`Y|Y|Y|Y|Y|㿘H o*@ aM H 0㿘`!  >    *0  *0>g " ˚ @ >g">g"diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿐>g"'H'L'P'T 'X  ,  H>  `2" 0H@ 㾐%>  $  32   10  40    $ 2    /3̒  `1"0 3c   4   ` "`2  2   @#   ">g 4 2% >g"Ȁ > ""  " "  ` 2` @"g 2  " :  B ; > ! (    '( '''IH /f * ' `` @``1X$``  "` H 00,& ` 2" $@`> ̠  ,$`@ $`"̒~ >X > 䀢` * L R& 0 $`1+"$0 Q H 0㿐  2a 2 `/a%  > a( a 2  > ,`1",& ``" 8`  $"   ?ܐ"   ?"    ?`& &  1'        & 2  > `` 7 "`]&<@* @ *@@ $@ >g4` aw4` ,`a($` a $`4`0&> /  21  `2+,` ` 4` /@ ڒ ,`0> &``( 7 "`(>    # &a 2 `  `?쒂B>`  ?쒂B;  㿘`    *>g"Ȱdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK8!> ڔ P>gb'L 'P'T'X"` 'H  , 2   `0" 0}  P`0$ P0s 1 `   P ` 2 " `/"0[ 25 ؒ P` O"`@O @O   2   /ސ P =$ P ////ܒ 1d  1_ 1  P :  B;   1N  06   >f @Uq   !"6 1  P`/"㿐a% ```> a ``2 > ڒ @> ڀ`"  P`/~"_    4֒  2  > ڔP`"/j 70K#V @4`  N` &  ?6 ``$ $` > $`$` $@`P`#```(? ; B;`(a  `<* @ *@@ $`>g4  aw a, , , 4 Ϡ4 4 a($ a $  //  ]& 㿘`    *>gԝ"а㿈a"@  o6. . ' "  "`"@"`"`  o6 ?#\  @7 `   1   ' 7  `.6bind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d h \H /'А Ԕ 6W  +  .8 '̖ "  "`"@!?=ƒ# ` ." '̒` "` "Ԓ#=  . '` "`  $ ,, 3  " "Ԓ =  뀥 3 '`"` ,, 4 $ 6g̰.Ò >  Ӏ 3h " "Ԓ =s  ŀ -ѐ   M%  -̐  <$$ @M <~)>g"؀ %"ؒ  & && & & & & & 8& 4  '̒` @`@'$$`d 沖 .s f'Ԓ  7 _'> !`CЀ "-'̀ 3@-'''ȒД̘ؖ 93Ȱ # N&@` ڀ` Հ`"؀@Ѐ` > j! ǀ`` >b!8`& <   /ג   ' 7>ڐ L`    ? /m̀`'''@-s-nЀ -h5ԁ㿘` ? (  ,   2   2 -   & L"㿘 /|  "    ?      ./.@&- 㿘 ,  "   " " " " "㿘  /A  2   @ " ` &@.@ ` .` `.` `.`.ؒ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnfs_read modenfsbioread nfsbioread: type %x unexpected 0X ! `   >!` 2`u 6p " @b`@#`   %` X#%` N`@ @  0@@4”<PƐ08PÐ05%`a "%a¿%a &@ "<< <` `>0> c\` "``@L7<` `  @ `a:` N >i"  J' F 3@`aM:` QA #@ "  0" 0 @$ 0@   0 $ 0P[PW @`Mΐ`: @ Ɩ` Q   0@  @@ @Ӗ "  0"   0 $ 0@ Y'`$@ 8 `` "@@&  /$. l h l $& l @ "o  0 d $ 0 0 >!c Z O l "@&, +> \0`"0 $@q "?  0"2  @ 0 $ 0@I  @$`" @ 8    !( `" H@<``> !( O ` 4@nfs_write modenfs_write proc8 X !` ` >|#x` 2 <> #"<>p#  ྀ  ?4@" @b`@!`"`ྀ  $ @  ` $B =`` 6`а ̀"`@ `B 2` )   0h$ 0O "$$ $` @,> c\`$ "`$`@J=  ` ? @`%8 ! Li:` @ /ྔ4`<@ C8@ 2 d @ C<   @  d @ `@ 6  H.$ , ΐR  H   d` @ `8@@ $ ` $ d$ d$ ` l  `& d h d@   d $ h8  @ $ h $ l 0` ?$ 0$ , "`0  0`$ 0$ ,@e `N` ^ 㿘 X! @!O@ 2 @ >X!P+ O/ "   O# nfsvinval㿘 X! @  >X!P!*   4 >ߔؐ  I   @U 28     4   @?  ? 4 ?4 Ԑ   k 䀧  ? 4 ?4 Ծ  㿘>i" (  >   ` 0@>  0@ & 0> ʒb& ` & `""`# ԙ " ` 0D @ H /d * % M~H 0Qy Process killed due to text file modification nfs_doio: type %x unexpected h \ 0  ''@ $$,$ T :* 2`@  <*`  H$ 0''Ѐ@ <> c\` $ "` @2px> c\`,'̐ "`,$@4j 0@"n T H <$''$ <``F>0U T> : * 2 c\`*  #`<@2> `& h <"  T`* "@   @8 H @Hj@& l <& l`( @ $`T` >#p ` &`> \4> #"4  < @@0Ӓ5#y 0& 4(& 0s> : \* 2( ` d H$#($* @ 'ԑ<` 0C <  @'Ѐ`$'̐ ' 0@ & 0@3}Ȥ ̀  0  0 ?& 0 0@*@& 0% 0 !H /d * % LbH 0 0 Ȁ" 0$& 0" & d 0(& 0%`& 4` 5`& d& ``& @@ XP>nfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s X>   "> _ "  4  2  > X  F>< x  /) ">ې 0aJ ">А - `7< >  ">!'!>!'@G   / ,  $  >!8/Ȑ@F ?> ǐ!"b'̒//ɐ@| ">!X!>'Ġ!>  ѐFm  nfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d 㻘@ > #@j > 0$ab ʖ > 00@LϴiO :.` K.  * . nfs_boot: bootparam_whoami: bad reply 㿈 &= '` "` #a b$$ |$  "@  o$ 4?#\b' Ԛ >`  (  %'   (b>  > 4 a $(" '> " > ʒa 'U '>!X H "&M &Gnfs_boot: bootparam_getfile: bad reply 㿀> "> Ґ!  '@L7ʐ "@5 a#\b  k ) Y'Ԕ ' 쒒 '#' Ɣ耢  '@Eƒ   &..>#% 㿈#ab   2@K '( ?#\b  ! `  H` #   ( $ '  E 0 H%diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnfs_hashlocknfsnodepl㿐>X!h>   > "`> >! ؖ  >ac> >#\!a!  穘    㿐> #> c> * @ +>   X2T 2 @K 2   _ 2Z& 2 +> a "  2> #( ^2 &  0>> ͒ 运!@Dג!$`$ !`L2` @JȔ 2 `< 2`@ $`<`@ $`@ $" $@$   $  $  DC4 a n & nfs_inactive: pushing active㿘 >c> !  cD > cv   <  `$`    @>s`5  ` 4`   nfs_reclaim: pushing active㿘 >c!  ``D >!c> `" `< 2"  "@`< 2T  " T   T @$! ޒ ! "!! NB> `Ő!$` diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapnfsconnfscon sotype㿘`$P P T+X P` R $\ 22 )5   " "@ 3?   )'   $ **2",# Ւ )  " "@ 3   "`\ E 90- H /`! * ! !P>`*`6 X ` `8 2 ```<@_ 2`` `8 >X`8  4`8H 00H 0 A>X!P*` 4`4`r4`r4`T` `! * =! `! *  0* "` >ِ#h  (   "?$ c2 ` R  2 (z   "$  2 !a* *` 63 #>X`p`> c@!P@4`@A4`p* $l$$$x$t$p$$$$|$  ?4`H 0@0㿘 @*?>   >!`  ̝ ޒ  > "P`" `2@`$ @"`$@`2` 㿘 P & P1 +unfs send error %d for server %s nfsd send error %d 㿘$ ""ʐ D P 2 ? @&$" : &$\ R    " V` @? ` ,S !> ` %$  @  &$>`  ? # 2 short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s `> #&"@  T"  P@ 5   $`@A 0) P``@& 沔 " > \`" ``V   ? " @ 0 $ @2 @ s}x ̖А  ''?'''''' @ز'Ȑ   -_ #   # $  # @ 耢    " >b  e  t *@  ! ' > >b@` O _ ' @'Ȑ  -! #" @ " @?" @ I耢E>  b̘ " + ; !''' !Ā Ȓ 'Ȑؖ,Ā`! #   # $ = #耦 "Ȁ  >1"  " " '̀ E C?B !^  & > bܐ  @ 1 " 0(`2`, *    А"@''''Ȑؖ ,Ȱ # $ 瀦 #"'" '̀ "!&@u nfsreply nil㿀@$  @N @F  ? #`\ `P2 8 "   '쀣`' '  @ e䀢  $>  8@ > \(` "($> "P  2 2>g$ $ ch耢 `$ > *` * "  4* "   4>g* @```d *``l `|  :    : *``l `|  :    ` ``l  4`|* > ?* @8  4* ?*  `8`d `h` $ ( $ " 8"@ `  ?"@ ``4 $:@@@> `@@ $`$` $ ?$ $`?$` $  >g 4* b *`l  8: #@  `"  4*  *| : #@  " $` 2U  > \$` "$ $2 $   >`#$  is alive againnqnfstryH'D X !'H'X @ H$<D    $$$4    $('ܐ 'Ԣ@?   Ԑܖ@ "#\#`ܘ@c  H0W     *  '#lԖH#\#p#dؖ#`#h@܀`   T 2<``"8`$"  ?ܐ" 4 ?"   ?`$$   "   $ ? "@$$   e h$(>g". $, $8 $$$$> c\a$  "aH /` * ! +> ˒bP`$$""`7>  P8 ? T  (  @2H 0  \ @  P `  d \`@  $ @  !% $  $$H 0 ?$8  H /` * ! `""`bP" "@H 0 $  ?$$ ?% 2 $ > <`@”` ' '   "    'ĖȒĔ @  2> "  "> "|@2 -$> #L@2 2  PАX"@U  P$ #\@Ԛİ  Ȑ ?` `Đ " 6 @  @ Ā 00'  Đ "   'ĖȒĔ @   i  Đ "  'ĖȒĔ @  0T >"# # F8  >!p  k 8&> >g#H- ? F2GD" X"@\"` "  X"@\"`" 0  + build > MLEN㿈\ " > b  #(  > "`  $  $  > `X &`8 &I > > " &   > #L.& & ?$ > "| & & &# &`L @` `@Ek *  LU> `@2`<     @ ꀦ?> l?'p '& &&      8 `   0 $   "      ?$ 4   "" $ $   $ ` & && &J KHBC L9= o& &     8 `   0 $   "     ?$ 4   !ْ $ $   $   & &=` :& 7&5&     8 `   0 $   "     ?$ 4   ! $ $   $ `@ &&$`"d "> c\a "a not responding㿘H /`4> ː* !> "P     $ 2 <@ 2Y $ 8 : $ 8(2"d 4>g"*` ``d *`l |  :    : *`l |  :   ` >g* cH@=  8 `4 $`$ $  ,@$  (> <`@ $ $ $ , (@ > #\! `"!  $ u$ $T ` dn$ , dk$ ,P`g?$ 8`x`t"@``|"@@ 4  @&Y(   $  @6L 沔 &  "C  `    @     `@  +?) #"(\ "#4`8" $`` ,  $ $ d$ , d$ ,:  $!$> c\` "`$ $!$$ 8 2# H 0> #[`"`$" @" 耢` *@!(  nfsndlck㿘 `  ``<*  !%  ϔ  &>0 Į !2>X!P * @@2`@ & nfs sndunlock㿘@@*@>b @&*@&:nfsrcvlk㿘  *`@   < "  $>h`c a>X!P * @2  $ nfs rcvunlock㿘@*@>!0@&*@&㿘  2   "   !Ӓ   ?  6  0 $" ?@&  &  &       8 ` $ 0 "&L @4HG +  !   ? 4  $ $    $   82 `"  $ 0  " ?$ 9` $%` $@Ā`      $  2$ 0 2q Bad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad P`0`@`,''   " ' ( ' (@i > Ҵ$`Xc 0   "    ' @L >  $`T$`L  I> #  J  K`2 $`L $`D  L`L`` ` L2 `D>h`* @$`D!`L> b8 ? $`L   ?` ` "  @  @F 03'   "    ' @ژ `@9  P $`$`$` f * ` ` "    ' @  4*`" 4 *: `4`@ R`!2 '  ?` ` " @ ' @ג 0'> ☀  x ?  ``&`&` 'Ӑ H   Ж`!?''''Ԁ 'ܔ@    "   ' @9 }☀  ">Y#    "  ` ' @ Z  >;  a7Ԕ  &a`L @$`L` &` >& (    "   ' @ %☀  "> @^    "   ' @ )0P' @@A'` *   L``5> `2``< ``    @` 뀦` > !8`h  `l@ ``pĀ@ `&`h` $`D$`T @ R``L  $`L  $`D$`T  $`0$`@nfs server %s: %s 㿘 " =>`ȔUE diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘  7  & &build > MLEN㿐 'H' ?` p (` $` ` `"@$`` $`$`        8 `  $ 0 "   ` & 4 `  q $@`$` ` '>gp $` `  )>g#t g $p %#tg `&@p $p>g#p> &@$c $>   $a" $H "  $` $>h h. $ $ $S``   `8 ` ``0`$ `  "  ` `  ?$@ `    >?!$@`$` ` $` $ $ $ $? ? $ @l .`@`$@ c`P`   `8 ` ``0`$ `  `  ?@2`  / $@`$` `   `8` ``0`$ `  "`  ?$@8 5ɒ` &$` @ "$ `$` ,` $` `   `8 ` ``0`$ `  "  ` `  ?$@ 4 `  S $@`$` `  $` `g \ $\O$ `   `8 ` ``0`$ `  `  ?@2` #  $@`$` `   `8` ``0`$ `  "`  ?$@8 57` &$` @\` ?" $h,` $` $ $hd ($@& l& "㿘   "@ "P ` $] @`2`W @@`*0 "L H  "@` 4ߔ`3!`` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @0&nfsm_uiotombuf: iovcnt != 1㿘  >ថ#@`? ?"x d     8`   0 $   "  ?$&  )  $ %      8 `   0 $   "  ?$       48   2r  $  <`  B#$> & &@"@`""`$9     8`   0 $   "     ?$     $ %  @*@` $ &  &&@ nfs S too big㿘 @`&` `&@&@@'@> ; H( >༐"Ht @$` $@"$`  '@3&  " H   3 ' @"$ $  40$` & &@   "   H &" "@㿘 `     `8 ` ``0`$ `  "`  ?$@ E?@"@` ` $` < 3=` &3$`  t   0  $ $@`  "@ `?$      ?"@ 3 &$ ͐ &  &@ 㿘>X!P> ?a > Ά > ߘ > !> " 3> %> '> )> +> -> /> 1> #> $## #c&`$$8%" %c %|%L&"8$b d@1 !> ̀ $#$#> ˒"P""P"`!> 7">Pb㿘 *>  " > ʒ""""` 㿈@ D X a @b"  T ͘쀢 `@>g`' ``+`D*``*'`H  %'@>g c* @ `< >c!2`  ``4'`8*`" *  * '' 2<" <% $<ɰ -? > #X$8L > &|$&$8Nl$P0$`&$`$`(`( /6 & D`& ,& 0X d-& ` "6 `  & ` & ``    > & ``    @ > H`8& `<& $`@& (`L& 4`P> P& 8.& @` 6 ` & `& ` > `& ` : 2* @* > H`(& `,& $`0*`" *  * & (& (& @`< & 4& 8`@ > P& < ` 2 `@!>  2 `  8 `2  ` @( `>  <`` @ > <`> !8$`1 ``$!"`&$`&(`" `&,`&0 㿘 > `  X!8`"8`@0o" < 2` 2      > c\`  E"`c\`( "c\ ` 2`( `@!`( 2 `  8 `2  ` @( `<  <`` @퉔 <`14 ``$!"`&`$`&`(`" `&`,`&`0 㿈\$`  $$ @   @@"@ $  "| H  "J  /2 n `@$  ,@@`'@ ?",@& &a 2Q  $@$ #\$ h0 #`@ 2> `< L 4 L! `$$ # !$ d$ F 2   @@`  L=LL6  $@d$        +" ' (0! , " "   ( #2" 㿘\`@1@     8 `   0 $   "     ?$ 4    $ $  > b  $ #@`     8 `   0 $   "     ?$ 4    $ $  > cĐ $  #  #`# , #0# 4 #8# $@'@@㿘`1     8 `   0 $   "     ?$ 4   h $ $  > b $ "4`     8 `   0 $   "W     ?$ W4   9 $ $  > cĐ X$ "@`X&'㿘V`&`& ` & L 0>g@#*` ?&` /&` &`&`H&`L& `F&$`D 0 &(&,`&4&0`&8`$&<`(&@`,&D`0&H`4&L`8C&P@>gcx* @&@`2>c>c!h!X*` `@&`&` &@ ?`D&`H*2 @ & `&$`&(`$&,`(?"&0@-#&0`,&4`0?"&8@-ޒ#&8`4&<`8?"&@@-Ւ#&@㿐> #\&`H 2 ` F`0 2W `   N` ` 2`c R 2` h`*0"JN10  d  & &R 66  * "  R 6   $$` j1      @  H( ``X2 `p `d00 0`2`XH  L`R D>h(R   P?# @ >hІ  + ? *@ " @**   㿘@.[ P &@  &` &` 6`   `" V *V` Ȑ`㿘`>  X !8`@," < 2!!!!`     diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcld kerbnqnfstimr㿘@;  @27@>ڌ#8!   8 ̀@8+ Ā 2 + 2 &  & &  @& &C 6\ Q .&@2 &+  & @2 @>X!P@," >H Ē!c  ?2 V @"  ` "`  "@`"`& "@  32  #" nfsd init0`a2 U!> #x "@#x> `$#x>!Д   #x #x@ 7 N!4`+ 3 D'''''A (@ " X H[a쀦 @ @@ @ @$`@`@ ? nfsidl㿘> Ъ?     Г* 2 />  Щ-`"->i  `%`&  , !> @!> " ` "@>! @  "Ȥ`P> M> ʀ`"``"`> ""``"@`0@"`\̒ 8> ʓH o *@ e  p  0  @`2 . 0 $ 0   0?! @$ 01 \`t "`tH 0㘒 2`\> "Ȁ`2`!>  ?& -`"%㿘> _#Y nfsio㿘  #> ʐbГ,  2  $#> ʀ )>hP  8 " "P>>!Ė  ? >  bБ, @  Β      b0>hcP 6"cPnfsauth1nfsauth2㿘\@ >X!P>@&*  Ș `<ؒ A@>X*@&  ,!&!& & & @ & _& @!P>*   `<  >X`  *@& P "  f *@&' ̐ `$@+A *@ @&*@& nfs_getnickauth verf too small㿈`4`>, ؒ C@3*  耧`"3> `2``3> `ha8@6@? ``"`& `@"@'@ '` "&     "`t & &" '`la8a8   a8 2 `p `p@ a8'`l '`p '`p`l '`p'' '' x @'\ ~'   "  ` ' ܀ ܤ N}@#> `'@'`a8@, a,n>h#H ܀@6  `& ܐ | 3< `"  "`  "@`"`& "@&`&a8x&h &l&t*l&p& & "& `@3$ C*  耢  &`@3 C*  "` `@3 C* " `@3  C*  &     " &  '   Ґ''@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapbuild > MLENp L "'=    5 @> @> c\`  "`  D ޖ |'`S`   ?    8 `   0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  K  >֋!x"'" '? " '`R "@ "` R )g C`찒 < 0   "  82 `   0 $   "    ?$   "@'"  '   "  '`)% #\#` Ԛ谒 "  . #'   "   ' 1ܖ :   Fؖ .؀ 耢  =䀥    " 3 䀢  4''   4ܖ  d 0b&@ࠀ 8 8&`"&`      @ + 3`  &`       @ + 3`  &`      @ aC + 3`  &`c &`$  &`&`&` &`&`&`&`D@ `T(p Z`(l ZLa(h X `D`@(`  Dcp> c\` "`  DS`S`   ?'`  `  8    0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#    >!x"`'"` '?` "` `'R`" "` R '  `r t0#\#` 肚찒 t .'   "   '  $   ܖ 쀦 M   " /0 ' 0 * 08ࠀ@a >$ ࠀ $$@a >$ $$ऀ@c <$ऀ: $$ $rootnfs_mountroot: root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap > #> a8 ;А <"a8А@'k!(>``ખ? ">> h `@%> @?> H> ͒$`$  2`""" ?`p`ږ >Ր @H /e4> 2* &> 2"> A)cĀ %> 5>Ӿ ?>  ; l>`S  2+>> a@E@l??l "`<l?" @l$% `@` >! *2 @>!0ْ|% Ր!@$% %  nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %d8>#?  >V#<@"<@& X    j'''''' r  @   &/$ @ۖ > ,nfs_args: retrying connect nfscon㿘H /` * ! ?` ` ` +@ @  @ &H 0` 0 `, *#> !>Xc@$!P(i`, @$ѐ !Pc& d@$ː d@@$Ē& d@$* "@ d*` @$* "@*`& d` " ``0  d& h d& h`b`  `" `  > & "&   @  4&  @ 4& ` " `$  > & "&   @  4&  @ 4& `@ ``(  <# & $`"  &  4& ` " ``4  $& `@" ``8  $& `@" ``@  $& `@" ``H`?#@$`J6!`@" !`L`?#@$`N6!!! 86!`@ `P`?#@$`R6!`@" !`T`?#@$`V6!!! 86! P " ⬐ T 2  Q! > >!@   _ > &  &$ &( d&, h&0 &4 &8 &@!&H!&L!&P!&T8#  2p   H" ? a K X" * W'>hcP 6 < "cP  <@@!쀢` D @ b '!Lx9 @4 "’ 2.@ Y"g 2$ Z$@$֐"Y Y 2$@$ɐ@!l  2 '@㿘`<@@ _  !@$!&a$``$`=v>X> c$`@#!!P    $`h$`$`$`$`$`$`$`d`$`$`$`    < $`L4a4a4a4a$` ` ``@$ `$ Z`$  ZaL$ X$``  `$`X$`Tp &`L  ᡐ nfsdism㿘!6`  `$> >!    > @Ӓ *@$d @$nZ `$ ɒ  㿐!`L`   &@㿘 ` $ X2`] 2 d p ` > ^; 2? d 2 X -㿘`(7   $ -002!L&* !K!L&$ 3> c\!!L  aL  c\!!LX >h#Pm L     - -diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿀  #\#` 㲚  .build > MLENp Xa " `<   <    ) #> c\`P "`P  HȖ S``  ?'`  ` `8  ``0`$ `  " $ TS``  ?$@$ KS`4IS`     8  `    $ 0@  "@    ?#  7  >w!"'" '? " ' R "@ "  R "S  ` 0   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "`   '  <@  2 @2  "2 @2 " #\#` ⯚찒 I .'   "  '  "x 0.    ܖ 쀦    "   '   2 N0@>open eacces vtyp=%d 8 `<  ``>#c    ! "  $!@ "@  " ! "  $!@ "@    @  "9 @ݓ$ `< 2   <   [d '"  [[ " Ā@"$ `< 2   <       @b$ $  㿘  `< #`  `X!"     @<   4     $   ? 4  x `X`! ` "2 g >  c\`D "`D  D {'`S`   ?`  `  8    0 $   " $ SS`  ?$$ JS`4HS`     8  `    $ 0@  "@    ?#  U  >͕!"'" '? " '`R "@` "`R  r C ` "< 0X   "  82 `   0 $   "    ?$   "@'"  '   "  '` 0   #\#` ߚ찒  .   'i  0㿘` `  @? - 2X ?2X $?2 X ,?2 X ?#@" X < y  2< ?"F ,<?`#>#*` e  ,?? $?? ?#@ ?2 ? ??N ?5< X < F  ` ` ` z  6   <@@<`?2< $?"`<  ``  ^  2` `` @  ?2< ?<@۽<@"L"T"T""T"TpX> !\H @ "Hb  D  < T|'S``  ?`  ` `8  ``0`$ `  " $ TS``  ?$@$ KS`4IS`     8  `    $ 0@  "@    ?#    >!"'" '?` "` 'R`#@` " R  C`q <s0m`  " `82 ` ``0`$ `  "  `  ?$@  s "@'"  '   "  '[?`#@:   "  8 2 `    $ 0@  "@` >   ?#  5 "@'"  '> `  "` Đ '#@`7#`   "  8 2 `    $ 0@  "@` >   ?#   "@'"  '> `  "`  '#@`?:   "  8 2 `    $ 0@  "@` >   ?#  Đ "@'"  '> `  "` Đ '#@`7#`   "  8 2 `    $ 0@  "@` >   ?#   "@'"  '> `  "`  '#@` ?:   "  8 2 `    $ 0@  "@` >   ?#  S "@'"  '> `  "` Đ '#@` 7#`   "  8 2 `    $ 0@  "@` >   ?#   "@'"  '> `  "`  '#@`?`?">    "  8 2 `    $ 0@  "@`  >   ?#  ސ "@'"  '>   " #Ĕ '#@`` #@`6#`  "  8 2 `    $ 0@  "@` >   ?#   "@'"  '> `  "`  '#@`$u> !8@<   "  8 2 `    $ 0@  "@`     ?#  f "@'"  ' `  "`  '#@`$`#@`(k#`   "  8 2 `    $ 0@  "@`    ?#  , "@'"  ' `  "`  '6#@   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "`  '#@`,u> !8@<   "  8 2 `    $ 0@  "@`     ?#   "@'"  ' `  "`  '#@`,`#@`0k#`   "  8 2 `    $ 0@  "@`    ?#   "@'"  ' `  "`  '6#@   "  8 2 `    $ 0@  "@` `   ?#  K "@'"  '`  "`  '#@   "  8 2 `    $ 0@  "@` >   ?#   "@'"  '> `  "`  'k#@   "  8 2 `    $ 0@  "@` ?  ?#   "@'"  '? c " ` '>  ! <`2>c>c!h!X*`  $`?2$ > ! $ ` ?2$ > ! $ `$ `$$ `(?"$ @͒#$ `,$ `0?"$ @Ē#$ #\#` ۅ찒 "c .Q   "  ` '  G> @#Ā@   "  ' ʘ .'   "  ` ' 浘 @   ܒʔ䖒    'ؒ翐ؖ   0    `X!   " &@`X < "`<? ' `< # `'x# ;  9> @@`T5 50  2(&@`T!  T- ` ̀ > #\ `"     (%  $60&@> #\   L`" " L  $ H z'`S`   ?    8 `   0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  b  >Ƣ!"'" '? " '`R # @ "` R ~ A` :0   "  82 `   0 $   "    ?$   "@'"  '   "  '`> ڐ ?     8  `   0 $   " $ R   ?#$ I 4G      8  `    $ 0@  "@    ?#    >!"'"  '? " '# @ " ϒ   c " e}  #\#` r .n . ''|   "    ' Θ .   | "|,D     "    ' 䨘   @   H#    ?` ` " @   ' 䅘  vxs qR`2 `X`@ 2`Xڰ 0wx qxF 't   "    ' M    tb t'p   "    ' +   p@  0} 'll6 ul&@}  (% R`2 `X`@3 2`X32 x xa0 F'h   "    ' ۘ ;   h /h'd   "    ' 㹘   dΔ  d '``Ô   % `  "  (%  @"&@ x 2 &@x\"!O&@ !`"3k```   ``X < ? `  (% 㿘 `< 2     㿘 `< 2     pX> !\T@ "Tb  D  |'S`   ?`  `  8    0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  g  >ç!"'" '?` "` 'R`" " R  C`` "<`0   "  82 `   0 $   "    ?$   "@'"  '   "  'A`#\#` 찒 " R . "'   "   ' M 5   bܖ )쀦 )   "   ' +  H0 ڐ薒  0pX  ``=  B "`  i0e H0a 0 > c\`X "`X` , P ޯ`|'S`   ?    8 `   0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#    >\!"'" '? " 'R "@ " R 8 C`̐ <ΐ0   "  82 `   0 $   "    ?$  ΐ "@'"  '   "  '    "  8 2 `    $ 0@  "@`  `  ?#   "@'"  '``  "`   '`"` ""` """!`#\#` c찒 "` .`;'   "   '     Րܖ ܀    "   '    'ؒ᳐ؖ    "   ' ~   / {٨%` 2      m> p X!  '@` ` ='LB5 38  /  +Lc\`\ "`\ࠀ` ? 4 X }' S``  ?   `8 ` ``0`$ `  " $ TS``  ?$@$ KS`4IS`     8  `    $ 0@  "@    ?#  a  >!"'" '? " ' R $ @" R } D` =L`  " `82 ` ``0`$ `  "  `  ?$@   "@'"  '   "  ' : A   "  8 2 `    $ 0@  "@`    ?#  ِ "@'"  ' " `' $` $  $L @$ ;$   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "` `  '$ $ $ $   !`#\#` f찒 " .    "     ' ˜ > #Ā@   "    ' ީ o     `?'   "    ' ދ Q  ܖ ߡ䖒 F܀ a   "    ' e +% 6@%@ " "@;` "`` b >`&`   2 " #2 А %@]   '@   'ؒ<ؖ ؀ `T"`%> L "&`hX ! ` "D  > M--`ʰ -! > c\`l "`l  ? 0 T` `< ڪz'S``  ?   `8 ` ``0`$ `  " $ TS``  ?$@$ KS`4IS`     8  `    $ 0@  "@    ?#    >W!"'" '? " 'R # @ " R 3 A`ǐ ":0`  " `82 ` ``0`$ `  "  `  ?$@  ː "@'"  '   "  ' ۰ ?  ?`  `  8  `   0 $   " $ S  ?#$ J4H     8  `    $ 0@  "@    ?#  d  >!"'"  '?` "` '#  "   f    "  8 2 `    $ 0@  "@` >g  ?#   "@'"  '>g`  "` ?* `'# :   "  8 2 `    $ 0@  "@` >   ?#  א "@'"  '> `  "` Đ '#7#    "  8 2 `    $ 0@  "@` >   ?#   "@'"  '> `  "`  '#   "  8 2 `    $ 0@  "@` !>   ?#  i "@'"  '!> `  "` " '#   "  8 2 `    $ 0@  "@` `   ?#  3 "@'"  '`  "` " '#   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "` " '#$u> !8@<   "  8 2 `    $ 0@  "@`     ?#   "@'"  ' `  "`  '#$ #(k#    "  8 2 `    $ 0@  "@`    ?#   "@'"  ' `  "`  '6#   "  8 2 `    $ 0@  "@` `   ?#  R "@'"  '`  "`  '#,u> !8@<   "  8 2 `    $ 0@  "@`     ?#   "@'"  ' `  "`  '#, #0k#    "  8 2 `    $ 0@  "@`    ?#  ݐ "@'"  ' `  "`  '6#   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "`  '#?    "  8 2 `    $ 0@  "@` ?  ?#  o "@'"  '?`  "` F '#D 2  X#    "  8 2 `    $ 0@  "@`    ?#  3 "@'"  ' ` "  `'>c!h>c!X*` @> ! $$ $ $ $$ (?"$ @ 2#$ ,$ 0?"$ @ )#$  #\#` 찒  .    "    ' E  `C!   "    ' )   @ 팰 Hڀ    ?` ` " @  '  X  /   "    '  `"    " S T$ T 0~'䀤` ؖ 'ؒ䖒 s؀` "(  @#  d   "     ' ؖ G> #Ā@    "    ' | -    `?'   "    ' ]   Вr䖒 켰  Ѐ쀦  "(5 @&@{ ` 2`" (㿐   (h` `X ! ` "'Ԁ  ` `X 2(> c\`` "``   ? ( L` `< Թz'`S`  ?   8 ` 0$   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  &  >f!"'" '? " '`R "@ "` R  B A `֐ ": 0  " 82 ` 0$   "    ?$  ڐ "@'"  '   "  '`   띐ݰ ?  ?    8  `   0 $   " $ S   ?#$ J 4H      8  `    $ 0@  "@    ?#  s  >!"'"  '? " ' "@ "     % 'h    "  8 2 `    $ 0@  "@`   ?#  $ "@'"  '`  "`  G' "   "  8 2 `    $ 0@  "@` >   ?#   "@'"  '> `  "`  `'`H> 7""> 7b "b""?#@:   "  8 2 `    $ 0@  "@` >   ?#  蘿 "@'"  '> `  "` Đ '"7"   "  8 2 `    $ 0@  "@` >   ?#  l "@'"  '> `  "`  '"   "  8 2 `    $ 0@  "@` !>   ?#  6 "@'"  '!> `  "` " '"   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "` " '"   "  8 2 `    $ 0@  "@` `   ?#  ː "@'"  '`  "` " '"$u> !8@<   "  8 2 `    $ 0@  "@`     ?#   "@'"  ' `  "`  '"$"(k"   "  8 2 `    $ 0@  "@`    ?#  U "@'"  ' `  "`  '6"   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "`  '",u> !8@<   "  8 2 `    $ 0@  "@`     ?#   "@'"  ' `  "`  '","0"   "  8 2 `    $ 0@  "@`    ?#   "@'"  ' `  "`  '"   "  8 2 `    $ 0@  "@` `   ?#  t "@'"  '`  "`  'X"   "  8 2 `    $ 0@  "@` `   ?#  @ "@'"  '`  "`  '`>c>c!h!X*` @> ! $$ $ $ $$ (?"$ @?#$ ,$ 0?"$ @6#$   #\#` 찒  .    "   ' R  C!   "   ' 6   @ 癰 Hڀ    ?` ` " @  '  `X  /   "   '  "    " S T1 T 0~'䀤 ؖ 'ؒ䖒 s؀" "    @   d   "    ' ң G> #Ā@    "   ' ҉ - `  `?'   "   ' j   В䖒 ɰ  Ѐ쀦   #K "7    析 2   @`" u  `` 2``" "8   `<  `5 `D ฀ $  ?ْ 2W $O       @$ "    ฀ 2 @ t !$!ʐ㿘   @ p`X> \!p `"p" $H ΄`z'`S`   ?    8 `   0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#    >1!"'" '? " '`R # @ "` R   A`ѡ :0   "  82 `   0 $   "    ?$  ꥐ "@'"  '   "  '` i ?      8  `   0 $   " S  ?#JG     8  `    $ 0@  "@    ?#  @  >!"'"  '? @" @'#  "^   {`#\#` 찒 "`6l` .`d   "     ' ] G> #Ā@    "    ' C -  `   `?'   "    ' $   ܒ9䖒 䃰  `܀ z` ` 2``" 㿐   XX @     "!` X@ 4 "` D (`  2` <  @ 2`ΐ `` ```#\`@6#` <`   <  #  " 㿐`` #`` `#\@pX> !c\`x`  "`x  H N z'S`   ?    8 `   0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  軒  >!"'" '? " 'R # @ " R  B`k ;0   "  82 `   0 $   "    ?$  o "@'"  ' `  "`   ' '      8  `   0 $   " S  ?#JG     8  `    $ 0@  "@    ?#     >M!"'"  '? @" @'#  "+  ο + zS`   ?    8  `   0 $   " $ US`  ?#$ LS`4JS`     8  `    $ 0@  "@    ?#  痒  >א!"'"  '? " 'R # @ " R  B``F ;`0   "  8 2 `    $ 0@  "@`    ?#  J "@'"  ' `  "`   'q ` M ?      8  `   0 $   " S  ?#JG     8  `    $ 0@  "@    ?#    >$!"'"  '? @" @'#  "  ͖ ᘐ`\#\#` 찒 " 6 .    "     '  '> Ā@    "    '  `    `?'   "    ' Ș l   ܒݔ䖒 `܀`   "     ' ̢ FĀ@    "    ' ̉ -    `?'   "    ' j   ؒ䖒 ɰ  ؀`` 2`` 2`" " p  `X a  "X   o @!     :> c\`| "`|   ? D  z'`S`   ?    8 `   0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  M  >!"'" '? " '`R "@ "` R i B` ;0d   "  82 `   0 $   "    ?$   "@'"  ' `  "`   '`( zS`   ?    8  `   0 $   " $ US`  ?#$ LS`4JS`     8  `    $ 0@  "@    ?#  䜒  >ܐ!"'"  '? " 'R "@ " R  B `K "; 0   "  8 2 `    $ 0@  "@`    ?#  O "@'"  ' `  "`   'v   ?  ?    8  `   0 $   " $ S   ?#$ J 4H      8  `    $ 0@  "@    ?#    >'!"'"  '? " ' "@ "     ʙ " ޛ  #\#` 찒 "6  .'   "   '  n` ܖ  b i    "    ' ݘ G> #Ā@    "   ' Ø -   `?'   "   ' ɤ   ؒʹ䖒    ؀ lm `` 2``" "  " h> X\! h @  b"h@`   ?L(@   <   z'S`  ?   8 ` 0$   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  ⍒  >͐!"'" '? " 'R # @ " R  A``= ":`0  " 82 ` 0$   "    ?$  A "@'"  '   "  'i `  ?    8  `   0 $   " $ S`  ?#$ J`4H`     8  `    $ 0@  "@    ?#  ޒ  >!"'"  '? " '`# @ "` ` Ȑ 䀥 j?`#@:   "  8 2 `    $ 0@  "@` >   ?#  ᎐ "@'"  '> `  "` Đ '#`7#    "  8 2 `    $ 0@  "@` >   ?#  V "@'"  '> `  "`  '#   "  8 2 `    $ 0@  "@` !>   ?#    "@'"  '!> `  "` " '#   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "` " '#   "  8 2 `    $ 0@  "@` `   ?#  ൐ "@'"  '`  "` " '#`$u> !8@<   "  8 2 `    $ 0@  "@`     ?#  y "@'"  ' `  "`  '#`$ #`(k#    "  8 2 `    $ 0@  "@`    ?#  ? "@'"  ' `  "`  '6#   "  8 2 `    $ 0@  "@` `   ?#    "@'"  '`  "`  '#`,u> !8@<   "  8 2 `    $ 0@  "@`     ?#  ΐ "@'"  ' `  "`  '#`, #`0k#    "  8 2 `    $ 0@  "@`    ?#  ߔ "@'"  ' `  "`  '6#   "  8 2 `    $ 0@  "@` `   ?#  ^ "@'"  '`  "`  '#%ٰ ?     8  `   0 $   " $ R  ?#$ I4G     8  `    $ 0@  "@    ?#    ><!"'"  '? " '# @ "  Ů  ٰe2R`   "  8 2 `    $ 0@  "@` >c  ?#  ެ "@'"  '>c` >  "`  'l`  && & & `$& `(?"& @#& `,& `0?"& @#& `` #\#` k찒 "  .     "    ' Ƙ C !   "    ' Ĭ   @  HĀ   ?` ` " @  ' Ċ X  /   "    ' j "    " S Tħ T 0h'䀤  'ؐؒf䖒 ]   "     ' / G> #Ā@    "    '  -`    `?'   "    '    Ԓ 䖒 U  Ԁ`L쀦"`А`f `` 2`" Ð " h> X\  !   `d'@  "db$H`  < x`z'S`  ?   8 ` 0$   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#    >%!"'" '? " 'R # @ " R  A``Õ :`0  " 82 ` 0$   "    ?$  ܙ "@'"  '   "  ' `]F ?      8  `   0 $   " $ R   ?#$ I 4G      8  `    $ 0@  "@    ?#  4  >t!"'"  '? " '# @ " R  ` `k?`#@:   "  8 2 `    $ 0@  "@` >   ?#   "@'"  '> `  "` Đ '#`7#    "  8 2 `    $ 0@  "@` >   ?#  ۨ "@'"  '> `  "`  '#   "  8 2 `    $ 0@  "@` !>   ?#  r "@'"  '!> `  "` " '#   "  8 2 `    $ 0@  "@` `   ?#  < "@'"  '`  "` " '#   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "` " '#`$u> !8@<   "  8 2 `    $ 0@  "@`     ?#  ː "@'"  ' `  "`  '#`$ #`(k#    "  8 2 `    $ 0@  "@`    ?#  ڑ "@'"  ' `  "`  '6#   "  8 2 `    $ 0@  "@` `   ?#  [ "@'"  '`  "`  '#`,u> !8@<   "  8 2 `    $ 0@  "@`     ?#    "@'"  ' `  "`  '#`, #`0#    "  8 2 `    $ 0@  "@`    ?#   "@'"  ' `  "`  '#   "  8 2 `    $ 0@  "@` `   ?#  ٰ "@'"  '`  "`  'Q#   "  8 2 `    $ 0@  "@` >c  ?#  { "@'"  '>c` >  "`  '``  $$ $ $ `$$ `(?"$ @#$ `,$ `0?"$ @y#$   #\#` :찒 6 . `   "    '   C`!   "    ' y   @ ܰ H   ?` ` " @  ' W Xa  `/   "    ' 7 "    " S Tt T 0j'䀦  'ؐؒ3䖒 _؀`d   "     '  G> #Ā@    "    '  -     `?'   "    '    Ԓ֔䖒    Ԁ  ` 2`"   "     @ а  < 2  "  t " aZ kp  `X! @  "\Z aD Ѱ > c\`t` "`t   ? $ H `z'`S`   ?    8 `   0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  ׌  >̐!"'" '? " '`R "@ "` R  A `< ": 0   "  82 `   0 $   "    ?$  @ "@'"  '   "  '`h   ?  ?    8  `   0 $   " $ S   ?#$ J 4H      8  `    $ 0@  "@    ?#  ْ  >!"'"  '? " ' "@ "      " э{  #\#` 찒 "`6l  .`d   "    '  G> #Ā@    "   ' ܘ - `  `?'   "   '    ܒҔ䖒    ܀ _ `` 2``"    "   'h 'dX!< 'l   @ " 2 2*? 2 Ā@2 > c\`  "`!(Ȱ  " °   @; .`]  'h"@ h"" @b$Ǩ$ ]  > #$ p'x''''t'p?'|'@@x@l c@ @*@%@@  x@~l #@" `q) .        @ h" 'h``  ``p` ?2* 2  Ԑ  'd` d  l > ɐ^   `"  ^  " "@""@`"<`2 l > 2  > c\`  "`  ""EEK! readdirrpc resid > 0 hX `    ` 'L'' > c\`  "`  D    5 |'S`   ?    8 `   0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  Ԣ  >!"'" '? " 'R # @ " R  D `R谒 = T0G   "  82 `   0 $   "    ?$  T "@'"  ' `  "`   '{ K   "  8 2 `    $ 0@  "@` `   ?#   "@'"  '`  "`  '# #    2# <##ଘ 6#   "  8 2 `    $ 0@  "@` `   ?#  ѐ "@'"  '`  "`  '#  #`L#\#` 䰒 " ~ . ?'  ܐ "    'ܐ ؖ \   Ԗ QԀ   ܐ "    'ܐܔ ؖ ;% %I0<  ܐ "   'ܐܔ ǘؖ   ܐ "    'ܐܔ ؖ       ܐ "    'ܐܔ ؖ  ?   ?"`"@ (``  5`@@ "@@`" "``" &``@8 3+`@@2 &-`5`-` ` @?&`@ "@@`? "`ܐ @$@*@@"@@`""``"&`  ?` `ܐ "  @  ܖ 0'܀   ܐ "   'ܐ   ܐ "    'ܐܔ  ؖ a؀ "&'& '&"    .   ܐ "    'ܐܔ ۘؖ 3`?C䀤 ^> "`"@ 5`@@ "@@`" "``" &``    =ఐ '@ H0  0` >9̐ 0EEK! readdirplusrpc resid > 0 X'| 'x`'L| # `  'P''''t > c\` "`  \DS`   ?'`  `  8    0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  ѳ  >!"'" '? " 'R # @ " R   `c    "  8 2 `    $ 0@  "@` `   ?#  h "@'"  '`  "`  '# #    2 # # #  # x`#` # `L#\#`' = .'   "    '          "    ' d  ' '     "    ' J     ц@  ?t"`" (`'t 6@@ "@@`" "``" &``8 `:+ @@2 '"`t`'t.6.'t`@?&`@ "@@`?"`@% % @$@,@@"@@`""``"&` ?` ` "  @  . 0l'   "    ' Ø W` '"@ '"`   ``  "S  T T 06'   "    '  !L   "    ' v  ``@` ?` ` "    ' Z W 2X @ 2X 'U   ^ '''R '' ( >c!X*` @2 .|" % j`@%@  3|,   "    '    ` "    8 0v'Ґ    "    ' ǘ [ `f    "    '  ?`? `&> t ""@  6@@ "@@`" "``" &``$   P ? P "@ݰ Hذ  ` >;#Snfs: sillyrename dir .nfsA%05x4.4㿐` ' V `4 $s$ `< 2>?e!,   4>?a $  `*`:  z,  @ w   @  "   _W hX> \!L `""L $H  z'S`   ?`  `  8    0 $   " $ TS`  ?$$ KS`4IS`     8  `    $ 0@  "@    ?#  +  >k!"'" '?` "` 'R`#  " R G A`ې :0   "  82 `   0 $   "    ?$  ߐ "@'"  '   "  'ȣC ?  `  `  8     0 $   " S  ?#JG     8  `    $ 0@  "@    ?#  z  >!"'"  '? @" @'#  "瘒  , .π`#\#` ;찒 "`` .  !   "    '  ``@  H` ` ?` ` "    ' r z@`$ R @ '܀`@4 RVF  `R @ ܀`@ TΔ "`ܐ` 2 U2 X@r 2Xq Gܰ Ǡ0P -'   "    '  "  ؖ /䖒 ؀ @ q 0 'ԐԒ䖒 e ``쀧`@  ܐ0'@pX! H > c\` "`  DS``  ?'`  ` `8  ``0`$ `  " $ TS``  ?$@$ KS`4IS`     8  `    $ 0@  "@    ?#     >J!"'" '?` "` 'R`$ "R &  ` Ƽ0   "  8 2 `    $ 0@  "@`    ?#  ˼ "@'"  '  "  '$$ $ !#\#` 찒 z .   "    '  R> #Ā@   "  ' ٘ 9'   "    ' Ę $   ܒٔ䖒 쀦 &   "   '    0А@Ȕ  _ !1㿘  "  `X L ̓2` $ nfs physio/async㿘  0`  >C@  0  > # 0 [ 㿘    @ nfsfsyncnfs_fsync: not dirtynfs_fsync@ ?' X'T!쀠@'L'P*  !@  '?   X!"T T`QH /d * % 8 p 0 23硐 0@ @$ 0,"  T:  `2* * @ ;C 2 d ( d   d" @ :C8 @     H 0GP&!1 + X 6,  0?# @$ 0郐%H /d * % g t? & t 0a $ 0 0$ d $ 0$ `H 0HΓ,H /d4 p* % p \  0 + L 2Q`2N 0  $ 0>C8`nj H 0 Pq ea>X!P * ' 0 `>C!!HT` 0 2Ґ`T  0 $ 00 0@ @$ 0H 0 o0 H 0`L `4H /d * % >C`tH 0 P a >X!P * ' p T [`  ?`2` 㿐   `` #\  tag VT_NFS, fileid %ld fsid 0x%lx 㿘 >D`#@`8 `<>D#h㿘 @  bwrite: buffer is not busy???㿘>  0 # 0 >Dn# 0?! @& 0H /d * % G ` 2  \" \`0 "`0 \`t "`tH 0!@  @ 1 T :* 2` ` *`   0:  d@ @" & 0 \ ,v 0* & 02  0& d ?& 0& ` !1 \ X ` 0@ & 0g`2 뮐` `0 "`08   `X <   `<          2   /㿘 > `8>da28> " *"@ *`@ *`"a|*` @㿘 > `8>db28> " *"@ *`@ *`",a|*` @8 ` c &>cd4 `D  >c`X < >c !" ' ' ""  ' '  >c#P> a|* @@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full 㿘'@`  0  %@> @  ? `>F ȖU >F  >F!2  Ā "C   >  `  ̡, < ] (@ƒ d$ 0> @- " $06 2 `@ @ૐ>M @J  a `@ $`$a'@@,ޖ  >F@0>F !H dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optim㿐\'` %@ `0e@> @ 2 ?  @  >F#0q`>F#p2`>F# ".`````̡,`< `(@ d$ $`.`  `>F#`K >F# ?䯘 '= @,  `@߾@ `@ $y$`dT,@" >G ``$6 `2'`<`*%`(@ߎ `̀@#>M>G`  ”`$``<`(@} d`̀@`0>G `P`Ԑ  $`>G `>G >M @  $3`@@ 6 `T&?  @ =  `$`$`d,"T 0""0 H@౐%@` 2" >F@*0>F!H4`԰  5'@+b ffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d, >i" U   %$ N     P@? ,`@`T d 0@ œ: 2`>HȐ @&  @6  ,`@ P "`>H! @&    8@  d`T*,` T "`>H!H@ @   T@w:-`@`T@o:2 Ȑ@" 2 @" 2 `*` * ?@@ 0?* Y 0  H@_` *` * ?  ` *` * @ @2>H;!x"  0?  H @>O"h@ , @@%@" ,``T d 0@ : 2 >H ! d T: "$>H! 8`@ߠ @>i"  >ib ` %`    >i" h  @* ,``T d 0@:   d, "T @`T d 0@ : 2>i>H!" >H" 8`@ڤ @  mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free 㿘& Ȁ f<@ 2@k,ϒ@: @j<@ L @   *@ @ ?*@  >P" @ "9 X  @ B04 `" >I#s>I#>I#i& &  &5&   &  >I@ ܔ>I#԰ 㿘  , @В @̒ @Ȓ  @ "=  @ , , #P*@ 6@`& `&  &#P 6 #P*@ 6@`& `&  &#P  @庒``: @8``: ,   8@m & : ,  4$$   0@U%@ &@L @8  @B8 " 6 #P* 6 `& `&#L &B &#P 6 ,#P* 6 `& `&#L && &#P , 6 #P*  6  &#P 6 #P*  6 &#P v 㿘 `\@✒ .? 2I`8`t @  @``M .?   @`@۶@۲` `,@q`@۩ cP*   6%`&cP 4: cP*   6`$cP- `X )& * ``*  " `@0 $b `8 `D``|*"@ *`@ @f*``8? @a `8㿘  "`,/ 6`,@@6&@  .`,@`,@   ܲ``,@"  㿐 .`P T': @/? 8? 4  ޜޗ.@   d, ?٘ @`H"U  > #Ԁ  >    0!8$ @᠐T>!   @"U@:c `   ?":@ ؘ  8#@"   @"U@:c `   ?":@ #@  ># *` 4 ?" #*`  " T>-    @"U@: `    @"  * *+@ $ ?$ $̀P?$̒@` ?"`  ,㿐 .`P  2 02  ͒.@   d, ? @H"U  " #Ԁ     > 0> *  !8$ 02 T@˔ߺ08>  . 4@ ,`@ "`8@I  L@@ର8 $   @"U@: `    "  * +8`@ 8  $"@ $ $̗+`P $̒@`  4 "` ,  " `0M@k  ߶ 0B@6" $   @"U@: `   ? " *@* `@+ $ "$ $̘ 4P"$̒@` ,`""` , ?# $@*`  # pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cyl㿘  `H @7` " 8`( @`@bU c``@ `@> 2 `#X" 8%P`ǐ |ܦ@ `@bU -`T@`T@  @"U-`  @`X@܇* ܂ @߮ @z v@ߣ@ߡp @ߜ%Pj@ @,`U $`%P@,` @,`U 4 U`@,`U $`,`U d@s @%@ | `@ا* %L?,#\ %T.* R? ?>M# >N 2%T,#\ %P* R`@"U@c``@@Ք 2( `%L?2%Xe` `@  `: $ >M#Ŗ >Nl ( 8@ 6&`(o , `@>`bU "``cؒ@@Ґ?@`&` Ē& ` #P*` "۶ |@  |۰@ @ ۪  |ۦ@ @ ۠  @̐%Pۚ@ * `@"U@-` Ԑ@ `X@ۈ* @?4`bU -``T@`T@  ?".  n` ffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost block㿐` .`T6`  A<.@   d, ?~ @ HbU "hԀ h.$    `@ 4$@ `$@ ` `$T@ Tv"@c"8  @`: l:` * &  *    *`  p   26C @4@"U@`&@  2`>O:!@$ګ`&`*@ @".>O%" @”"8>O"H@@ܨ0 cg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in map㿐 .`P  2 ް XS.@   d, ?ە İ 0@`H"U " #Ԁ > ܱ  !8$ @W  :`b \  ?&:@ W 0` `:" ,  @"U@:" \ @ 2  @ "U@ " \ @ 2   0>P!>P`!@bU "  \ *    *>P!>PD!$ 0 @"U@:b \  ?  &+@* <?$ Ȗ P?$Ȓ@`?"`  ,  $ P $@ "@ۢـdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free frag㿐 0  @> @   8T@>     >Q!>Q!@Վ$@ >Q !>Q!@0  -@   d, ?M |0@`H"U`  > cԀ > n 0!8$`@0 w`@`bU >@c``@@ ; 2 ` >Q" >QR"H@"U@"``cؒ@@  @`-` $`ĐP` $`"ث|@|إ@@ ؟|؛@@ؕ@P؏@* `@"U@-  Ԑ@ `X@}* @ 4`bU - `T8?.@`@"U@:c@``@   " $  : :@ `4?@ }T > 6?`$@ `@"U@:`c@``@  : *`"; " @ >Q" >Q"h"U@"``c@@   ?"  *@   +`$-`$`$̔P$̒@` "` `@"U@:c@``@ 8 " ?$ ::@ @  `@`"U@< c``@@  d`$8 " $`$8̐P#@$` #@#` ``$`P`$`"ת|@|פ@@ מ|ך@@ה@P׎@* `@"U@-  Ԑ@ `X@|* @ 4`bU - `T@`T@ @ "@ ,ق㿘@$ffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ffs_freefile: freeing free inode㿐` ,3@*>S`"@@ɒ` #-   d, ?` ُ0g@`H"U   > #Ԁ > ف Y !8$ @9 @bU 6`b \ `: 2 `>S"xLҀ 2 >Sb"@"U@b \  +@* * 0@*$ 0 -  $ <P $Ȓ@ `    "` ?$ P?$@ ?"@ ,ǰ bsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %dffs_checkblk: partially free fragment㿐 0  @> @ " $>T! N>T!8@*>T!P @͒_@ƒ* W  dࠓ, ?י Ȱ?0T@`H"U` " cԀ "ع E?@d0 @"Uc``@`@>@ .T > ! @   @"U;`c@``@    ?#;@ 2 `@ @  >T!pv`?start = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in map㿘@` `, & : ` , `@:bU "@``@`81>j* h@  ?"? * @  +`@"U@ c``@`8 h*@  ?"? * @ 2 >T#`W >U " *  9&`,  `@"U@:c@``@  `8 "  :& >i;@ bD.>i " @*   `@*+``8̀ >U `>U 8 㿘%$lh>`.`# (.> . # (.@.%$p@6`8('@ . `. @ ` @ '@,?`8('@ (> @ ?@ '@ 4/  &.  &`*` &%$( ? $  #T( uid %d on %s: %s 㿘>Va0 Ԙ8 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapffs_balloc: blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %d  P'T\'X@D <0 @ ?'>V~! 2%6P8 @ ` S @P ` 40`*: ࠀ8 <20ऀ@8<0D L 03 /0#`T#\< `P+ ;   @<.`$@   $X`Օ 1 .`P* : ࠀ8` ऀ 0?  `".P<D L  @  c? " 0#`T#\А :0* : ࠀ8 D2 0ऀ(0DL  Tٚ n  ǘ %X`d*@ " T <@3 H" @"  Q$'@7 I 4>V}"* @'`3'  0T  'Ķ0 րd'.@ <"T@H "`@ 2Ѳ*  $'`$ 'M ` ' n C2 0 r 0TQ  & 0=d'.@ <"T@ЭH ԁ"`@ @ * $ &'X`m ?0 h-@H*  `;@* @0T K &0  d'X.@ "TH@V<" @%@* @X* `$ n ~j ې X0?Ӝ 0 ձ 'd.@ " T%I ԺԶ@  @0`0@  ""`?*` * 0c ">V|"H@X*` H$ " > T@ "@ $$diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapffs_update: bad link cnt㿈> 88 *`" *   * ''`X <`   ?%  @    ?%      `@% `%   % %  H`B = H  " 88% `*`" *  * %   ?% e, 4 ! !5 5  ` @c`@`* [`` @ה@`x``?* `d`0, ҕ찒 "U 0  "`x>Y{Đ `@x  H* @ ή  `X < @D ffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2'T   < `2  ` ` 'X @:`  ` `! " >Y{\#@η   !  > & `O @v 2а@ & ( & ,& 4& 0@>e08 e4   !T#\` D T 2> @Y@5`CT T !`&    @?e< 2`PJ> @n   !T#\` D T 2b > `P * :  8 e<2`0 8e<`0 eD `L @< T$ H@Tc`T`0ҁT`0  : D`P@B?'`t$ '`t$'`0 :` 'L̈́ <. ? " "@ . $ .% `!&    X'H H^ <Z <>  (> ɒ > # T /?'`t"@ '`t ܠ "@'  `d/ @ǚP 2P  @ %`0\L@  {ޠ? +` , ! &`P* :  8 e<2`0 8e<`0 eD `L -< @۴`J,`  E` 4`0`P`* :  8 e<2`0 8e<`0 eD `L ` > `P`* :  8 e<2`0 8e<`0 eD `L # >Yy#H  `T:  ޔ< @H  0. ">Yy#`    H ">Yy#p!> " &!&! `& ?@ ffs_indirtrunc: bad buffer size㿐  ''P'X    tؐ?P@:0:  3 `0" > # `, "`,`0`< `8$`0 $$`T>[y7#ސ P&Xu"?"`H0 9Ɣ 0t, "@@t*` X < @ E 2'ސt?{?&@,  d. ?? 2'@0@?@ P @т,  d. ?_ 2'@:В  X`0 $`0гX"diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐  P @ 4 0*:  8 %<2 0 @8%< 0 %D  L  '?- \0 %< H @ & '㿘 8>jh/  @(+.`   '@;>i>iD@ @2  8!/@/ 8/`/  8`@ڈ Disk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlap㿐> 3!`> *" *   <* d:`  T@  ;"5 t 0@20 t \ +   2% t` @2  t < " t T4 t: $ t>]!H <>] T;  !Xy?>]w! t ʀffs_isblock㿘 8>>]0#  >]@ `?>@ * @ * *@  `?>@*` @ `?w"؁ffs_clrblock㿘 8 >  >]0 >].@>@ *` @ *` * * .@ >@+ * .@w[#ffs_setblock㿘 8 >  >^0 >^ .@>@ * @ * * @ .@ >@+  .@w, `ffs_isfreeblock㿘 8 ">  >^0 >^@`?>@*` @*` *   `?>@>  v! diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapsoftdep_flushfiles called㿘>^vʐ"p softdep_setup_inomapdep called㿘>^v"softdep_setup_blkmapdep called㿘>^v"softdep_setup_allocdirect called㿘>^v#softdep_setup_allocindir_page called㿘>^v#Hsoftdep_setup_allocindir_meta called㿘>^v#softdep_setup_freeblocks called㿘>^vw#softdep_freefile called㿘>^vm#softdep_setup_directory_add called㿘>_v` softdep_change_directoryentry_offset called㿘>_vP Hsoftdep_setup_remove called㿘>_vD softdep_setup_directory_change called㿘>_v5 softdep_change_linkcnt called㿘>_v) softdep_load_inodeblock called㿘>_v! softdep_update_inodeblock called㿘>_v!P"@  softdep_slowdown called㿘>_u!diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapffs_mountroot: can't setup bdevvp'sffsroot_device㿐> #> > 2"+cİ  >_> 5!!> ## >_w"P0>>_>_"xba 6#@   ?"B7 0$> ͔""` 2""@"`!`   Ԕ YƧ @ D @ WARNING: soft updates isn't compiled in WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck Ɓ l S _v#<*@$<< @ @@  L Ҁ    Ӏ  R<* $<@c  Ӏ <@ L Ҁ  *@$< <@0@l E<@B   ` !ʐ  L р 2 <@>`>` 8v Ӱ  v Ӏ   @  , 5V  ,@ $#L    @Ŕ `0 @&(&&$&&,܆ < " > - aH&    "<< !!` `  v<@@#    ` 2 z v )  Y4 Z`" @ǥ  Y' Z`@ǘ$  Y`@ǎ$ @\ 4L l D`&@<@"&  L Ҁ,  Ӑ  , #L6  <@   ?, Ӑ@  ffs_reload: dirty2㿐`D `P ``֐ I ``  鰚 "@>asϐ!`` @>`@ې`* 6`` @o@`x``?*  `d` , p`0 @  x@[  H* @ Ƒ U % ˒10.ffs_reload: dirty1x< '  `   S   >asm#x`h ?ʚ " (<` @ܐ? FH!T\@@0@eg8< o  ` #P"P#T"T *- h h#@40 "0! %(@%@D@  4?@ ##P 8 0 4Ȉ$  d@*@ ?ʘ 0ܒ H 8 Ӏ '%$ $>a ,  #T%$"@ ,`>a''''b ≔㿈 ? y䦐 > #p Ւ`  芚  V \`<   ?b P `h  " (<' @G  F HaT%\  O 0@@eg(  , В ?L р , Ӑ`, `<@>`>` s %L 8s  %L?    2!@ţ! h 2 %` H2 h h#@0 "0('`  ,  4@  %$  ,*  2  @$$#P 8@ 0 4LJ%  d@*@ ɘ  H' 8@@@%$ $&a , @ $#T%$`"@ ,@`&a&`d "`  2&`h`  &`h`<%( &`@&`<%`%@%` t %`  d%`$ 8%`(,````" @t"`" , $#L 2W  ,@$#L`!Β "`Ԓ" @%0=aH 0   @ɯ; B?%0 8 <%0%4 <%0C Ӏ    #P3 #L3  , , `<@   ?, Ӑ@y  #P3t " 쀢 W  /` ` 3^ 3[ &a㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:  :`>%0 t : @5 %0 B ?>%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿘6`<` @`+@? 9L Ҁ 2` Ӑ` `, @  "#L), 2 `  ?" ` 欚 L Ғ  `  ?`#P2Β 2˒ 2Ȓ <*@$<$㿘<  ਔ` % , `@ @Д  ,  `` :``/ ffs_statfs㿘!F aTe\ "`4>dpr#&``0&``(&` `8``̠ &``<`(@E d$&```,?&``Ȓ D@ &` `TH Z `D Z!La@ l `D`@8  㿘` "  < `  p ``% ` `` 2&@`̒ > fs = %s update: rofs mod㿀 L`Ѐ   L`Ҁ  >e>e!XqX`>eo!h>e`''''ߩ耢 2< `` ڔ 2䀢 >e` < 2  `  2 r @ L`Ѐ @˒ 2inode㿐a @ & > #x K > & fސ @! >eT  ,7 >j" `$ $$ $@$ "ޠ ͐0g@ʒ༠@ʋ*  @@x`?*  d ,  0 M?&@x H* @ =T$>> "4@k " %& ݓ$  2,] `$ $ X < 2, $, $$  &㿘! ` ( FĂ,`@  F@   2@ "`"`㿘  ` `4?@ΐ *cP`8`0`4W%``d@*@  Ǻ  HƔ`@Ơ`8 2`8&`8 6 `T`d@3" `h ǖ ,`> a8$` `h HeL? H"Pe, 4H8 H"@"H`:0c0 2ffsino㿐> 7 2 >ac #\"> >fc !   dB @ 㿘`  >j   -0   -0>j #h#l>i">i"Gkdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map%s: modeffs_read%s: short symlink%s: type %d㿀   `>g>g!HnaX`<`X @ `2  2 >g>g!hmaX ( >g>g!maXe0 ð 2 e4@(0 2   b'@G  '*@: 8 e<2`0@8e<`0eD `L  e<`0  *= 2`P@(`P`P+@:  @ <>j#h  ?#\#`$ː2$ '` 4'`*:   2'8eD 'eD `L '?#\#`8 ? '$$`@$6`H`HA 0'  b 4a`P`8]`P " $ffs_write%s: nonsync dir write%s: typex'` >g>h!HmaP` 2<1 "#   >h$>h $>h>h "  <`  @"`` @ `  @"`0 2 `>h>h!`lВaP!xl͒aP` % ``0 @ 2<4< `` ` @     = ڰ  '``  ?耦 `P@ ` <0 @`"* $`!#\ r`< @ 8   @   < @{ '@{` @P`* :  8 L20 8L0    8@ @@ @ "@&H@  H@ "0^  >j#l  $̘   ë  " `  $ ` 2r``(` " `  "` 34 ` 䀢`  n  !@ @``& @ b $`<``  !`   ffs_fsync: not dirtyffs_fsyncffs_fsync: dirty㿘 < 2   "   <@"    `?H /d * % p m  0*@$ 0  p a  0 @W  0  >ik{""  P &K  p  0@> #     0 $ 0+ 0` $ 0H 0` 0q RH /d * % p  "  *>i ൖ H 0  +H /d4p* %p   `k< >i"FH 0    `? 㿘  @  >  c $  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 `"    "@      @  ufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cache` X  쀧 >j` >jju#P`'@L@Ň@?"Ȁ "Đ@Җ  6'Ę .`$* &`" `` 4 @6 * .`(  2 @` ` '@.` (  "@~  0z * @V   &L  `0"2 >jj #x`0$ , $`0$`T`> #`,`Ť", `H*Ā`$ !`"   @: @6  .`` '@ @ @ .``H ?(  "@ Đ? 'Ā € ```"$$, &?& ufs_getlbns: Invalid indirect block %d specified ufs_getlbns: indirect block %d not found㿘 X!&`&   ` ?` >k#i^   &@`R  @ >`  2 ( % ""@ "&&& "  @ޖ   @Ֆ@R &&:& @I `" `2  >k#Pi% 2& diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>X!h>   =p> > "a"@> p> ̈́ (  @222㿘> #> "p> ͐@ a* @ "  @2 @2  `֌ > 0 2  㿘> # T    %> p@> ͐ !* @`p`2 @`@2 @ %  `2`p! * @ @ &@ " "@ &    2   "" diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapffs_inactive: pushing active㿘 >c !    D >m!@V 1V 4#  X < 2 @$ ?@& !   @? &   !& 6 `    !`     ا  ufs_reclaim: pushing active㿘>c! "   D >m" c1 $ @ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapmangled entryi_ffs_size too smallh' < 'Ȑ `' `' '&  ?° G @  @ X < ?  Ä [ 2 TՖ/ @ ܐ # "Ѐ` @`> Ѐ   @   `Te ՚Ѐ   @ `& N ''耥'䀥2 X @"X  ?'X! L?' |  ;    2$  8$ $   *'$ Ԭ  !;   @ > 0 '$   `  "`ܒ'> ɒc` 'ܐ "`  aB 2` * @  * '   " y  !:@ ֬ 􀍡2 H?' H`  >j#p @   >m@ǐ  "" @$ P '@`  `  ?"@`@   '2@䀧 ' @&@   "'@ " `2 @t` 2 X @ $@ ` "e`@$ `z$ '`@$ @`    &t܀ | '$  2L`   2D @"@  ; 2   $ taB 2` * @ *  $  耏a$  $ tؐ'@ $ t@ $ $ t!,#  ~ $ $ xА($L ?@YWŽ ܀ 2 `> ɒc` "` `  `    8>m >m @ `      < $ ] @ >$ |F @A=  !$ t" $ t  2XӜ&   " ! `! "Ӽ  `}&Ē x ,̀' @$ g   2X`   Y&`(Q$ L @# X ` `06Ѐ( @%   _0&   2X&  Ѐ  @W &@ %s: bad dir ino %d at offset %d: %s bad dir㿘 >p`X#P eݒ  D >pd#xFirst bad Second bad 㿘  ""  @ >p ? @ $>pe#     >pe# @   J `@  J   ufs_makedirentry: missing name㿘`(2 >qd3 &`.``!  X @ < 2 ..ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2㿈 `t  ?` B `!"a>qc!P #\;  "  2``":  <` @s"$`"6 Xa@`L` H @ Œ =a`   ` : ` 2 `` : <`` a:@ t  ?`t  " "6  ` `"  y`t  @Β  : 6>qck!h66>qcf!6V``)$``x %: ` 8`` ` `xa@:   @ ``P㿐`  !:@ F "@ *` t "@  !:`   @ 0 t "  2` ``?``&`&`6``X < @  t v   $ 㿐  !: @ !"`X @ * ``` &`&`6``X < @E   $ `   2D ?` ܐ  #\#`#h#d#l  > 20 ܀ 2,  "(   4 M  .`2M  "  M .2    D4 @8  checkpath: .. not a directory `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# ܔ X `찒 <   #`#\ #d#h#l     2>scZ h܀ Зdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map        - diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map 㿐 `   &@㿘!ƒ`@  `0`4&& 㿘> 7c  "c 㿐 `` &` a`@"& & F diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 >caX* @  @  "     㿘 >c@aX* @`  @  "  "  ` "``D?2"`ώ " <$ `  2   `"` D=``5"`> 8"`` > `H!8@"`:`H`> 8"`"`> 8"`` > `H!8@"`:`H`> 8"``"` 㿘  ` `<`>u 0*` X <   2   @"    ,`! 2 ! Ӱ Ӱ Ӱ    6"> 8" > H!8@":H> 8""> 8" > H!8@":H> 8""""22" " "D:"$"(","0"4"8"@"< <(@ XL" : 0( @( :H < "H:P㿘     T ?2  ?2  ?2  ?ݰ  D? L? !܀   @$`  @?c @? $` @ @$`` $` @`  ` @  2X ?" X <   @ x ?2< ?"" $< "l  " X a "Xa < ] a  @   Q $?2X ,?"5 X < 2D a@)!2 " $ X 6   / $?" ,` $` ,?"a` $`a` , $  ?#@  X <   @ p 㿘 !@ 2(Ȑ "* "  < b"!  O! ( 2 d"  <  @o@$ 4  @ b2 @mڐ chown: lost quota㿘  a"a a@2!2@  !2a  (i 2 a!2(w laa a " ^$a $a 8 1 0% >v^W"2`` $`  ` 74`  ` ;4`t$a $a^ !WWO   㿘 `<  ` @2   ` "     א` ~  y 0̉̇ufs_link: no name㾐  $ >w]ې"< 2 X8f X@0^    #0Q`#A ` @7 `` `a$`4`$`     Z " ``?``$`$`4` "     ufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown op㾐  ` ``>x0=*>x0:X @ B @ -`(2X>x]3  @ 4'>x], @ `/`` /  X @ 4`>x] @*  $` ޖ ] h`$`  ` ;$`ufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entry㾈    ''$$ >x\!X X@  "0X@耥Ő:耢 4˶˴0L ` ߰   ` ْ , < а ݐ˓ˑ ? %>x\g! % 쀢`  s #@    @ ` @   <  :     耢     ’ h  @J .@     ꥒ K $` p     `$4$      }g`   r`2% # S`" P f O@2>x["M A   `2[``@>x["8% #`# `` `a$`4`$`     ``?``$`4`$`. X  ````a$`4`$`    ဥ`  Œ ې`@>x@>x[6"8`@2`>x[."H""`  `" `a@"`a  `<  `  B`m  B  < 2  2! ` 2``?$``?%` 2 ```?`4`$`` ` 5`%`   !@ a`  E [萂  = S ? %>xZ!T쀢   ">xZ"`ɾ 0V@">xZ"`  >jR#|$  V ` %`쐂 `  `` `Ɍ0$``` ?$y    ?$$40hufs_mkdir: no nameh` `$`>{Z5  #@  !  ԰ 2  `$a @$a 2  ? "` a`  țș04` $`Ԑ "`<4`$`@"` $``$4$     2X X @ >j>j#x#ؔ `''a   #\`"  . `" <`$`Ԓ @h"А`H a      а  _ԔА 2  "`  `"@ $$4`$` $`4`  㿘  @  " @0^  R   N B` 2`E B @@   @"`9$` $     ` $`  $$   ```$`4`   ?4 $ X <! @ @? @@   ǗǕ㿀 (`  @s /  " h @ X @@6  ϒ  <`$ <   #`#\  #d#h#l  w Yufs_readdir: lost in space㿘    !@n $" "   ɔ 2N  "J >| >|X"  #"@@ D  4(    "@ < , "@ " @ "D @42 8$    @  2   @8" "㿘 X @@ 2   2  ,   L 㿘   @ T㿘    ` 5 T㿘   Tufs_strategy: spec㿘` \<? >}W! T P@2 T   T樘 "  T 0h$ 0$ 40?2 T H@7 <$ @ T?>e ` $ D8*` @ 0 tag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld 㿘 ?   >} 2   "X  >} "XT  >} #!X!  T>}Xא#8㿘 >d`> `" |*` @㿘 >d`> `" ,|*` @㿘   D B>c  ":>c  "> !8"  > H8`B ":H "# ?> !8"ऀ ">c  "> !8"  > H8`B ":H " ?> !8" ?">c#P> a|* @@ >~ (      $ "      㿐   `P` #\ : 㿘< >c`a 2 @`!$ <>~#*` $ 8`R >  &  @a|*$ @$ 8$ Ǖ$` -` 2`H @ $ @`H> # <`H# *` * " *  * " * <`H&       ufs_makeinode: no name㾈$`>~Vv#'<& `  p 0y  $a  `$a 2   "`X a`  ڐ0Y  >c4`$`2 a@  " <`4`$$`a  2    "` ;4`@"a` $`a`    2є 2@ Đ  & Ĉ`$` $`4`ā P >j 2 >j 8>j 8 8 < "   <2  2  <`@  4$ " @   2  `@" "  2   , `@  " "  @  2  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK Ndiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_amap_i.h(( offset) & (PAGE_SIZE - 1)) == 0amap_lookup: offset out of range㿘> Ȓ  ?@  >>> (`T B`6@@ @& >U !.`@amap_lookups: offset out of range㿘> Ȓ  ?@  >>> (`T֔ ^`6@@  & >T!.` ѕ.amap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in use㿘> Ȓ  ?@  >>> (`T `6@ @ @>T"X.` @ 2 >T"x`"   > # €   .` " >T" "   * "@  $  .`"@amap_unadd: offset out of rangeamap_unadd: nothing there㿘> Ȓ  ?@  >>> (`TB `6@@ @& >TQ#س.`@ 2"@>TI#?@  +  ?.`"  * "@?"㿘  &   &  $    " $@3 $ ?   @W 0@R 㿘  ?@Y0' &    ?&  $    " $@ $ ?   @'?0@"?vm_map_lock_read: intrsafe mapamappl㿐>ac> >#\"@b (  I /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0㿘> Ȓ  ? >>> (bȖSr ` 6>>> (bȖ0Sf 뀠@?#> ȳ2 `Jb@ ". * 2  * & & & && & $&  b &  b  &  b  &  ^ b [ bLQb@    @ *amap->am_ref == 0 && amap->am_nused == 0㿘  >   >>> (bȖS ! 0 b - b * b $ ?"> " b> Ȑ"@L(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed㿘> Ȕ  ?  $ P" @   L>>> (bȖR”!7@  2@>>> (bȖR!86@ `@& ` `$ ?@ 0`$ ?@ 6`" @ `$ `$*  " * ? ""$`,2 `$  ?  b-3  -`$ b?$`$- b & b ! b ` & `>>> (bȖRS!% `*``X*` $``*Q`*  @!`$` `*D` * @@`$#$``*5`* @ `@ $`$" @y `$2* *  $ ?$" b$` .$`+ b( b ?! b(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0㿘>    $ "   P>>> (bȖQ֔!2 L` @ 2` , @ "   `> # € &` 0 `,   L@@6`` *`  `> # €` &`amap_wipeout: corrupt amap㿘   , @ * @`>@ 2?>Q" "@@_   & & T& 㿘`P 29 "+`$> ``$` " 2 ! , @@` @"@* `$`$@@#w`$` &`L"@ &`P`8 2` `8 ?&`89> `$"@ ?@  >>> (bȖQ"v2@@?;> Ȓ `Hmb@ / A.2  * $ $ $$ $ $$ $  b $  b $  b $    b   bb@J W`P    `8 &`8 & 0H6! `L*  * @ "   `"@ "@  "   * "@  & &`L * "  *@  ? $    ?$  $  ?  ` `$"  ?`L@2 `8&`P ?&`8&`Lamap_cow_now: non-resident wired page in anon %pcownowcownowpage㿐`P V- @*  `2>#@Py $A`0 2=`(   4`(>x"- @   #\   @B  `  ">@>@J?#@=Ғ??$ "`( @ @=q6`( &amap_splitref: split at zero offsetamap_splitref: map size check failed㿘> Ȓ  ? >>> (bȖO#\`6 2 >P!" " 4$>O!( 2 @   &` `" &@㿘  b*   & $?& $  @*  $  8"`"@amap_pp_adjref: overshot targetamap_pp_adjref: negative reference count㿘  $@@* ,` `  8 @&@ 8 $ $ " & .`$8 $"  @@ە,`,`  8 @R@>O}" `  8 @$ 8 $ $ " & ,,$ 8 $"  <>OT"@ , ,8 $ " ,`,`$ 8 $" 2@@@@,`㿘 6@9  5   * -    , @&!  *@"@  @?  +   ?*"    * "@ ?& @? #@@ ̀diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘>   > : "b> 7"c@"uvm_anon_add: can not allocate %d anons uvm_anon_add㿘> Ȣ `|`x" 8$`|>k `. @q   b>"O>N#  * " " > 7`""`" " @B`x `@$`$`x> $ "h `"" `" > Ȇ|  |> h` > Ȇ "` "" " /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_anon.cpg->loan_count > 0㿘    0  @D !  " ( 0  ?>>>"(`M $ 0$  "> Ґ 4 (# €@B @> h`> & ``"` "`㿘  @T$   & > Ȓ``p?"`p   0    .2 ." 0㿘> 7# "!   @6 ,`@  6  @ "   `@&  2  anon_pagein: uvmfault_anonget -> %d㿘  @`"$ ``" `>> M# ` @S $`  (?> ِ# @4 (€> # €@:Zdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘 (>` $ * @ @ >` 2  2 >   hDs  &" $& > &   @ @uao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP object/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_aobj.cslot == 0㿘`  >D N<!H>L!h` @7 @   `1 >>>#aL!\* @ "@   " ?" `"`">  hE 0` .`@"@㿘  @0  ( 6' $ $,@`" , ` "  @R > Ȓ``p?"`p  , @> E h  & $ $ c> Ҡ 6  , @ "  @R > Ȓ``p?"`p  &  e c> Ґ"EZuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots failed㿘> Ȑ  `  . 2@>k > 7>L # $ ?$ $  "` >k> 7`#>K   "> Ґ"C9  $ $ $ ``*>j 6` @ : ! 8  c  ( $ $>Kڐ .  x c $ >KА!@ `  ?$ >j#$ $$  $ $ > 7HH $ ,H ,"`0"H$ 0uaoeltplaobjpl㿐> 7cD  "cD> 7"#H> 7!>a#"cL> > hc X   Ae#\> >#\"Ěc 4  A[ 㿘@ " 㿘@㿘 ` 3 0&  ,`" 0 0"`0 0 ,"@    ( "> Ґ 4 ( # €>  @ @[@?O  2 (`  & uao_flush: strange, got an out of range flush (fixed) uao_flush: weird flags㿘 `  >     * 9: 3> Ȑ`  8    +@; 8D  ;`   @ 2 (  >LN ؐ`  * :  > Ȣ  :`@gd2`*  *`  2 @ `  ` `" @7n >  g   $@a ` 2^ $` X  :F4 @6ޔ C` "  49> 6> 02> 0 21 , 2-> # €@7j$  0 2 , 2 (  4 (> # €>  @ @x@>lJc!` ``4`` uao_getpageuao_get㿐d@g   Z  ?K@6j 4>  @`   ` @  є `* ` ` .`@  #\  @  `4 (&>    :D '      2~> Ȁy> >  @G `!  `4 (>" &`4 (& @5 2 (#\  @; 2 .>@C  4 . A> ` "` @ < `* `` .`@`2@6 (@O  " ( ( (P|?@Ou  (?# @4 (@=h0?> Ґ# @4 (€&>    :Dy pg->flags & PG_RELEASEDaobj->u_obj.uo_refs == 0TAILQ_EMPTY(&aobj->u_obj.memq)㿘 (   >>>#aI$> # €>  @ @,`&@@=  "   "  >>>#aH%     >>>#aHޔ% T 㿘 @O 㿘> 7#H``@ "`,d0a  㿘  @,  (&?  $*@" +  6   *`@5@ " (&  + 2 < $ 6  , @ 6  @ 2  &  (pg->flags & PG_RELEASED) == 0㿀>   .@  : ' #\'#`#d  ",  &  ( " >>>#aH9%` @N ?(# @2(> ! @> # €@5 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map> 7 P> 7 Tudv_attach㿘 > -* @*`"@L*`  [>!V>!ȀRP "!> 7?F>   :F !> 7#P`& (`@2` ` (`` `&`>> 7#T"$ !> 7`` &``&`&` ?,&` Y #P``@2` `  !> 7 >k & &&  & &  & & & #P#P`&  "`$$#P& $ " /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_device.cuobj->uo_npages == 0 && TAILQ_EMPTY(&uobj->memq)udv_detach㿘  ?1&   >   >>> cG6!9    & >> 7 #T"$n   ` $"`$ $ "  & =  udv_fault㿘  8 ( \ ` >   c > X  `> -*` * " L*      0&@ @ `&B @{ `<> a@  >   c  >@@ߐ!) >   :@ D@ ,> ȑ,??   >  c  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapfltamapcopy㿘 & &   2(  $ >kh   #   > #`"   M" >>>"Вb(FR!  $   @_  2  *  ` > # `|   $ "@ @*&  `8 " `( ` > # `c &   & `. `8        8   > `  > #`@ >@@ #X   > # / anonget1anonget2flt_noram1/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_fault.cresult != VM_PAGER_PEND㿐> Ȑ  `"    > #! b@ "b@> #! bD "bD    0  ې "5#\ ( `! ` > 4 (``А "`   >   c ˒ > ""Ȗ C >   c  >" "2     @7ɚ  >   c  > Ȓ``>"`@?g!   >   c  > Ȕ`" @Kܔ  > #  ؐ $ ` #> >EJ#8`c l   @c b  ܢ  $܀ P` ( " ($  (?# @` 4 (> # €` >   c : > Ȓ``԰  G"`Ԁ 2  >>>"Вa(D!&@K ?& @8` >   c  & > #@@2`  ">  `L ` ﲒ"  >   c   > Ȓ`` "`uvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2uobj->pgops->pgo_releasepg != NULLflt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2'L > >k` ` `? `'D".@ '')'ؑH/` /> #`܀` `H*``L:`H 0 ` '  '@''` 1> >D#8`# 5 @쀢   # (   $ܒ"@@*'`8  `(#   '  '耢`H< @ > ɔ c  ̰  1> H 'HL H 'HH 2 8 > (  > # ۔ @> Ȓ`` "`P  ( D> # Ɣ  D 0T>k*`0 *   > >>>"ВaCm"  @ 2 8 $"2 ?@  .      'D      L$@ `  T L ' @#.` "`  "` ( 2` 0 2` , 2 `> # €@0`@&.`> ` `4$@    .  `         . >  %@.@  @R  > c$T X?;"@ X@ XX1"?"@+  `'> `0 #> `( ! > @0 > Ȓ``>  "`  4  H   0 a@>  ```  @#`#\` @LX ` 0p`2p'L> Ȓ``X 'P"` 0$@@8C  P#\ @ T#`#dP I'L E @`65> `(  >>>"ВaBC#$'L@/ > Ȓ``>  "`@ 48 H   0 a@@?(# @2(>  â``'L`- @F` ``>0>B#  0`@ 2< 9#\     @4H 2 >  c  >@;#@Ր@/> # € "  `0?"`0 ?"  . 2.$ .(  @ 5.5(%Y>  U> Ȳ a l&a   #\   @4  2,  "> >  c Ғ ph@ >>>"ВaPA$@2`̰  ">`&`@;#xo@/(?# @5(`Lܖ ` 컒# ? &  `"   H ؀`40> ! @ >  c  > Ȑ  h p  >>>"ВaPA2$ >@;?#(L  @-(?# @5(B> @.n>  c  L?'L ? >>>"ВaA%.  8 @ L  > > #! b@ "b@ bD "bD   & !> Ȕ   "'P` L`4P܄ " `8 `#\  T#`#d` ` `>>>"Вa(@%W > >!   ذ  ؐ & ` "`>@#8 ؔ @ Δ   ܠ  & L (   `L` m"  > ɔ c   -`L`( L] L( > Ȑ  Ԓ`"  $  >>>"Вa@M% E@- L? (c ;2 (`b > Ƞ ! $!`8 2L0 ׀2#\Ӵ     @2  LL`( L L?(# @2(@-dL> c  K  >`$ @:#@-(!?# 5(> # €LL`( L L#( 2(L  $@3d  @3_'L>?  L#\8@?    @2)  =LL"> `(  @- LL? (c 2 (>  c  > Ȳ `p`h@ >>>"ВaP?&M@`̰  &`x`>`&`@9 0؀?"> Ȓ`a"a@-'  > # €LL`( Lj L? (c 2 (L@, `a  "a `Lܖ ` 값# H ؀`40> ! @ *L( "(<(?# @5(> c  w > Ȑ  h p  >>>"ВaP?(&>2 @93 @؀ @+. ?(# @5(>  @  5(@,[( "((?# @5(> c   6 㿘   @ 0>    㿘 !> >>#8 #   @Q#  (map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryva >= entry->startentry->next != &map->header && entry->next->start <= entry->end㿈  >>>"Вah>h'2 H@ > L >>>"Вa>Y'@@i t@>>i"#$ >>^"` @: `$>>>"Вa0>8'N@  (`@>`  >>>"ВaH>&'Q' H #> Ȑ@nf#> Ȑ` >k` `2 2`@: > ӕ*"    #  2`@: `2`? > Ӓbؗ*`*" @ * @ "`@*`@@ > ȁdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘  >   8  5>k`` !> >="X`# ߔ `@ G``# Ӕ >k X   > !䀦@ > 3!`* @@* 㿘  %>   >="X  >   8  @   㿘>  @ 8  @ ^㿘>  @ 8  n@ uvm_fork: uvm_fault_wire failed: %d㿘a &` @ $>k@!? &` >k ` 2  "" >=6 `&`  @   H`"\@}㿘! #>k @ % ,`` & ,(``@&!   :`0  88  :`  > 8((   : P㿘! >k `@  H /m4N 1* .N 1  @FՐ , & ,H 0> & `` "`schedulerschedpwait㿘> !  J1 2, 2J ?* @ "@@ $  2J1  > > >!  ǘ > ```2 @> > @6"> 㿘> !    .  ," @`2$  2  L 1   (  4 >k x @ @@$`(    2 ,`> Ȕ@* 2@   " @㿘H /m * .  ,N 1 ?`& ,@F<H 0> Ȓ`& `>k "`! `(@  @ldiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvm_init: page size not set㿐>  쀢 2> >;ߐ"  @"h> ǐ("b@)@ @@]e@1@, diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿐` ` ?@  =#@ " -> Ȑ @  8   k +>k``@|   ^쀤 [ 4* *Q P $@8`` $ ' $ >kh   o   > #`" `  M" >>>"Ȓbؖ ;!  $ ``@@``` > # `A   @Ւ   +>kdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvm_km_init: could not reserve space for kernel㿈>'> "#> ."  > 8> 8> `8"b""" ""> Ș #!L> 8"  "?"" ""!> 7#!P"#X@A >  @$#XE#'& #`#\ ?@ ? #X>:" #X>k" `uvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation failed㿐\`@>  #\#' *@ #` ?@ _? "@>:R#x&@]  @@ 2 @>:A#@Ζ$@@Ж >:1#/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_km.cuobj->pgops == &aobj_pager㿘 >j#؀@ %> >>>!aP9!K &2  *   @H  @&- >  ( "> Ȑ 4 ( 6@ @->  @@ 0+  (     $ 2 $( ( "  4 ( @; ː@- 2 UVM_OBJ_IS_INTRSAFE_OBJECT(uobj)(pp->flags & PG_BUSY) == 0(pp->pqflags & PQ_ACTIVE) == 0(pp->pqflags & PQ_INACTIVE) == 0㿘 ? !> >>>!a9i!  &2  *  4@p  @% % `( " `.>>>!a 9J!  >>>!a@9?! >>>!a`96!@-S  @@ Ӓ0? `<`  ` 2`$, 2)`$(%`( " `.>>>!a 9 !̀  >>>!a@8! >>>!a`8!@- `2` vm_map_pmap(map) == pmap_kernel()km_getwait2㿈>  @ %> >>>!a8є!  Hc'  * '#`#\?@ ޚ? H  >kD@@>  ` H" 6  #\  @* ?(# @2(2 `>@2!? > >  4  !4 @ &@ϒ㿘>  @ 8 @F@ 㿐 2(>  & >kh      > #`"   M" >>>!a8=!  & >  @ 8 @ @( > #  f  @ uvm_km_alloc1: non-released pagekm_allockm_alloc1w㿈>  @ -> >>>!a7" +> bh @  H#'* '#`#\?@ ? >kO  `` H" Abh @$' "(  >7 2(> "  $` #\ @* ?(# @2(> >@1! `!4 @ &@`Ĥbh @|$㿘@ 㿈>  @ > >>>!a7" ?> "@  H#'* '#`#\@ ?  vallocwait㿈>  @ > >>>!a7W#  H@  L*@ " @>  " H#''#`#\@ `  >  { > 㿘?ǖ?㿘H / * ' >  쀠8`?H p@㿘H / * ' >  H 0diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvm_loan: intrsafe mapp " >6ߐ"  ''''''` #> >6ː!`c  @ 쀢   c    $ܒ"@@*'`8  `(c  ̔ '  '耢`Y L ( `6  ` g$   ؒ@S `ؒ@  8 ؒ@Ĕ ?  ?>  @Π>  c  `>  *@& @ > c  r 2s' Ԑ": ` @= @a loanagain㿘".     > # €  &@+" 4`P   # !?> >!  -  0 20> # €0`@"X&0@ "@ &@fltagain2uvm_loanuobj: object has no releasepg function㿀 `(`  `P`   @&#\#d#`   ''     р  >   c ђ   '  `&  #\#`#d      ݰ?> >!    Ӱ > #   ؐ $  ` 7> >5w!`㘒    @㘐    ܶ  $  (  `L ` -"    >  c m  $`(   `( ` $ >5."0€ u @"a ? (c 2 (k `0   > # € `0 "`0@!u@D"@   &@"@`@"5&@8 `( ΐ ? (c 2 ( >   c  (?&" `0 2  > # € `0 "`0@"@"@ &@`(  ? (c 2 ( loanzero1loanzero2㿐8#\ >   c ƒ >@." > #   ؐ $  ` 5> >4!`    @    ܒ  $ ܀`"r #\     @& ?(# @6(@"@@ `@ &@ X&0 >  c x  "M?>@.@# > #   ؐ $  ` 5> >48!` Z   @ P   ܒ  $ ܀`"  Ā #\    @&Y  (?# @@!B6(@ "@ &@㿘`@ ? "@ `uvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!㿘`- 0  >"3̒?$ 0@ z 0      ( "> >"03# €@' ײdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘    @&vmmaplk㿘& $ ( & & & @& D& >& H& L& & & &     & & & Ho o>  " "`"& H 0 㿐 ( & >kh   X   > #`" I  M" >>>#(c82!  & @ ߖ > #  *  @   " 㿘 ?  &  H L@UN 㿘`N`"` "N$` 2$$ @ $@" @$` &`@2"`"@@$ &&@$@&`$  $ ` $`" @$` $`@2"`"@@y$ &P$``" ` 2$` $ $ H2$$ ` $`" @]$` &`@2"`"@@O$ &&`$@H&`$  $ @ $@" @8$` $`@2"`"@@*$ &$@$@#$``" "X" 㿘2 ` 2%& &` ` &`" @`&`` &`@@2"`"@`@$ &&&`@&``"`   "      2)`  `2$`  & ` &`" @Ð&` $`@2"`"@@$ &$`&@$``` & &`  2" ` &`" @`&`` &`@@2"`"@`@$ &&`$" &` @ &@" @{`&`` &`@@2"`"@`@m$ &&&`@f&@`"` ` "  ` & V"` 2)` `2$`  & @ &@" @:&` $`@2"`"@@,$ &$@&@%$`@` & &`  2" @ &@" @`&`` &`@@2"`"@`@$ &&&`@& " 2@2& 㿘@2`C` > @ 2``` $`" &@2$`$@@ʐ$``"Ӕ `" &@2"`"@@$ "  2" `@$    0`` $`" &@2$`$@@$` y㿘@   `  @? @ ` &` &`&`  &@`6$ $@e$ $@  " `  ?@ &   "  20"   " "  `/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.cnext@`8`  8%s: %d/%d ownspace %x != %x %s (last)%s: space %d != %d %s: corrupt: %p >= %p %s: nentries: %d vs %d %s: lookup: %d: %p - %p: %p 㿐 $? `A ` (  L2  >>>#(`8/ `$"@` $`$  L2 `$>>>#(`8/  " > !>!>!#\ 0 \?= 2` $Z?  v`? " ` )#   >!0Ҕ2? D` (@"+  $```@ $ >!0?>"0 ?!>!10?uvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpl㿐>k > >" "`"` "`"`> >"ܐ!"" ""> >"!0"`"` "`"`> >"!P"" ""> ِ">" # ah" " " > """" #> "h> 8 h`` " h"` `!>a#> >"a#\   $ > >#a `   $#\> >#8a#\ `  ${ 㿘 >X $>kH /f * ' > "h`h  "`hH 0   > .}#, X ` > > #8%  , X#% , X XY $ $&`( "&` `0@ B >`0&`  P  L9`L  ( & `$ ` $ "` "     L2  >>>#(`8.  $"@$ $  $   L2  >>>#(`8. $"@&&2 "`8   L2  >>>#(`8- $"@&ݐ&2`8   (0 `( €㿘 >X $>kH /f * ' > "h`h  "`hH 0   > -#, X ` > > #8$  , X#$ , X X&`$$ ` & ( "`P 0@ B < 0`P `Lt L (   L2  >>>#(`8-c $"@&Y&2  & $ `$ &` "     L2  >>>#(`8-@  $"@$ $  $   L2  >>>#(`8-( $"@&&2 "`8   L2  >>>#(`8-  $"@&&2`8   (0 `( €UVM_OBJ_IS_KERN_OBJECT(uobj)㿈`4  02 4   "     > #`  `?`   &  21@" Ű  2(@ & >kh       > #`" ܔ  M" >>>#(c8,!  & @\#d#`#\@*  >  > #  鵔  ` "`  ?   >k>>>#(`,W" `  H@" r`$@@m (@j`(e"`8` `0"@BZ@X`8 S`<O`@K`DG`TC`H ?`P >   7> cܐ  "c `"`P@`P +`$$`$    L2  >>>#(`8+  $"@$ $   2  & 2 ` (@"  @` @2 > a "a >X $>kH /f * ' > "h`h  "`hH 0   > +#, X ` > > #8"  , X#" , X@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8$ <$ @$ D$ T$ H>   *   $ P$ L$ L$ P  ( & $ `$ $` "     L2  >>>#(`8+F  $"@$ $  $`   L2  >>>#(`8+. `$"@&`$&```2` " `   L2  >>>#(`8+ `$"@&`&```2`  @& `$ @:&  > #  2    (  >   @  "  $ (  > ̄ ". 4 `  D` $ ("" @*$@   (  @* ""   2$""  㿐@?\' @`  ?@ @'&@ L@     (     (align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= length㿀`'X'HXd  >>>#(`*E$F@  H>>>#(`*7$GH`H@ @ 'H`LH@0@`H@ ``(@ $'H, @  $'H@H`L@ـ@ א`( "'` :'`ڰ  H#\N 2'``$ '  H $@ `"`$@:$:  `"$`*$ $ * (: `` '􀢠`$H@ *'H#\ 2p H?`lH`$'H`#\ "`Y3?`'􀢠> >>>#(`)u$`"`*'*$'H#\ ?( $'H?@_uH H?@x~Ւ'HH`L@@ `( "'` *ܰ '`H&2#d#`#\vm_map_pmap(map) == pmap_kernel()㿐 H@* L8@8  @q 2  &      ( &  ('&  $ $  H"  $ H_ 8 "9 ( ` 2>   >>>#(`(%m2 > "€ >k ` H  $"@  (7"  8 @K@>k ` H  $"@  ("  8$ ( ?$ 8 @K $ 2  &   $&   "  "   (`   L2  >>>#(`8(k `$"@&`a&```2`" ` (@`  L2 ` >>>#(`8(L `$"@&`B&```2`  ("& $ '  *T $& !VM_MAPENT_ISWIRED(first_entry)㿘 W H "  P>>>#(`(%؀  >  ` $ L" 2  8  + (  X"  X ( `" X@  X  H /f * ' > "h h& " hH 0  > #8 > ِ#  2 H㿐>   H@  .@ ' #` #\ٖ `?uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5㿐 ` 2| `$2x `( 2t `P n )  @ >'~"$@ ( >"(ʖ>'q" "     >'g"  >'a#2 >'X#("`&  @"&  $ ""` =  (    L2  >>>#(`8'  $"@$  $   2   (@`  L2 ` >>>#(`8&  $"@$ $   2   &"  @?& `` (   L2  >>>#(`8&̔ `$"@&`&`7    L2  >>>#(`8&  $"@$ $   2 `"`    L2  >>>#(`8&  $"@$ $   2 `@^``2`Z&  @2 `&   $& "```"` |  (    L2  >>>#(`8&T  $"@$ J$   2   (@`  L2 ` >>>#(`8&5  $"@$ +$   2  X  H /f * ' > "h h"" hH 0  > #8)  > ِ##  (start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0㿈> Ȑ` @2> >>>#(``%ɔ&א` '耏`" H>>>#(`%&H'  ` @'   ''  & >kh      > #`" є  M" >>>#(c8%!  &  ` &@` @ &   `   '`  (@`` `$`8   `   ؚ`8 ڀ ` "$ ऐ`">X $>kH /f * ' > "h`h  "`hH 0   > %&#/ X ` > > #8^  / X#W / X " ' ' ' ` `$"@ ' $ ' $ (`' (` "€  0@B   ? 0` 8' 8 @ <' < @' @ D' H' D P' P> ` L4  ' L   $  " 2 Ў ' L쀥 `' T' T% ` $   (@( ` $ '`   (@&``2%`ऀ    > #`ᩔ਀`?` ଐ &ଐ  @Ж   ऀ > # ሔ   `耢 `" '`&   *'`& '` i  (@f W`$@G`  ' ?&   $ "  "%   (``   L2  >>>#(`8# `$"@&`&```2``` (@`  L2 ` >>>#(`8#ߔ `$"@&`Ր&```2`'  '`  (@ " ऀ  > #     > #   ` U ऀ ( &>khऒ  ژऀ  > #`"˔਀  M">>>#(c8#}!ଐ &@ऀ > # ૔      > #   `7`0 `1@㿐 2( H & >kh      > #`" u  M" >>>#(c8#'!  &  H@* L8@8) ` @`$@'`"! ` 2 `$ `( `P 2 `8 2  "`8 " ( :`0  > #   㿐 '  & >kh       > #`"   M" >>>#(c8"!  &  H@* L8@8  ` @  ' (  2N `@2I `@ " ` *`8 7 ( `<&`<&`@&`<`<>  8  ` `$ ?D  `H 2` 2` `$`  @  2 `@" ` *`$ > #  r 㿐4g 6 b  2( H & >kh   ^   > #`" O  M" >>>#(c8"!  &  H@* L8@8   @ [ (   ($ D "  * $ > #    㿐 2( H & >kh      > #`"   M" >>>#(c8!!  &  H@* L8@8   @  (  (4 6 $ T > #  ާ   "  * $ > #  ޔ  map->flags & VM_MAP_PAGEABLEvm_map_upgrade: failed to upgrade lockuvm_map_pageable: stale map㿐  >>>#(` !))42+ H 2( H  & >kh   _   > #`" P  M" >>>#(c8!!  &  H@* L8@8  27  > #  " ,  @L (   $@:    |  x   " * H ( H "  $ H $7   * $ 2   > # ה  2  8 2 "  <  ( 2     @ $ H < `$ H $$ ( @"  (` (  (?$ H    $8 H 2  > #  ݄    ("  * H   &  '> 㘐 n   ( @  H 2  $+ < " B㘐 S > ' @ 瀊`&   @>  h?$ H " * H  H? $ H $ H $t 2 H 2- 㘐  #  瀊`& Ɛ 㘐     >א @ 瀊`&   uvm_map_pageable_all: stale map㿘  >>>#(` *2(`  & >kh   ט   > #`" Ȕ  M" >>>#(c8z!  & `!` D (@" `H "`` &`H`$`@2`H `& > #  ܘ հ `  & 2  D > #  ܆ ð  (@  `< " ``H 2``$` " `@ 2`<> Ȑ   2  H@ @(   > #  \   (@"& `<`"``H  `8 2`H `2` `( 2 `H` `$ ͏ `H &`H`@2`<   &  )> # (  D  (@`H 2`` `$`< "`F#  > @ 瀊`&   @>֐" `< "``H?&`H`@2`< D@" `< " ``H? &`H` &`H`$*`@2`< # Ҕ  瀊`&  # Ĕ  (flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: wierd flags㿐 ` 2  >>>#(``F+ 7> >Z# 㘐 {  H@* L8@8?  㘐 c ̰ ` `8 2`$  (`@"` " `㘐 H  `` *`8 ` @'`P@  `(>>>#(`+; o`m>k t "j` `$&@ "b` `LΒ V>  Q "9  4G> D> 0@> 0 ?>  , ;>  . 2   "3> >>>#(`+y" > >>>#(`+~# €@ > Ȁ 4 0 , > Ȑ?? $p> #>  쨥` `4&@`$@@#@         2` '`` @ c@㘐 ژ 㿐c @  (@" ` @*  `< 2 `$@ ` 㿘> Ѡ "@ 㿘 @p @ Ɛ`@? @?K & & "`  ఄ ఝ㿘 `  @@Sv@SC& @㿘 @W` 2`` 2(` $`>kh`  "``  > #`"``  M"`>>>#(c8Ŕ!` $`` `$`> # ` `H`L` 2(`@ $`>kh`  ``  > #`"`۔`  M"`>>>#(c8!` $``@`($`H$`L   `L2  >>>#(`8s  $"@$ i$   2 ` > # `١ 0 ) @RԐ@R& @㿐 ? @&  2(  & >kh      > #`" s  M" >>>#(c8%!  &    H L  @>> ѐ"-&fork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)㿘ऀ 2( $>khऒ  "ऀ  > #`"਀  M">>>#(c8Ŕ!ଐ $प(L H nĔ (D8`" ` >Ɛ!0 2D>!h " 4 2`   +  >X $>kH /f * ' > "h`h``"`hH 0 ` > #,`X ` > > #8  ,`X# ,`Xnb X P  $ H>  ` $ L" 2 1  (`"  ` " €   ( @ & $` @ $`"``" `   L2  >>>#(`8! `$"@$`$` $ꌒ    L2  >>>#(`8   $"@$ $   2 `    L2  >>>#(`8  $"@$ $   2  >X $>kH /f * ' > "h`h``"`hH 0 ` > Ғ#,`X ` > > #8   ,`X# ,`Xm X`P  > ` ``$`L" 2 ~ `(`" `8` "`8€ `8$`H $`8  @ & $` @ ( $`"``" `   L2  >>>#(`8j `$"@$`$` $Ւ    L2  >>>#(`8R  $"@$ H$   2 `"P    L2  >>>#(`83  $"@$ )$   2 P "H  H    ȭ H  P "-ɛ( "@8  @ " 8>  D<  $8 $8 @  > `D`<`$ ` 228& ऀ > #  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘> !8@rw  2>k> @">k x> Ҕa2  : @ 㿘> !` J`1   2 ` a 8`` 8```2J`1  >k |@o("@*` o 4 $@``=#'`` ` >"$*` > ǐ @ 0> Ȑ !T>`#|lĘ h> Ƞ  X'n \ \ ` _T Q*$ X@k d$ LK > Ƞ  \'Q ? X `  _7 4*$ \@j d$ P. > Ƞ  `'4 " X \  _ *$ `@jߒ d$ T >k x8 -  ` ,  H l 㿘 @k 0> !8> ,20J1`+>#*` >k  >k  6  x :  6  x :  "  6 6 2,> Ȓ``& ,`` `l"  & `l` & ` `" & `& (& & & & $ <   diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map N N/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)㿐> Ȗ @  `` *  8 2   ڜ ` ;> > 0`c '  &`( "  >>>#Ȓ``є : $>>>#Ȓ``Ɣ  `(@"j ` d `$@8`8 ""`(`(  8 >>>#Ȓ``  $ 2`(;jP >   0,`P    Ly$  @ ` `0$ @ C  @ 2 j!>   ؤ`(  'c *}8c  ԓ` `` @ ` ``' ?   7> Ȑ  @8 @ d  #  '>@@    В  *'o 2`0  $`0T`  `(`<` D   `@   `0`,?`$`0Ԑ`0: `< 2   2`  ? `   X`   @ϒ T @   0K =` B     2 "  Ę *  : b 2@ ( #\;` d #h@ `'` `0`,?`$`0Z`0㿐`@`` `  "`>  @ @$ *@`/ "  )> >T 0 # u D# $ "@ e "  `  `Ŕ@㿐>  @`   F$ X>@?8S   2( & >kh   6   > #`" '  M" >>>#Ȓcؖ ٔ!  &    > #    쫖 > #     틒  㿘>  @` @  `   #@  @  Ș     㿘>  @` @   ` #@   S@   0   㿘>  @` @   ` #@  8 > D*   @    @    @    㿘> Ș  @`   $ *  @:   2 H (  #!2  "      㿘>  @`   $ * @:  !2 "      㿘@`"  !2 2   2d  2 #㿘  %  㿐\ `ܰ /> Ȑ  :  2Ұ 2ΰ `2@@ *  &@@ ð 1@ᇔ@@`??@ ?`< `?@6`' # @#Ɛ ` ?̍   `? `?|  ``< } { 2/ / `-  #`#\o ] 2 ^ 2(  % >kh   ~   > #`" o  M" >>>#Ȓcؖ !!  %  "`` 6`H   > #  K  @@@ Θ  " @۔@0> #  3   `@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapH&(H> Ț > hX3@P( H (    2  2  $ 2 H `,2E`,`.@"`` > |`@ `.? > 2`. `.!0 @2 ``>  "`` > `@ `.? > 2`. > Ȇ  `,2`, ,(2 ,> "x"  > Ȇ  .2 . /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_page_i.hpg->wire_count == 0㿘 . " .`"  "`> ""| "@ .?# > 6 .``?"` .`6 ,  `0>>>!`8ٔ ր "> > &"&" &  "@"  .> Ȑ 6 .``>  "`€ (  > "d@ ? (# @6 (`.!0 @2 ``>  "`` > `@ `.? > 2`. `,!`.@"`` > |`@ > 2`. > "@x"` 㿘 (?#> Ӓ @ 4€6 (㿘`(?# @> #86`( 4€`4lcv != -1㿘> >k 4  2@2: > ӗ*`" @   @ `2: 2? > >>>Ð!`(!;"ؓ*`  /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_page.c(pg->flags & PG_TABLED) == 0pg->flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_init㿘  > "h, ,`@@  " "``$ >  "bx" >  "b" >  "b" > > " h# T# P# ,# X"h" > >k``"">! @  > ӓ,`"   ``" @ > Ȑ` 5>k` * @l`8-`$, @@de  @I>  3> Ӛbؐ`@"( `>Ò$ߐ!>!, "> Ȓ"@*`Ȑ ` "(  !%@ bؚ@1> Ȑ" 4  5@  8   @`# @a  8`@ > #`> Ȕ> @*@&d!> >k*@'" "P  0$"     "(","`"\"T 4$` "X"Luvm_setpagesize: page size not a power of two㿘>  쀢  #   "> ! ` "  ` * "uvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memory㿐+> Ȧ`)>k `.!> #> #`@$cd #`% cd8  @ $#`$cd> > #d`">Đ">Ð!*@ "`@ 2> >!  ` uvm_page_physget: called _after_ bootstrapvum_page_physget: out of memory!uvm_page_physget: out of memory!㿘#>k`?, + > " %> >y#(ؐ` f ` @ @.` `  @)>  `*@& @   ` #@ ` 2?>T#X$`v +  , ؒ   c: ` m ` 2/?` )>  * &?@ @ O#` 2?>"#$`D +  , ؒ   c ` ; ?`?,4 + %> Ӛ؄``  &>  `*& @   #@ ` 2?># $` , ؒ   bӔ `  ?Ҕ 㿘 I     uvm_page_physload: page size not set!uvm_page_physload: bad free list %d uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_init㿘>  쀢  >j">Ő"d >k>_# >#(>Ř #h  >#0W > Ӑؐ  2>kؐ , >k `?  >-#  > ؀ +>kؓ, +>k-> `,؀@, ?, ؒ  ?a $@$`$` $` ?$`$`` $` %`@uvm_page_physrehash: WARNING: could not grow page hash table 㿘>k   > Ӑ"ؔ +   "   '> ,  &, '> h T+>  P, ` ->k,`  8 `֒  >!0c   "" ` H /f * ' h?" X" P`:" T0` "` $  "@ `$h`2 X  P* @` `2 X  P*  "`$2@  X  P * @"`2 H 0> #h`Ŕrehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d 㿈'>k> h  $>> Ӓbؕ,` ``    @    ;`  >Ǡ  ЖF#\> >? ><!> ">7!Hobj == NULL || anon == NULLoff == trunc_page(off)free_list >= 0 && free_list < VM_NFREELISTuvm_pagealloc_strat: bad strat %d㿘\`   3> >>>ǐ!aH #3> Ƞ` 8  :   >>>ǐ!ah z#  <@ >  @@  D   > `"   ` ``  8` ```,4`(`( > #> "@> #@     ` 3`2> > "h*@+`@ *@+ @ %@> 0 > >>>ǐ!a #ɒ"h+`  +    ` ̀`>ǐ" ` "`" "@``?"` (! `$?"`$ (! ` "``  "`" * I > 6 (6 *& & & 96 .`5` >  $bh2 `X@ `P* @H /f * ' &  & ""H 0 &   ` & ` " "  (  6 (` "`6 . ? (# @` 6 (> "П@ 40͐ 㿘 N` (  > >>>Ð!ah q  >  $bh2 `X `P* @H / * '   " "`  "@H 0  `"  "` "`   "@ (?#  @6 (?" *&  6 *`F *>  ( 6 *` & >>>Ð!aH  >  >  $bh2 `X@ `P* @H /f * ' & ` & `"&`H 0 &   ` & ` " "  (  6 (` "`saved_loan_count == 0㿘 (`W 0 ?# @6 ( (  > >>>Ð!ah ̔  >  $h2@  X P* @H / * '   " "`  "@H 0  `"  "` "`   "@ (?#  @6 ( ?" *&  6 *0 " . .`?# @6 .|&  "  .>>>ɐ!a r$ " .`"  "`> ""| "@ .?# > 6 .``?"` . ! 0  `2   >  ""`"  "`> "" "@ .?# > 6 .``?"` , > Ȓ`6 ,` ?"`  (?" @d6 (&ې> bh*  & *  "@* "  > 6 .```$ "`>k $ 4K㿘 @),` ""` ( " ( ( ?   ? `$€  `c  4 (`# 4 (`@ۑ,`㿘 %> Ȓ``$ 6> > h  h*h@ @ 2> "" 02` "`$` "@ "> "П@ 4 (!4 (` $`" $` `$`$  $`"$"> "H diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pager_i.hrvpg != NULL㿐> #$>    > >>>ː#`c0 3 A >k` `2 2`@: > ӕ*"    #  2`@: `2`? > Ӓbؗ*`*" @ * @  >>>ː#`c8  C㿐#>k!> "`` #\@ ϖ > "a> > "```" K@> > "cp"t?$?"  >k,      >kemergva/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pager.cnpages <= MAXBSIZE >> PAGE_SHIFTpager_mappppp->flags & PG_BUSY㿈  )> Ȥ #> .@ #`a'#\ ?ܪ? 3> #> b> t > >> #p@#p@:  "t@'>>>ː#`bH e > 6  "` >> aؔ "朖 )> Ȁ &   >>>ː#`bH F  (  > >>>ː#`bH : aؒ! 4@ 젤޲@㿐'> Ȑ > cpcp.@ > "#t C'#> a 2(a $ >kh   P   > #`" A  M" >>>ʐ#`cp!  $ aؒז> ` a"` a` > # `  .@ >  @+@  ৒ 㿈 'X   X`@ 4 ? @?耢4 ?`(?+> `쒢@@e/b :  2  @ ( & q&`@@eb*`&   & `  < CB(U "N`. 2`( "G`( 2`( 2`(> "d@ ?`(# @7`(`( 7`(`( ` +> #`7`(€ 2?&* &@ &D 4  耢4㿈'XX```` ;`#\`  &'@ &  ` ``@q  2 N L `E@H 0> `9@<!` `  `. > ` "  `@dH`  ה ` `@ `@ `  '@&@ !uobj || obj_is_alive㿘 d @[Y 2@. !"@ "  >  @d   @`( "@] @(` '?. ?# @2(> # €@@7 ( `$€  >>>͐#`bH;"# @ 2(> !@@> #@@@`( 2`(`㿘>ΐ!l& X& > "  &  "@"  ?ԁswap || pg->uobject == uobj!write || (pgs[i]->flags & PG_FAKE) == 0㿘)> Ȑ   8: ,2  2 *  0#h` 4`" 0  0 2 ` `     H,@,$  H S  `. 0@ "``` `>>>ΐ#`bH #@ ````( +2`(" ( @" >>>ΐ#`bH@#R( @2> ـ`` > !@ > #@?(c 2(( 2( zH /d`* %`   0  >  \ "> |/> ѐ#~H 0 $>τX*          <$ "h> # <@>J!x>X!P: ϐ 8> Ȑ  @"H 0㿘> Ȣ ` @W `: $`< : @ $`< `, @$`<$`<`< @W, $`@ $`@` @W $`Hpgdaemon㿘> #> ""H o@>  > ">ϔ "ɖ %> Ƞ! `$! @"    @Wo @$ D `$ D  @@ D  @, `2> N> aiodoned㿘H o$*@e%> ؀  >ДԒ" {؀ $$`H 0%> Ȑ쀣   0  8``:@ " #` X@  > Ȓ `,@ H> "M0`0/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep>  @: * 7  2 * #p#p'  ' `  ` !> Ƞ   @ *`  `` `' `%> Ƞ! > ɐ $! @b@'耢 "`.ː!, $!,`2``2+`(`  >>>А aXa!2`(`0  ?>>>А aXS!`$`04`.`( a0 ^"a0a$  "a$  !0 S$!0!( $!(`( %!> `. 0 > Ȓ``p "`p> # €E> Ȓ`a  5"a 21% >>>А aX"! @ * @4"hp $ `.>>>А aX"C `0   H`   h l  `0>>>А aX"V  2`(`" `.` "`.@ " `" `.    @`d` `  `(> `.` 04`(@ € !> Ȓ ` 7"` " `  `@  % @`@` А`-  @: '@ ]  2 `(?# @4`(- &@ % >  @`` @ `&''  "@@ @> ȑ7 '' > Ȥ 4 $4   ;`   #\@  `8 `$8$`. "WU@T'G 2`(>Q"@ "`(,`(?# @` 4`( % > # €@'; & `$€ @  '耤 > ]> !@ > !@> #@`( 4`( '耢   . `'耤`I `G`p->uanon != NULL㿘%> Ȣa $a``@6aa ]$aa  a`d > "`> " > Ȓa  > `d > "> Ȕ  "@D "@lh@ > p > 쀤 "" > k"x g .`2   2  (   >>>Ґ aXz$2 ( 0  ?>>>А aXl$`$ 04 . ( 2?`- .    "  .@  ?"  (c 4 ( . >  @^    m  @  (?# @4 (> # €-> Ȓ`a< "a< 4 (`4 (diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0㿐 ?>>>Ӑ apɔ f !> >>>Ӑ ap g 쀦 ` * @\WB  8  ( , @ ʬ )> Ȑ !>k  4` 2`@: > ӗ*" @   @#@   2`@: `2`?Z    `32`@: > ӗ*"     G2`@: `2`? 2 @\> Ӥbؑ, `)@*" * @ . " *`" * @@  4?  `@ '*`" * @ . {à @='*`$ , @Ð (2 @    $ * *`@ > "h @"` "@> Ȓ `?"` (!" *`$?"`$ *  6 (6 *6 .& & &`& `"'` @' > Ȕ @<@ > @@ D > ߻"(m->pqflags & (PQ_ACTIVE|PQ_INACTIVE)) == 0㿘 = .  " >>>Ԑ app! ` "`&  "@ 4 .$F> bh*  >$ *  8"@* " > Ȓ```$ "`>k $`4 2 .촐diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vnd㿐> "#|> "aP> >Ր#Ȓ   > #Ĕ#> 쀢` ""> 2"mn ">> > !#\ \ X > "cx>!> >Ր"8a0#\    > >Ր#0a8#\ x   @b㿘> |  "4 "$ $  $  $   "` " $ || $ | "`"|$  \&  &$D &$H @2 $ "$D$ > Ȓ``d "`d> |) "! $@ 2$D`$D@ $H "dH$H@  $D"dD> Ȇd d  2$@ 2 㿘> #|@  "$  "@ [ \ 2swapdrum_add㿀> #x    #`#d#\   ">1 &$,&$(> | " $( &$D$,@ $D 2$( 2 minirootswapctl: miniroot copy failedswapctl: copystrH`-> ɐ  @  > !P  &25`> #| `,```#  $  :> @[* 2`  $ P $ `$P$ $Dd` `2`&հ a2Ș А``2@> # l ° @ * >֐!$O " @>!    $Oq 2  D'''''fi @    ( 0 2 < " > 5 ~"a` \  Ȓ   y h0Q` `  \ $̠ \ ݐ  @P$̐ $ $$@< 2? $< `?$$ȒH \  $$$$$O6 ">!@^ % v< 2$$$  \ \0d 2     @0 l}  swap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap 0+> d@c @@f  <  2 4  > ,* "@p*` `" @?) @ cX+ 3`    ` D cX>  L&dLc(8   &dP&dP< * -> ț2&`@ @P* <  ?   `>k_ `d4 "`>הP  #\ ? \ 듚  &d0   "c>'"`c(> "x X D  R:` *  * :@ $d0>"xȖ  >>"X"Ȣ$@>א"SkXV`> Ȑ ? &``&d`h  "`hc@ /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_swap.csdp->swd_npginuse == sdp->swd_npgbadswap_off: swapdev not in list 㿘`d( d,&`Β 2 `d(d,ܒ "d `  ?&`d$@" d@>>>ؐ @bH~$m < Ǝdkd@> d@#  @] "d> Ȑ  h d" " hd@ >t" > d( d,#x6d0t \㿘>>   㿘>>    swstrategy: vnode type 0x%x㿘 T: 2* @ > Ȥ @X*     2 d( 0 (& 0& 4X 00$ @Y< d@* <2`    >ِ H /d * % s& TH 0`0@ sw_reg_strategy: swap to sparse file㿈H /d * % 9> "8! H 0 % % % %% `<>2`*   `H*` `&`@$L$@: '@OO v씒 ?>!"$LH /d * % % < @N `Q"4H /d * % 7> Ȑ0Œ H 0`0 @$ 0$ <$ 8$ 4$ H=  $ T`,>!P"Ȓc!$ ,$ X$ $ \$ p`d 2`<$ `$ d``""@$ ``<`d""@@8$ d`l 2`<$ h$ l`h""@$ h`<`l""@@8$ l T$ t$ @H /d4 * %  !   % r:$T"@<H 0 >D@TH /d   0  * %   ?`%  `""8`0&`4(&`0"8VԐH 0㿘  ! $$P&  &$x&$0@\`t "`t2 $$P6 $x2$  ?& vnx->vx_pending == 0㿘 t H /d * %  < @`@"@ " $`@ ?$  4 2$  \ > qԐ> Ȑ#0  "`@`0($`0 $`4  2' 2#> "8Vc 2 "  >>>ڐ @bHW& 2 > "8pVIz$H 0㿀'> Ȑ d $] > #|`"P``"G`   "?$D$ $ 48$D$0   #`#d #\   2)$D$D`@ $H$`"dH$H@ $D"dD$$D`$$H` 2`$`"$D$`$  $$ l "l$($`2 ` `2` ` & 㿘ɐ$$@"$$uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost 㿘?9> Ȣ `d  >>>ې @bH&2 $ >>>ې @bH &6 $(>>>ې @bH0&$0&   >ې"P$ "$$ `l"$`l㿘@?@1 flags & PGO_SYNCIO㿘> Ƞ  t'D  $ t>>>ې @bHV&2 p  ?$ pD@    p $ p㿘)> Ȕ 66>`@VD` `* 2` @?@    " H /d * %   > > b# ` +> hcH 0`   `> !P !&`0&`,&`&`T&`H&`pH /d * % 7> Đp&`\H 0 `.&`8&`<&``.&`dH /d * %  t`" tH 0> #> b`02`@ @@>ΐ &`0&`X!, Tf`02` `rH /d4`\* %`\  oܐ` c`\ "cnOcH 0swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystr㿐> 5!>ɐ#0JeՒ  \>#0A $̢ \  $̒ @K% $`$d@ {$@  \ $d $d>d#Ih !> >@##  fd@d> \; \0# diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapsbrk: %s %ld failed, return = %d growshrink㿈#> Ȑ`   @   Ж*  "E'`$@8@   đ*   * '4 `##` #\?͚? 2>  ē6@   @  >  ē4@ "  $ Ā`!>!>ݒ!`&   㿘 Ԁ@> &  `>ȑ, "@: ` "2 "  :0 B ; @S 4  @  $Ȱ  uvm_coredump: user process with submap?p`  ( ( D Z8 "<>O  L= #G$>@ 8 Ԁ > Ȕȑ* "* 5  ( #* @#@ aH ''' #\#`#d#h#lϚ  @ D #`#\#d#h#l   @ D &28diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvm_deallocate with null map㿘 >ʐ"` >  @ 8 Æ@  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapuvnsync㿘> "#> > >"c `  / uvn_attach: blocked at 0x%p flags 0x%x uvn_attach0   >ސ#ƒ  & >ޔА" ӑ > < 2  > , bp*" * `@ "  " <  `d ` q&  "m>  & ( ("`,"& , "_&  `!&  > , bp*" * ` @>   `h@  @ (  @N!   > #@ "  >k  "& ڐ& &  & &  & &    & & > `& >  & ( ("`,"& , "& d5 Գ " uvn_deref: vnode VM object still has pages afer syncio/free flush㿘 ? <&  @  ?` & @    @ dǐ0+`&     @      & ""   (`" , ,"`, , ("@  " >" & ^duvn_termuvm_vnp_terminate: io sync wanted bit set㿘  <  ?&  `H&     @Ě    & >ߔ " x  2     & ><#" &  (`" , ,"`, , ("@&   uvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0㿘 (  >! > # €`&@ `"&   " >!H  b"   (`" , ,"`, , ("@  " >А! "$ ӫ$  uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flush`> Ȓ `@:* '2  2 * #p '  '`'"'`  8 ;    ;`D    ; @Pd2`*  *` '2 @ ` `H   B "'  = ܀`2 ( 4   $ 4  (2   $(  (?# @4 (   [ ? (# @4 (>   @ :E " = F'܀`` 4<   $ 4`22  $ `, >   @ :E ` (   ) ` & #' `"  ( . > # € (  > "d@ ? (# @4 ( (`2`  4 (25 (    ``֔`? , @2ڠ> # €tѠ`"Π (  4 (> # €烐> c 4 ( € *7;`2'#\'6` ```"`>["`   ֑*` *2 @2   vz  .@q  **2 @2   ``R```Q` ``( "`(`(?# @  4`( ;i  `4`(> #@`? , @)> # €ɐ ````(  4`(" >  > '">$#('> # €ː`    4   "   & >` " ͘   ! >y   >& uvn_cluster: offset out of range㿘> @4 > $@>x#x@@  B > ? 8  @  ; F;`  @    8   @ ; ;`F  ?㿘@ uvn_getpageuvn_get㿈d @5    '  @?^ '`( !   >  2`(&@>   :@ D ޲` 'u s   l  @ 2]> Ȁ W 0( `!  `2(> " @`2(&@@  '#\   '> @@ '> Ȑ  @2 `( Е ? (c 2 (0?(# @2(> #@&@>   :@ D ` uvn_iosyncp@6   '> !&  " Τ   4 2  $ @? 答 2 2 {  & 睒7> Ȑ 'г.@ D 4 $2  $( " %>  ?''쀊`@'''''  }K! 8  `~G  `~S   @  耦`&@` Fw@ 쀧  `. "@C 筒 ?  & `Ő `  㿘   "   `& _/ !> # & v #|`  㿘   4  2>  $( >     > 㿘'> %> 㘐 ” #> c" $c> # #> "  X2 (  2 (   ^ސ  $ cc $ 0 0"`$c ( 〦 > # $㘐    Қ 1   " (`" , ,"`, , ("@  =$  0 㘐 n rd%d: fixed, %d blocks 㿘 >k >k` >&@&`&`  NULL pointer passed to ip_ecn_ingress㿘` >! " @ @ .@NULL pointer passed to ip_ecn_egress㿘`?>!   @  .diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapiommu%s at %s㿘`> " 㿘>X   `@G `? unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB name@`> Ѫ"#쀢` >Đ# 0` `40@Q &`0>c0@&`D> "&`D`D> %> " X>cH@^`0&`4@ 2 *@&`8 <* '' @#\#` ?N  >>k `@ >/#X 4 &`@>  4  ` @>`<  -> `T    Т@-> @J%`@* @ `8@J* ?$`0Ds: ? 0$ І$`@ :`@>`< 2?`T  ?&`<&`8 H `0" `0*` ?  "6 `0 <"``0" H 0 `0>@#`82`4 `23 a4  >@F~b 2'a4 ''@붐c@뗐@ >' @몐>> Ȅ > X2@> 쀢*```< "0@( 0 0 > р`<> "0@( 0 0 4@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKobiovmelvmesvme㿘>X    `@E `?%s at %s addr %p vec 0x%x㿘  >!X& ">> S!h> 4O!x>X   >D! 㿘`> ;!h  p h ` Pinterruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsP!>X  ` 4>>">m d@5  ` >>"x0"a4  >@Ec` 2'a4 ''`>"@s $`@H &`<   &`8>"o@8`@'>8N %8@T >"V@某  @)Z >'і N `4>b@68@E 2@t >@Db耢 2> ,b "b@)$ >'ԛ @- >vmesattach: can't allocate intrhand㿘` >>X  >> a@I  >>?"x0<"1> # >$   &#>א!@@2$>ә @avmelattach: can't allocate intrhand㿘` >>X  >> a@Ip  >>"x0"1> # >$ C  &#>원"@?$>] @%vme: PROM ranges too large: %d: version 0x%x P>X  ` $`>̐"x0R0`4 @Z &`0`@< @T >b&`4@W $`0@Gx &`<   &`8>#S@`0> >"#흒 `a4  >@Da 2'a4 ''>!!>"' 'ӹ>!''Ӱ vmebus: no ranges㿘 < 2`4>!@? ? -   ="@ <  8 2    * *  2  &`0P2` >X  2` ` @r> ><2} > <@@"t ` >X `''`' $> !ȓ. '䀢  ?@>  @  ` '`'?'` '8`"' > @Cga  >8@C^a  2'>8@CU` 2'8 ''@'   "'耢`">@Ð'>=ᔰ 㿘i 㿘a 㿘Y vme: spurious interruptvme: spurious interrupt 㿘> . !>X`*  ` 8@ `>> ! 4  Ȁ> >f  #*@  `" @   2vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirq㿘> #`?>א!2. >Ґ"@ 2"@  2 & > 3!.`   > @  2  T  2>꬐"8@> > &@& 㿘>X  '>  쀢" ?`  * 3@ ҂`6  @2  ?*@ >  @ ? # @\ 㿘>  ?@>  @ ; auxreg㿘> "( N> 3!l (Ho o>X  > ?8` **H 0 01> "?8`**"> "?8`**"Ho o>X  > ?8` **H 0 > ">XaP?(2 > "Χ auxiliary-ioauxioauxregmatch㿘>X  "   >0>0 >!>!@A`?! 㿘0?8 @Ȗ >X  ?8 >   >  > *b"(>!"0> >"`8G > 3!l ] no aux register㿘> b( >鯐"ؕH > ⬐*b(**@H 0 > "diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKoclockeepromclocktimer㿘>X   > ? > "t@A;   <  8@  delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d 㿘 > ""T   @$0> ٘ ` > *`* @ *#b@ @ > ""l= #> $c5>  *   *`   ?#  `* > #>쀢` X> p> W 0 c` >`$cM 㿘>X   V` > ? > "@@   ; 8@  㿘>("h  0@%> > "b"㿘>X  2> ? > "@@ "   ;[ 8@ >@@#؀`?mk48t02modelno prop: %s (eeprom) mk48t08㿘%>X` >#0  >@兒c8 2>>肐#@Ր#H>@@PcX  0 @^#> !>  b  b&  0 @G(> ʹb>     > > ِ? ``> >  "b" > *  *`  *  > #"l"`<counter-timercounter㿘>X   > ? >@?#耢   :’ 8@  > " >!@?`?delay calibration delay constant %d 㿐!>X    ?* *   @Ζ ?   @ɐ0? ?> > "a""    ?0 @ ?   > !> " X$# $#'$@= d@6>結!#> @: @d&#> #>!؁㿘Ho o  > c    "c c?"c`?H 0 >  >  < > " >    > <>Xg> ْ` `* `*  `*  `*  `*  `* oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz 㿘> "T !!>X!P`d>膐 @ d> "bВ d$!P@9 "@!> >X"aT" *; " *`; " i*`%>XP"@@?  >` p d$P d@8>X"aT#> at atP$atat@? " at> G d$atat> ""@8͐3 : >  dbP  bP:  "bP!>X   >X!T> !*` > !"+ "   >X!T?`*`  "* " bP> ґ:  #`"0;   ; 㿐Ho o> "T  > " ` ';; 0>X ``> !'`? 'H 0> # @   >X   : 0:Ր  oldclk statintr㿐> "T !>X>^    > !>  X '  > ! ""  "`0" ? '> "P;? >  0    > !* "@  * ?"`  ;Zx0N㿘:(;`; :9 8` / /`+* *`(@ ( `.  .` . .`D @E ` ` 43   F,   2!m!n   >,(P ?`4 * (*&@ (.`& +  . (( 㿘> !8Ta@7 @>V @7* @>M &  E& &    `?  >,!,R  4  6>a,* R@$`& & 4& Ta@>@7R.& @>.@7J <& @>  <&@7A * @> & @78*  @=&  @7/*  @= &  @7%* @=  &  @7* @=ے  &  @7* @=В & WARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! 㿘>  <Y`?!  >B!0 ư!@ > "T @> ;   `@- `-,> "a8!> !8  >!`$!8`$>@& >!8, "!8>@!>!>!Ta@6 >!x> "T  > a8 -> " )a8@2> !8 !>  < Ԑ  ' `,',',',',',',',' ' `,'㿈@@㿈@D'@#> H> ✄ (  *@`@ ✄ (H > H> ✄ (  @`*@ ✄ (H 㿘!T!@5!@<@5..`@<.@5ے <.` <@<.` @< .`'2>>!l!m`P.`>  "c > c        & c "  .`.` `; `7  3'  2!m!n2 8     ? >   ?@* (@*   (*   ("@㿘> "T 9Z0=H > !8!8& & H 0 > 㔀@   > 4> cL㔘&cL`"? & ?/! && > "c c"`㿘>X   =  e9 %"8@p .1> "    % `  " , `d"d   @  @]㿘#> b` 5 , !> " #@B  @N* :  .@>X!P@4 2b> ؒ  @N* :  ۴` "  㿘#> b  !>  $">ؐ! Ԙ $" 2!>  $b㿘> > "`"""s power㿘>X   >@:Z#`? 㿘  0@d > "a>  >*Ȑ#㿘> J# "> ! @ *@8_"@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKsun4cpu㿘`@: `?midsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s  &`0>`@%  &`LX:   @2`H &`H`H  >4 0>4!x>X   0 > > > "c@`H>` a0`@@S>  , " `4`8`<@a`4!>`h@k!Q>!> >> a  t@E> ْ!J! ">>!(> !0` "`H@k`H >4!xH/ /aD@H 0㾐'p5p:   &!> Ӑ "`,%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) 㿘>c> #┒  "> `#>#В←  $ > ,#}: >  <0> D r: (>   > ` c d:` > >` Pc l :` > >   s   hK >  T> \ : @`>; Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %d㿘> D"8 8 < @  ""`l0= . 08" >&"`D"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!> ٠ `0.  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& mmu-npmgmmu-nctxclock-frequency㿘@>`@8 & h& d>`Д @1& \>`@+ & vac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-type㿘`? >aP@@$`& >a`@ >ap@ >a$`@ $` `  * & + "@>Ԑ! * $`l$`>$`a$`@Ԕ ! &!cache chip bug - trap page uncached㿘!  >X 0 @ > >!.bcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache 㿘` >c(@ސ& >c8@E  2&  & >#@& @͒ y%>@ǒP t> o@* & 4> c`@$& ,`  ` * ` * `"& 0>#x& 0> @c 4& 84o4m 8& $P@ & L> c@& D`  ` * ` * `"& H>#Ғ& H> @גc& P L4@4> P 0& < H 8  ,&  D@ 8  $& 1 >c@ۻ & > `@۵& `  ` * ` * `"& >!ޒ& > @ۗ` 43&> (@ 0@ۅ & d> `8@& \`  ` * ` * `"& `> P\& `> @a`h& h d3ʐ3 h& T >ߟ 㿘@x Ā( Ơ㿘@i@ [viking: PCR_TC is off]㿘 ւ>!  @ & T&!>j!  T &!>ڐ!a&!H&!\ T   & [viking: turn on PCR_TC]㿘 > T  #@2 >B!@, 㿘 &   Ң @㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@&!X&ƀƠUnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUs㿘 H ?>H` >`0@P?`4 ` >`H@D?>X<  >X  ? ` >`X@0?`4 ` >?`h@$'> < # !?`0@?>> 8`H@ ?>> <`X@?>?`h@> ")>X @2  ?2  ?2  ?2   ?2 & 8& <& @& D ` 4 2 \ & 4 \ 2   & \ 2!  & ! 2   &!  ` €`"!0 2!0  > @ٟ & @q@ٗ & !0 2!,  &!0!, 2!D  &!,!D 2!4  &!D!4 2!8  &!4!8 2!H  $&!8!H 2!L  (&!H!L 2!P  ,&!L!P 2!T  0&!P!T 2!X  4&!T!X 2!\  8&!X!\ 2!`  <&!\!` 2!d  @&!`!d 2!t  D&!d!t   H&!tB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%x㿘> !D`!D` 2``?2`` 2` `@ 2`>aR㿘> c  "cHo o  > b@``@."`` H 0memregmemory-error㿘>X  2    ` >#0@3d`?memregattach 㿘>X   > ! 2"`>x#``2 > ɒ 0 @Y > "!>ܿ#%ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory error㿘> ( > P> X>`i >> b> !`>>@ X>!(memory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory error㿘>$!>>!>>"(@`>ڸ"hHyperSPARC async cache memory failure at phys 0x%x%x 㿐>!8€` `>"2`> c<> c@  > ?> "D#c<"@store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. 㿘 + #`!>ۧ > cD "cD>#ۜ> D + > c< "D"c<Ђ$ Т@ a 㿐>!8€ ''Ndiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKzs㿘.3>X` / ` " /  㿘.3>X` / .` /ڐ slave㿘` @1 2, >X  2  > >X  >  >bX@Ŕ?V`@ @=        ,S& 48@ zsattach: expected 1 interrupt, got %d pri %d, softpri %d broken zs interrupt schemeintr㿘`> - #@$@ 2 !0 "!0>o#8>#Hڿ0 >#hڸ > 㠀 > > > ct"@]"> c@Y  >#">>I#`4*c> P``L&`L&`0&h&&l"P- @T& &@&@ 9?c @ *`l `>> #(#`l#`#`Ѐ`&@##`>> bp#`@)#` .7 @> ߐ > #@> "#&`*`   &d>#8h`& @ &@&@ ?c @ *`l `>> #(#`l#`#`Ѐ`&#$#`>>bp#` @p#` @>  > #@> "#&`*` S  &d>ث#8zsconsole㿘`>؟# > >`#*> 퀢`"#@ &> `"`">#>a"c4> "#>"h&> "#㿘> # H /k * ,   ._  >X> ` ` J`<  `<, * # > # > > # > 2 n`2 n1 ?c* @ ` *`  $ l>#($ @#$ $ $ 3`> $ ̐` a> 耤  `>!@  .8.:㿘 ޒ *  @)㿘 @, (& p㿘* & p㿘? 2  > c`  :6 c`*@ * @*`@*``L L`: "` H /e4 p* & p # }   #c %$ $ $ $ `@$ $  @Ӑ p $ p ?$ p$    `H 0  `` p   H 0 ,`=`k `u `= qH 0  "$ p `= 2 @( `>X ` `-  `2 pL`6 "  p $ p  @2 `= p >b `= <>b !Ę   `=    " `= p  @  p }$ p2,`= p =$ pH 00$ `= 2 p  @ p  H 0   h>baȑ* @€ @ 㿘?2   * > c`* .   @*  L@ >b h!ȓ*`  €H /e * &  @ p "  @ >X!P>b    " pH /k * ,  )   . )  z. H 0 p ?$ p. =H 0 㿘?2   *>  c`.  * @ *   \>b haȕ*`@ 㿘?2   *>  c`.  * @ *   \>b haȕ*` @ ? 0  > *`` *  ( (\㿘>  P q  `   2`8. ` \  @s  d* "@ ` @  d* "@ ` @  d* "@ `$ \.` p` Ā  h@E  ̑* "@ `  h@  ̑* "@ ` @ h  ̑* "@ `$ Ā`" h  `@ "`@ h 2 ```>X   * `) `? 㿘#>X`` "L7+l L7 > c *cJc  *c ,  M  L  @ , ,  M 0.@`. `+?  8.@` ". +7 .   0.@`  8+,  8.@`  +$  㿘N < D  <.`. <1>X  " 8+  8.@' `2 H (.@1>X   8+  8.@   *  & D !>X.`  `& H*  8.@   *  㿘#>X`@  *ؐ  .@`  8*А  8.@`  *Ȑ  @       . Β     ߔ. Ò  ", N 8 ` 2  0 * @ ` @ 0,  stopping on keyboard abort 㿘>ܐ#@Ұzs%d%c: %s overrun 㿘> @8@ 8> &@c> aԋ ringfifozs%d%c: bad ZRING_TYPE (0x%x) 㿘>  Pȸ `X\@>b haȑ* $    > ƒP$@,$X @d* @ ` 0`  > x> <`` >(T`@<`@`@Ґx2`@ΐr€m 4 "> pH /k * , 5>X `) ` ' ,'$&ٔ @H 0L`,4 p!2 pH$D @. ` u$H)Ð 0q p `% p % pH H P" `@ 5<`@  4` `€ 2 ,5@,5`0a Ӻ=` @B$X2=`㿘?2   * > c`* .   @*  L@ >b h!ȓ*`  @ 6 q & ]@ "jN 6`y@`x@ `z@<`{@  k@ "  j@ߐ\@"S  l@Аm@" H /k * ,  )  . )  /. H 0ư H /k * ,  )   . )  . H 0  #@ 2  2&!2 "    H /k* , N :  3  # ` . 6. 3  . #ϒ  3. 6 #`. 3 . #     $   3 #    . 3. # '    . '  .  @  3 # ߖ   . 3. # '   ߖ . '  .  @*@$ H 0" @h  @d  @  ) `` `   `2@` 2 & 㿘 l? @2  `@ `* > `* *` ` *  L@H /e4 p* & pM V  H 4  H & p H#  H+ H /k`* ,`  p  & p % P , %  , >X *`  '  $ D $ H %   , %  , H 0H 0l?0*` > #`(( (LH+4p(p Dp"pH 㿘 l? @2  `@ `* > `* *` ` * `( L @`$ 2  ,@ | @#b, ? 4`s @#Y& & & H /k * , <  c,`1,`%,`0"   "  @     @  `@@ ` 2 >X  ",`'': ,`'?,`)d D L@" @2  `4  P  ,`(,`-,`/,`2,`3 ,`.` p  `D,`4$`L $`D``$$ `@?H 0 㿘` ? ?}H /k * ,  ) 4 `. )  p   D. 4& L & D     . H 0㿘 0.!>X  &Ő     &     &    "`& `Ē `  `  `  ` `  `  `  `  ` ` ` ` 㿘 ?2H /k * ,   l@ " )4 m k@"  )  4@" ) 4* } . ) 4   p   D. 4& L& D )   R. H 0diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKfdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo㿘>X    "     2>>!!@'@ "    " ?   drive %d㿘`>"x 㿘@Y  @*  " d@J @G w@D@A [version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c 㿈 2&`H80 @r &`H`h&`d &`h&`&`\`\&``> `x"t>@c> "&`0 `0@w&`4`H 7   &`x&`|&`   7 + ` " 27*`h &`h`H&``&`|&`x@   X@  X`   X> # " X>А#  X&`tq`h  @ƒ @ >#0>` cP>4 #Xt 8 7'>X  >>!!@& *>   " #a8 04    >   <@ > @  > '> a8`b> aĐ`]'> #'>]   ' @ fdprobe: %d stati: %x 㿘$ hg   * @*  $ & @9 @6   #> $# x Ѐ 2 a$"@    > @ >  > #  >"̒ 6 > >Ð"& >ϼ"Ȁ    `? h   *@ 䞒 : %s %d cyl, %d head, %d sec : density unknown 㿘  > 0   ό?>χ ?&`&`ܐ L&`,`" @  @ @> !``0`&`&`X-2&>@:#4!>"X>a ?"&`@>bap~afdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive 㿘 D> : L`' L*@ !  T &W& 4 < 0@O, ĕ:`  $  @ B& @6*  :& 4& <  T @> # & @> <! H /d * %  ]!!8 2 $@0  d >ؐ"@ĐH 00 0(& 0)U㿘 $ \&!8& ` & `""`@ 㿘 ` $   & &  "`  "@`$ " &!8&  ` &  `"$ ` ̐&`@& `$)&! >X!P*!Β@ $ dfdc reset 㿘 h " x  *@ x *@#"  x* h   *@> # >l 㿘 h   \  ߖ  * L "   * * *0 * L " 2 * , 0 ( 㿘H /d * %   $ & H 0㿘 $H /d4 * % ?& \ d @? H 0fdcresult: overrun fdcresult: timeout 㿘a"  x Ѐ  $  >c@̢ ? | *@ "u 2 x> ̑cX?$ ?㿘 xa b?"^  x  ? $? | *㿘> L  :  6I L* @  `p2 ` ` *` *  > * c  2 ,  "  Ā " # ?  $ $ 䀢$ @ ` *@"     $  $     $ > L2   ( """ ("(" "ࠝ㿘>>"<  l㿘>>"<  ` fdcstart: not idle 㿘 d >  "0@J%s: %s: state %d (st0 %s cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d 㿈 $>  # d ̭`> ``> % (> ! (>̜"0> # ̕00 >  > #\ > #` > #d #p#h0́#0~timeout㿘 \H /d * % > 0 ! "& d d & d@H 0㿘H o*@ e@ H 0㿘 "&  H /d * % @mH 0 fdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossible㿐  >  d˹" d? h& > [" \`2a & dǰ $````"`& ```"@$a80@2H d`> #*` & l$`<a$`T$``   & d* L`ܐ * @ " ` "`! ?$ ``$` h ` & d>X!P`ap`:`t ` ?$` h " `0@2`@A$`@@=  $`y ` t   & m    `g 2  `@B`( ] ? h& d$` & d& `p`0B<<`p>X!P H*`#  $````@"N`̤`$a:` @8>  쀢  !: 8$`<- $`@@k$```Ȓ@ > ͐"H`> 0 & `ؠ @ & `/ x*@# > #> #H> #P `ܘ`ʭ#\  & d& $&  M _- `ߒ@ `ې X  Ր R  ϐ L  ɐ F >    怢 " `:  ŀ 25  `ߑ-@ ` ,  ` %    `   `   `   `    `  & dm`0>X!P y*`T   h ` & d>X!P @ 2hC `0x  >  2 > `@ ( 6 > # > X$`> ?8`* *⬐ *0>X  #> b!?8  ,,b b ,,b0` <`0@8"  !>  # D # t @2? l!> # " 0@> #h> #x  > `Ԑ#` ɹ    t 4 p# ?  & t> #ɠ & p p  & p & d l >`В!> #Ș!; ? >ɂ"& l p??& p t > c ?  & t> #k N& p`؀``̐ " `$``$`̐  $`Ȁ$`@`$@ \ d>X!P 2`@ & d&  & |:`W    & d& & n    `h  t& d>X!P* ]@ 8   h ` & d>X!P @ L'   >  >?  > # > C @'E \$`` " h > 2   , 7X - 2@ 7@ 2 / 3t 3$ 5 64 7@ 6D 6 7@ 6hard error㿈 \ & p耊`` l   6 `0 `0  h   0& d.& d +& d!>В!> #И!; ?  >   >  >  >  #p#\#`#d#h0ȍ#`0 ($`0$`4ђ l & l? fdioctl: impossible㿘> !L6  @ "A@l"@@"c  p@E 0a ">@Qe e@ 0W !@"2V  `m@`q@ 0H )"=@* e g@ >  1!7 5   @ 6 " *> @ lb<#   @ 2 n @ Đ 4 0 & $ fdformat: blkno %x count %ld fdform㿘> !L4` @  Ē 1 t  c 7  &, 2@ْ t $D$,$0 ```> * c$H $T$<>#0Ǵ|H /d * % 0">X!P>* P* n  #H 0 # "0(24&6 floppy diskfictitious%s: %s 㿘> !L6  @!@o@l""$ (> a($ 8Ĕ  $ 0Đ $ , @$ 4 4 > a8@ !,4 HĖ  $ $ < 44 J 8$ X`$ $   aW4 $ $, 4 >b<@ >!H&㿘>X    $      0   h  ? *@   *@Insert filesystem floppy and press return.㿘 >#@  >"ȁ `p2```   *` ( > ( /> h=%/> x%x/> t 4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +>X``-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +>X``+?P `-`0+-?P%/> h@̀diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKsbusslave-only%s at %s %s slot %d offset 0x%x㿘`> "h3> a @ʔ !<: a> "x!@>!<" 㿘>X  2 2 ` D 2   & D @o `? unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnameP`   ">#p0i>_^@c@n!>&`0@#ű>c@a ?&`@ 2 4 H &`< L&`8*& D  >@bP 2'4 ''>#@* @K &`< ϔ  &`8>#&@@6c@@b  @ >' @&`>relative sbus addressing not supported㿘 < 23`0`4=#  ?*@2`&a@M&a<>X  "`0>ې!>*  `  &`4&`0@ &a<9&a@ `4@ >"@  `0"@ ``@ 0( &a<`4`@"&a@ `0 <    8@  @  `4  "  8  # ``@ sbus_establish: can't find sbus parent for %s㿘`$   >>`#p>#v bP@ 0  2 $& 4& $ 4reset %s:㿘> !. > ij  4  `"  @>"xĤ   2 %s: dma card found in non-dma sbus slot %d: not supported 㿘> bX@= a<: 2` >~  mii_attach: phyloc and offloc specified㿀 ?>!0  ` @&`$ &` N'`$ 8 " 028`4  5?@1@.?2* `4 ' `4'>>'''[ " `$ "0`$0"`4&`$`$"4"<`( &`(  'mii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failed 㿘" >" / $ + 82 0` <2 0`` 0>l# L " 0>#@ b  ـmii_detach: phyloc and offloc specified㿘" >J P ( $ $ 0  8@2  <2 " 4 4$ 4 4 0"@_  OUI 0x%06x model 0x%04x rev %d at %s phy %d㿘`"  > : *` @ !P2 W >S!x 㿘`  "@ @`㿘 $ & 0 & , D  " 0 2 D 㿘 $   D  0 2 D㿘 $ & 0  & , D  0 2 D㿘 $   D  0 2 D!A  !@@mii_phy_setmedia㿘 L  `2  8  4 $ #@% 0` (*`>g#> P* @@  $  8 8 L 8  8 $miiaut㿘 P ` L? T"`8  $: 8  L 8 $  8`  L  4 8 $ 2/ !# !$ L'  P`>X!P>`& P: P ; @?`2?` d& P>a>X!P2`@ :`?㿘 ( !H /e * &  P  ? L& P`4 $ 8 D  LH 0㿘 L` 4 -` 2* `4  8 $ L`4  $ 8 2  ` 2 \ & ` \ `   & \@ & \[ ?? ?㿘 P #!| L  8 $  8 c#  c   L 4 8 $ @ @   P d L 8  8 $㿘 P  ?& P2 d㿘 H@㿘 L | 0@2  <  ,@2 <`  <@ $@ 0& | ,& 㿘 L  ,` `   h 0 ;" D, ;  D@`$ D `H /e * & zH 0㿘 P   L @*``" gF  T( @*``# g<  T)  @* `#  g/  T' @*``& g$  T%  @* `&  g  T#  @*``( g   X<@4@   @*`& ``+ f  X  @*  `+ & ` f  X   @*`& ``0 f  X  @*  `0 & ` fՖ  T  @*``  f˖ 㿘 @g L`  -㿘 P ? d   (""4# # & 0&  0 ! A !nsphy :` ( c  : %s, rev. %d DP83840 10/100 media interface㿘 >>` ~  (>&`@>a#&`8&`D&`H&`L  &`P@ &```L  4`8`$? b &`T㿘`( `u "`"6`0e^0```@2  [ 0_`@2   `L 4 `8`$`L$`8 `8`$0L` 4 B `L 4`8`$`L%b`8 `$`8E02`@2 4 1` 4 , `L 4`8`$`L`4 `$`82 `\``  $`\@$`\P ? 0 ) /3 㿘 L  $`,$`0 L  4 8 $` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,S `0 $`0H 2 L`0D   4 8 $ .  L 4 8 $ L`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   L  4 8 $ @`0  $`0㿘o L  4 8 $ L`4  8 $?b  L: 8 8  $qsphy :` (Q c  : %s, rev. %d QS6612 10/100 media interface㿘 >>b` "P (>&`@>c$ `&`8&`H&`D&`L @&`P`L  4`8`$? b &`T㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 4 0 @2   ? 0   㿘 L  $`,$`0 L  4 8 $` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,? `0 $`04 2 L`00   4 8 $ L`4  8 $ ?`*`>" `0 `0 `0 `0 @ $`0`0 `0 $`0 a a a a a a a a a a a a a a a a a a a a aĝ㿘> L  8  8 $scxspl㿐>    "> >"b#\    getxscannot allocate scsi xs 㿘H /d * %  >  4   ˜  `> ͐"ђ`  ?4 & H 0  @>А"H 0㿘` > r"   ` 6 ?# @6 @0  `@ could not get size p@ b  %h/#\#d#`  @]   . * *`  @> p 㿀@~  ##\#d/#`   @5 x@j a" @ //#\#d#`   @ 㿀@S  #  ://#\#d#`  :@ 㿀@; c /#\/#d#`   @ 㿀   @   /`//!0 ##\#d#`   @Ϛ 㿘   @ 1 0@  z09@ 2 0@@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@  Bscsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossible㿘 & , $ ?& & (. X `@@ "@   >0;*>08   (> HH /d* %  >p  5   >H 0 0 ?@_ ?" & , scsi_scsi_cmd: buffer without nosleep㿘`d2>֐"% `Y  $` \$`$`$` $`$$`$`$`0$`T  , `  * @*`  s?;0 scbusyunknown error category from scsi driver 㿘 ,`<*`> | ; @\?27 , 2  & ,  ?   u"@  ! > >!(    ??&  & , ?& ?  ? @ >#0  k k ll ll l k k lX l@ DEFERRED ERROR, key = 0x%x Sense Error Code %d at block no. %d (decimal) 㿘 ``4@?  p qu@ > l `  ` a>#*` ($@"Q$(V ``?# @4`@k `  ` ` $,[? `  ސ"@P?N -!H E %  )2` ;?``?# @4``0?` ,` 0   ?   @ 0@/ >  `    > **` @ @  >   m m m n n nX n| n n n n n n n%s(%s:%d:%d): probe㿘 >`#`>#    ReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sense    p H 0     p H 0      h 0    x P (     x ` P        x H (       H       p P 0     ` 0    h 8     p H       ` H (   ! ! h" 0$ % & & & & ' p( H( ) * * * + p, X, 8, - / 0 0 p0 @0 1 1 2 2 3 6 p7 X9 8:  ; ; ~; ~; ~x; ~h; ~X; ~8; ~; ~; }; }; }; }; }`; }@= } > |? |? |? |? |h@ |HA | B {C {D {E {F {G {pH {@I {(J {K zL zN zP zP zxP zPQ z@R z0S zS yS yT yU yW ypX yPY y8Z yZ xZ xZ x[ x[ xp[ xX[ x8\ x \ x\ w` wa wa wa wb wxc wHd w(Illegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xCheck Condition on opcode 0x%x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02x㿘  >$ @ 4V (!>$ H @ƐNL`  >$H `L`  >$ p@  , ` @>$8  , ` ">>$ />, ` ` * *`  *  >$ L` i` ` * *`  *  >$   @|  >$ L``>$! `@l  >$!(`>    L@     L@ "  )>$!@֒ >$!xВ  !x˒ ?2 @>$!  @>$!?`   `> %s, Error in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d㿘` ``` ` ` `> "*`1>  #@ )0A`>!, !> ` # ` ` >  `>!,`+` `  >  >` @2 >$ >#pc#>$`h #@ #J`> "*` 3> c>%``V>!,  ` ` ` >  `>!,`+` `  >  >` @2 >$ >#&c^c>$` Vc@ RcP ` L ` H`E>& *`  > #>% @ h>% >% ` `*   1> #>% @ >% >% ` `* ޒ 1> # `1> `*#>% ` `1> `*#>%`Ȑ h h h 㿘  oڐ!@!H /d * % > ` ` &" "` & H 0 㿘H /d * % `"  "` "@H 0 q H4> ل(>  @2HUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code 㿘 0`7 >&"P0: 2!, >&"p0/ , [ X, Z ,`*`>'   ( $" $ $, [ , Y X 4~ (   >& "     >&" , [ T t user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistr㿈Y  >' W ` <  aǐ >' 0J 2 D  ( ` >' `: 2(  H #d `#\#`4 H /d * % p  )  0">'H 00 0& 4(& 0 ΐscsi_do_ioctl: impossible㿈  !"[ a awav ! "h  !\w0!q} `& `   &&>&&&&>'` `&&  x` *r- &L&4&8&P&D8<w `k0<?# @6  6   6   @6 "'   6 @+@& 'В"#\#d#`    o  @㿘! @0!@ "@ !@ 3 09!@", !@.  ! ! @0!@!  """ 2 """ "    ` @scsibusscsibus at %s㿘`>(="  : %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links㿘>X 2`> ""`.&`0 2`0 6`0`6`: `$ 2`: *`$`:>("8`: * mF  &`4>("H`:   m7 `4."@ `4 >("x@ `: } `?@e?㿘㿘ؒ㿘 : 6 4 4, @ " :nm  : & 4 4ne 㿘` @2  "@@"@ `㿘?!> "p  "p.  "p@` "p @㿘  > bp 6> bp. @ 2 06   ?`&, @6(   $ ?  @4 @"` @֔ 8: 2`@@ ` @ " " """  " " """C @  \  "*  2  *    *  \_ \* @ 00* @ 800* @ 0**  @`*1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P4.21NEC CD-ROM DRIVE:2731.0gMemorex CRW-26421.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TEBCD-24XBCD-16XSW03DALPS ELECTRIC CO.,LTD. DC544CSENASUN V1.9SuperVista S-12 AT3 1.60 ULTIMA V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROP0001SD120S-200 NEC FC-1TEACG0661467ZIP 250ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171FCST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM C-OLYMPUS 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID CP16CP15DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1588-15MBSUN0669MICROP 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON CD-ROM PX-40TSPLEXTORCyberDrv1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-561 CD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:841CD-ROM DRIVE:5011.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicesscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixed`>- !      ` `@2  `  >->- >- >->- !`>-!>-!>-!`aЀ`2В ``+>. *` >-%!>-"!>-!>-">-">-">-" >-"(>- "0>- "8>-"H>-`"`>-"А    p   >- b#\#`#d>-">-"#h #l    D D D , D D D D D D D D D D D D D D D D D 8DECTZ30TK50 not configured 㿈 4.`.  ( g   0 ( %>  > H4 4 $ 4 a, , #> `P@A : Ð`P * `P P  * > #> `P  >   >.ap @>.ax@ `P2 `P>.ap @>.a@ `P>  yb @   ? # @4  ? # @4  ? # @4 쀢 `P  4 `P   `P  2  4 `P  `, 8 *@6 8   8, ,   4  `P @8  `  `0.`0 ` `P   #> `P'>) l'  4@"@a>-0 g >.s!h' 㿘 2 '5 @ 2-`2)@`` @X 2` @ `  @M 2`@@` @B  @@'ϲ@x@1 6 U ///#\#d/.`.@#` x\@ 6 Z(///#\#d/#`ǔ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapcdNEC CD-ROM DRIVE:260㿐> b0  V 㿘> &`` " $``$` 4` > "`0`&`&`Xh@`"   2`` &``"">:>;!H"&aT>0  㿘H /d * %   В $ $0"4("0  $2$H 0 %> -* H 6%> 2 > ,"p>0"X@H ɖ H `%> 2  > -!L>0"X@   `, 㿘A 0㿘? 2  @> "4 2   0А   ` 9s 30m菒!   ! _\0.``4` 軔! 2F `  4`@/ 4   @  `+ ,@ $ "      *@$  *@$    @ o$ *0`?# @4`   n!`?# @4`Y㿘?2  >  "6   0> : 05"      **@$  **@$    $  Ē /!@ #?c 2 `!   7  Ēb 2 ǐ 㿘 D'? @2  `@> "2` 2 Đ =& 4  2  6& 4 <(@  -& 4`". < D     @ @憐 $ 1#Xc  2w 㿘  0` `@ 0`<"@ 㿘 D? @2  `@> "2`  "  ( <*`" 4& <``@㿘>1>2!!ܚ gj㿘>1>2!!ܚ g^ 㿘? .!!@Ґ.@!@l@˒ K.@e K. *  ( ` (("  ?jX? 2`@ `> "@2`     Z! @"Mc@c@Cc@c @=.!,c# @"58" p ! `q@") !@"# # # @`m @0 @" !@ 0!@2@2   @"2Qc@0)c@"!Tc @"!T!@^ `r c @c@ `i c@"F c@Dc@ `[ c@& c@ :c@c@ `H c@ `p@ `s@q `9  #@"!T2 #@ "!T# e e@ "e  r @ ` @Y #@ ` @ "!T# @k `  `m@T`q@ݐ `  e`g@`f@D  h@"8  #@q `  !@ `瀢 0#@"p 0#@0#@ `ր 0 @2@ɐ `̀   @ߘ 0 U!0ɒ `& *`` & 0 Z  $   @   $ S0` € @ ` € #\@$!T` € @~ ,@@J pˑ*   8:d   @V Z  $ ?# @ `*`2 @7֔ 0G#$ a| #b : @,  2) ``"  "+  <*@ "  $" ?# @ `*`2 @2?  $ ?@# @ `*`2 @6@@?8Ő`>    a #$   @ؚ @ ,  $` `?# @ `*`2 @2  $ ?@# @ `*`2 @6@@   8 &bT 0!T@ !T    @     !T@     !T@     u@     k!T@     `@ \@  W   R   L  GV "A !=2  8  3 @  + 0(2?#ϒ @"2@!T`@W@    eATAPI CD-ROMSCSI CD-ROMfictitious㿐@!@"`Ƞ d &(&0&,`@ d &4&8`Ĥ  ?"  >5cp@^  >5c@W  6>5 c@P` !W  &&!,&<6H6J&X&&<6 &6&.@    @ "@``}`,    _̐  @ m`Ĩ  $   *   *` *    * *`  *    ?  `   `$   *   *` *    * *`  *   2+  + "" " "    00  ?$`Ā ?,  @ ? *  6` ? 2  @?`6 # @ `* * >1a@|p"( & & (2; ̠ @  h %/#\#d#`  㖚  2% * *` *  aa(& * *` *    c8& "&  ́x @ Ô@6`6`6` E6////#\///#`#d   Q h@& 4$ А@ " 4Ҳ@ &.`.  `  #\ ` @ `  x\ @Y   G/#\//////#`#d     x @> Ē K'/#\/#`#d    㿈 Ē'Д"#\#d#`     x@  B`/ / 7` @( //#\#d///#` Ú x@  C`/ / c7 (/#\#d///#` ⣚ 㿘   ښ 2``#  +    ˚  㿘Β   ? `@ В @@` >9 *`  a0  (//#\#d/#`  S   װ 2 .`` ē*``0  (///#\#d#`  6  ʰ `I ` ē*``0  (///#\#d#`     `-``* ě2`!0 2`2` ////#\(///#d#`     Ԓ`2 2  2  .` .` .`Ք ﻰ 0{` ē*``0  (///#\#d#`  К  d װ _.`` *    ///ђ/`  a0#\#d#`  ᭚  A $ ` *    ///ђ/`o  a0#\#d#`  ፚ   .@  .@ ` ĕ*?0 //#\#`#d  q      (  < @  T@@ Ēa0`  T(///#\#d//#`  T@  M` @s ??(?*? *`+`@  + ?* ?*?  ?*?*`?@ ? ?  0  `0@2 2` 24    `.@.`.`.`.`.`.`.`.`&` &`&`.`  ` p@'  @# `a0@  (///#\#d//#`  њ   .`.`p@ (@` ē*`0@ ( (////#\/#d#` (চ  `t( 㾸@Ӓ ( @ϐ @a0  (///#\#d/#`    ()*   &``F,  p@ (@ a0@  ((//#\#d//#` O  *  &``  㿘@` >:!*` Ӓ=a   | t <cd_scsibus_get_mode: Mode page %02x request bad size: %d bytes 㿀 >:"& @( @% B b  (/#\#d//#` ؚ cd_scsibus_set_mode: Set mode request bad size: %d bytes 㿀>:"  @.@ b  //#\#d/#` ߢ P     ``/ɔ P    ////ʖ P t   Ű .@.`.`.`P  ^  ` `/`@////ɐ/˒   \ , p b #\  S    //// * p b #\ ؖ 9    .@.`.`.`P b #\    " N #\   ɒ@` `/` /͔  Ę //  x @  Ô@ /#\//#`#d   ޿ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKch02009000SPECTRA㿐> b  Y 㿘> &`0b ><"2  "@C%s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s sx?> 2 `  o * @ 2 00g` d  2` 0 2W 0 * H $@ > "@} >< `j B 0@   *@ "4. 8 L>< p >;#><  T ><>;#Ț  H#\ H 2><>;#Ȑ #` P#d P 2><>;#Ȑ #h, 8 $ 4? c 2 ? 0 > ∑* ?0` 2`㿘? 2`>  * @# # #  ^  #"Q#"?4#"+8H0 #"(HA0 # #40 #"-0@0 ,@~ (@ $4"  "?@$8   48" "H"L"P" T "@x@ 4M `4I +  H`?@4A * ` ?@ X8  :  81   `` ` @k@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d     x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ ``   ``@ @  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d   ܜ x@ * 0  H `?@ '  :` @꾒  4, `4  +24 ////쀋 / / 0ab#\#`#d   e %s: warning, READ ELEMENT STATUS avail != count 㿘 H.`  S   WȐ$ 8 @I$ ;` ` ` *  쌐 Y   W@0 "` ` `*  >> M   W` `-@ @!`X `X x @/ 0a6`67  7 (////#\///#d/#` ٚ %s: could not sense element address page %s: could not sense capabilities page h@ ؒ @#p0` h//  //#\#`#d  ۠  >>D"ߥ, ,`, @  +(  (+`+  @  $D$T$8$H$<$L$@$P@鬒  @驐 0`////#\#d#`  \  >># 0X@鍒 \@鉒  ,@ , $ 0 ` 2`㿐> b& d   `& ddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapsd㿐> c  Ę %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted mediasdattach: unknown result from get_parms%s: WARNING: unable to establish shutdown hook 㿐> &`c `0 .aT> $`$`#`&`&`X`@`" >E#x>F!H&at`" )>?  ` &`ɐ"h``   > " ٝ aU`@ a^`@ ao` @    at> b`Ƞ`>?"p >?  >?0>?0 !>?"x@O@K#\0 }"0>?y"0 "t"h>a>D"ܒ jM &ax>?#f 㿘H /d * %    $ $0"4("0א  $2$H 0 '> -* H 6'> 2 > ,"p>@#@H` H '> 2 6!x > -!L>@#@`  ,!x`>aj" 㿘 0㿘? 2` > "O2` 2   0 | ` 5 p e! k` 2 ` س! ```4` ؓ! 2K `   4`!t@  Ȁ 2 4  @  `+ *@ $ "      * @$  * @$    @ B$ ~0`?# @4`   A!`?# @4`,~㿘?2  >  "~6  I  0 "A"      **@$  **@$    $$  "  !t €  Ē !@ #?c 2 `!     Ēb 2֐~ 㿘 D'? @2  `@> "~d2` 2  B& 4 <(@b  9& 4    `  /& 4 ,& 4". < D     @ @K $ 0  0(& 0 <I& @ ~1%s: not queued, error %d p Ā`?# @5 r/0 `$  $"`$  2   0 ( <$ 0$ 4$ @x ( T@M4  D ` " <*  @ <?@> "# @?,@ @k  0@  4`4`///// @Y  0@ * (44`4`4`///////  0l 0 2 H  &  H: <"`#\#` 0 ( #d   s >B @  2j 㿘  ` @ ?"` 0 `0 @ <X"@ 㿘 D? @2  `@> "}O2`  "    ( <*`" 4& < ``@}X㿘>A>B"Ę# W㿘>A>B"Ę# W  㽘? @ `2` `> "}2`     .  !@"! !@"8  p !   q@ " m@  0!@2    `m@"e e@ ";  `p@`s@$0 r@& !@0 !@"vV `q@i  h@0 e`g@{`f@ x0  @ 0{@ 0t۔!0p & *`` h&T 0~ a $   @1 2  e g@2 ? @2  @?`4`# @ `* * >A b@T   ~$ 05"4    -$ ?*$  @ չ " "  !22 @   㗚|DSCSI opticalSCSI disk%s %s㿘@’!@俒"`&(`&0`&,`&4 &8 d&8 6aT  >D>Cc@< aU`@6 aU@ߐa^@ې   >D``ؒ@ `ؐ.( 6H2` 6J& &<&&X&&  aW6&&.|R? 2`  ?6  +  *6 >AbĔ@㿘  !t € x@D  @@ 6`6`6`  //////#\#d/#`   %s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d 㿘  4    ? 4 ? ( `;?  7 ` 3 `  >D ܐ"怐#@%?$  ` ` >D>D"Ȓ   "  Ԝ  >D# ? 㿘?2  @> "{4   /? `*@2 `Đ  2?`  , ` "(? 奓2`    2?z㿈)> ! 2p ?> 2  @2`  ` %%!. @   (@붒 S @.` @ג,   ` @ > ? =  `7@ @9 6` *6`6`4`///////@*  @&  #  &&& &&3&(& &,,&0&$ `@@  %!  _(*``  @* %s: strange capacity descriptor byte5 0x%x @ @ސ Ģb  # /#d//#\#` ԑ  L    "   >E#>E#:  6 *` *  `* `*` *  3  @ .&` &`&`&`&`&@ Ę#\  &w   ѓ*`@ * ̐ &@&`&`&`  l㿀@v , @r cp   //#\/#d#`  ,$ P"&`  ҭ  @R cp  ? ///#\#d#`  ,   ʑ* ˓*`  &` &`  @ &@&`@(&`&` %s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry h.&`!T Ȑ~  + ו*ї*Ҕ ӓ*`*  ؒ ٔ &` &@?&` <`2 Đ"&`  ,`&`@ @銐M&` O " ґ* *`ܐ ӕ*ؐ &@ٔ &` &`  &``  &`` ( "%&`    @2 Ā` >F>F" >F" >F"  @ 6 "&`&@&`&`&`  %s: WARNING: cache synchronization failed x @  "`!@e aba 5/#\#d#`     >G!@I 0  @& diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st㿐> `  2 %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled㿘> &`L  $ $ 4 @L>Hj `X>H`` >H >H  \ 5> ݒ`  >H@` "`d>HJ a>HE ```>H>H> `0: `0>H`!>H! >H!0. a&a&a&a ?# @4 㿐>  ch L毘  & X& h& 4@& @㿘 X l  @    *@ h " ``$  * ` ` ,  *   %s: already open 㿘? 2  @> # 2H #*@ 2 L0@2` ` >H# 5   ? $` 4`%  D`2 0 @ڔ  0(`@\$ D`   0  $ 0 @ǔ `?# @4`㿘?2  > #6 * @ 0 !   @   " L     L @  L   2  L @  L @  L? c 2  %s: cannot set selected mode 㿘?2  > #6 * @6  0 h Ld `@,`$ 0*  l@ h $ 4 @ Sϣ  4 "@- H"@u ?@ : @ *  t d, < 0 ?$ 0 @  ,`@K  0 *  p@ $ 8$ 0@ >I ϣ!@ 0 ?($ 0 4!Β 㿐 0( L @ @ @۔ @ ρ!@` @ @ 0? 7& 0 c 4  L"  P 0 `" 0"" < T2 < 0" 82>J( 0 `" 0"" 8"" 8`" 0 4  `2 0 ` 0" 0 `" 8 0" 8" 0 < 4  0& 0 0 0" 0 ) ) ) ) ) ), ), ), ), ), ), ), ), ), ) ) ) ) )%s: bad request, must be multiple of %d %s: bad request, must be between %d and %d 㿘 D? 2`  > 2 *  <C@ 0   8@] >J"8   P &  T T    T>J"h  & 4H /d * % & $ `( $& (`("@"`(H 00 0(& 0 <Y& @%s: not queued 㿀 L`?# @4`iF0!  $` ("`(&! (" 0h"`` ``?# @4`6`"# 0 0@  @Ζ " 0 0 ( <$ 0$ @$ 4U`  0$ 4 < 7$ 0$ @ 0   0  <($ 0$ @$ 4 0 & 0:` @m  0@   0 > /& 0'/( 0   / 8@ <2  <2 2 /// H <# #\#d#`  >J#3 ` 2m`㿘? 2`  > 2 c* @`L>J`"`N] 㿘? 2`  > 2 c* @`L>J`"` NF 㿐?> # 2` 2`* 2`! 8 ` <  aa 0 !7  @h @Ւ 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0 ( 6 0(" H 6 H6 J64 J4 HV`o>L#*` @8   @^ &@  @   @N   @   0 @Z  @T } @, u Д  0*@9$ 0 0 4$ 0@d b`2 P 0 ?`@  T  @ S  T@$ 0M  0 $ 0 0$ 8 $ 0`EB  , <  <  Lۃ6@ >I! , < $ 8 0 %$ 0 0 ?!$ 0   V   ,`0,` 8*  p"@ @   <* * t @ *@  0 0 0 1 1 1@ 1X 3 1l 1 1 2T 1 1 2 2|㿀2 @ђ  0 `/ 8 `/@J: 22///66/// Lc #\#d#` i x`L  % @ۖ a0h /#\#d#`  K   * *` *  $`T$`P0 @ L @l a0 h/#\#d/#`    &*`*@ **  @  & \& `. d 0  0 ?& 0 @ А  40 @  4  L"7 @   /@/   03 <//// 0 "  @ 82 2 /// @ ڕ!0#\#d#` ̳ 㿀@  `/ 6/b /c  L #\#d#`  ̔ 㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @ L66`6` ///#\//#d#`   /  㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @N L6`6` ///#\/#d#`    㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @ L6 /#\/#d#`   ˱ x   0 =& 0@ے  L /`/!06"#\#d#`   ˊ %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d 㿘  4 4 0   7 7 * *`  *    $  p2? 0 "L $ 8ۢ& (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4>O (T  4 "  (  2 ( 8>$ 8 ( $@*;  0 2T  3`2L$`@M & (  @2H  `C =`<     8 >O" X 1  `   `>O x $ & ($`@   2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$ F2  6 t '$$`8(`82`0`0    ?$`0   ٔ Gl 0 2`8Ge   diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKdmaledma[%s at %s] offset 0x%x㿘`"!@>P { !@>Pw! espdma㿘`@   >P@!H "   >   `׭&`48Ȓ@ cable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameespP "8, 2  80 @ &  %>P&`D@ܘ耢 ##>X>P@a>P@܍a >P@܇a 2 `D`D* "`D "ڝ" #>X` >P @ " >Pb@??&`T&`T`T &`T>Pސ"`D< @ &`L `>P@">P!>P$@>P(@">P>P">P" >P>P"(>P"0 >P"8>P`L"@>P"P` > @ 0@>R>R>S `>T a&`l&`x>R>R>R>R!a &`p&`t&`|&`` I&`P 28`08 >P@aH  >P8@` 8@耢 2'8 ''@$`P ">PbX@@}N    >P'k @ >P0>P@`  >P`@0"` &`<"#%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../arch/sparc/dev/dma.cR_PEND㿘 D@$!@耊d! ?ٮ  D$ ?   >Q D@"P>Qbp!P>Q" D@ < "@ D Ȓ`"ٌ D @ ?"@ D@ "@ L  `2 L D " L@(@2)& H D* " T   D " D D@0 "& H D " T  D@ 7@("@& H㿘 㿘`@  2 @ 㿘t  D  D %s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address㿘 D@$"! D@耊d! ?  D$ ?   >Q D@"P>QbpC!>Q" D |` "& d& h!>] (  >R!0@@ -  d?@@*@" 8 & `' ( >R `!H>X  2 d ``   d @& \ & X>R!h d D"  L@2 D> ` d `@ @ *  D"  D@" >! "@  D  " H%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d 㿘`D`<@)>] (  `>R>R##`>R`D>R }"`D#` #t ?`H 2`D>S @$"!`L@耊d! ? `D$ ?   >Q`D@"P>QbpL">Q"`L @`2`D`D@ @@ "@`D@ "!`D@耊` ! ?Ր `D  ?   >Q`D@"P>Qbp">S (`D }"`` ($`H ( "#>S  `8€ @€  * @  € @€     @€   ( >S hْ 2,``  € @€   * `@  @€  * 2 ````@@2`` @" ``,>] (  >S @  € @€   @ @€    >X>`daH€>X  2 `h`X "`h`\@*```h @""@`d@"@㿘 D >R }" D>R` " #Q  l@ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKlebuffer[%s at %s] offset 0x%x㿘`"!@>T "h!@>T"x 㿘`@ؑ  2 @ burst-sizes: %dK memory nameP "8, 2  80 @ &  &`H8&`L @ " >Tc@}??&`D&`D`D>T`L c&`D ѓ: &`@ 28`08  ''@}c @}a@y  g >T'gޖ @}p >Tdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKqec%s at %s offset 0x%x㿘`"!@>U s!!@>Uo!  㿘`@  2 ֒@ #channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameP0  @Ŗ &`<D&`H4&`\4 2&`L&`@@x @ " >Ua@|͔?&`P>U!0Y >U !0R>Ua@|??&`D&`D`D>U`H b&`D`P: >U" >U"( &`@ 28`0 8  ''>Uِ"0@@|b8@|w@x”  @b >U'0f @| >Uranges%s: PROM ranges too large: %d 㿘>V H @@|B ?  & X>V P 01 @X& T @ X@| T $ `< 6 T  X`8 @2     " `8 X  @"`` T㿘`0(&a< X(   \` @"&a@ `0 T   X   `4& X#``@ %s: reset failed. 㿘`< $   ʐ ?   2`P>V"P`0@П`H$  `P$```H@И*`$ `P *``H@Б$`d$ $ `D @ 2  < $㿘 ` ` `ы@`%㿐   2$ >  09$   ܐ   2( ? $ '􀦠&           2(8  D$ $@&@ޢbe㿘`@ `?: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s 㿘4``H>Wn 0>W`@{?&a`0  @ 4&aX<  @#`&aT H @ &a\&aL <@&aP>Wa@z??&ad&ad>Wa@z??&ah D&ah D>Xahb &ah&`<`<&`@@a c@ca0>\>\Ḑ% @ ?|( # % ! # $  #&a4 ! # $  #&a4 & $ ! & $  &&a4 ! & $ٖ  &&a4  ( $ϖ  (&a4   $Ɩ  &a4a4$``\n >X&`H >Y>X?b" $$$44$Z"5a`!>W!("~8 >W`@) `@"&㿘 4 $@ @> 9 "  (  & & $  ?&  ( " ` `p* @ ?* x8@,`"X `"@a"   $ 4$6 4 $㿘!T"" !T" "!T  !T" "!T?!T"# !T#    !T# ?㿘H /e * & ϐ@H 0%s: device timeout 㿘>Xb |ݔ  `$ 㿘!P  !X` !T!`@}`@2``@` @%s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting 㿘2      `  `>X # `>X#>X# >X#}>X#}j%s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME㿘 @ >Y ` >X#>X# >Y }p>X}l#5㿐!T H@DH L `X @#`X"@"D"H"L!!  #`P !? &! *!x( ' 6`P! "3`2!  &!`4$ ;3`4  㿘!!x, @ &&! @?* @ !x*   "!`  !x@ &! 㿘 H /e * &  a2a1;a a H0!5=0 !69 = 4 6 4  @H H;0; 4@  2 4n 4 ?/6 4  @c@.0$ { H! H`4@ "ה!0 HV $  H 00H 0㿘!T H!X!LH /f4!x* '!x  !x @R &!|!p   !p @H &!t !x@!t*  + @" !x ("   !x !t*`   + " 4!x!x "@  "   $!x&!&!&!@u&!@!$(!%*  $c!"!#*`@ $c! !!*`@ $c $c @jː  $b  $bP $@!|$ !|($ `8!d$ $ $>$  $a_d  $ , ,$ ($a$ $ $ $ $b,$ 0b  $b c  $c 4 @ ;44H 0!\  "   #d"  #d #%s: rev %d PAL not supported. %s: no internal or external transceiver found. 㿐!\ؐ!``>Z# {0  $   '$   'Z   &!l?  ?&!l$'0>Z#{ %s: invalid tcvr type 㿘!l      >[{ M1? @ @ݒ @ڒ @ג  < `@Ґ?< `:@ `@ɐ?`!l @U@S @P *?@@I@G@E@@ @ *?@@ @@㿐!l !\ $   '$   '  2  >[ $   '$   'Ͽ  2  { 㿐!l !\ $   'ϩ  $   `2`'0 >[ $   'ϗ  $   `2`'0 z 㿘!l     >[ z֒ 00@. @+ @( @%  <@ `@ ?<@ `:@ `@?`@ @  .2`:@ `@?.l `\( \\( \  #d" \#d#%s: invalid packet size %d; dropping 㿘% H>\ zu \  L!p`*`   2 H L  $ L ( `$ H |㿘 a !"  0 2  & & #&`  `   ?&`%s: bmcr reset failed %s: bmcr unisolate failed 㿘!0` X  2 .  β ?  p   >\ ;"hd` ` ``*  !Tb " b ="b ?*   x ? 6 $ >\  "y 㿐!T H 4!c  @$c 0Tc ?$c  4"?#$c@$cD$cH$cL0G?#$c@$cD$cH$cL 4>" 7777' @і  ?    @;n # 22?2``$ 22*  * @3 2  א$c@$cD$cH$cL 4 =6 4qe㿘`@ `?: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s 㿘 L`H>]y4!0j>]a@t?&aD0  @ 8&a<<  @ &a8&a0 <@&a4>]?@t̒b&a@ D>^"H&aH&`<`<&`@@a ?``\ʦ >]>`&`H#bL>^?al!̚`"$`$`>b>b$`4`4h<  ے # # $`]aD!>]">xٔ8 >]a@Q `@"&㿘 4 $@ @= 8d "  (  & & $  ?&  ( " `ɒ `L*   T8 ' ,`" < `"@a" \  $\ 4$6 4 $d㿘!8 !<,   ! ?    $@@    ? @ 㿘ڐ@%s: device timeout 㿘>^ aw   & H /e * & ߐH 0㿘!4!@ *`2 2!< `#߀@?"  @  " @1 㿐!\ H!`  "P !\? &!\ *!T( ' 6P!\ "22!`  &!`4$ ;24!  㿘!h!T, @ &&!h @ @ٔ  `!T *`# " !`  !T@ &!h %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... 㿘`H@   >_ w.` T  $ T@ T  $ T@ >_ 8w` T  $ T @ >_ Xw` T  $ T @@ >_ xw` T  $ T  @>_ v` @>_ v` @  X  Ta!$ X$ T@>_ vܒ`  @ >_ vӒ` T  $ T @ >_ vǒ` T  $ T @@ >_!v` T  $ T @ h X  La!$ X$ Ld L !$ Lb L !$ L >_!8v` L  $ La >_`v!P L  X` $ L$ X``@ L !$ L` L !$ L >_!hvw` L  $ L` >_!vm` L  $ L ` >_!vb` L  $ L ` >_!vW` L  $ L ` >_!vL` L  $ L  >_!v?`>_`v9" ِ?㿘 H /e * &  a2a1;a a L0!5A0 !6= A 4 6 4  @L H40? 4@  2 4o 4 ?36 4  @d@20( H: H`4 4  @ !l H| $  H 00H 0㿘!8 H!<!0H /f * '  !T !T @v &!X!T@Ǟ!L !L@ @j &!P!L@ǒ@  * !T !P, @ "   !T !P*`   , " 4 !T #"@   $!T!X$`!X($` &!\&!d&!`&!h$`$`$`$`$`0$`4 `w!@$`$`$ `$` `$ \ d  $`,`, "$`(` , ,,,, , ,@ ,    dې ? $!  ! ,!!,!",!#,!$,!%,@F,4  `@ {a44 , H 0%s: invalid packet size %d; dropping 㿘% H>a"t \  L!L`*`    2 H L  $ L ( `$ H  㿐!8 H 4" ,    dq ? $     ,? 0M 4"6 4 7777&`@̰  ? @   @;n # 22?2  $ @22*  * @5 `2``ؐ ,    d% ? $    , $  #"`8@ ` "` "`p   hmeSUNW,hmeSUNW,qfe㿘`@ʾ  >b@ʸ!  >b@ʲ"  @ : expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe㿘4``>bs"0`>bs"08  @0&atD  @z<&axP  @tH&a|\  @nT&ah  @h`&a>b&`Hb@o? &a &aa  `!&a>bb@on??&a @&a @a @ @&a`0ђ>f!&`<&`@@{U`<ad>bbؔ@o  !>b͐!>b"as>h>h!` >h`L#x&`&`>h>h&`,P&`hZ<??? `p   " ]  "` `` >c"T>d>d?`T" $`$`$`4`4$`$@ʐ8`@> !d@Ð >bc@ɽ >ba@ɷ &㿘 4 $@ @6#  C@?* 8@,`"x `"@` "   $ 4$6 4    & & $  ?& 2 ($%s: stop failed 㿘!t "@!t    NJ !t    2 x>c#HrԒ  x ?& x㿘H /e * & Ӑ@ސH 0%s: device timeout 㿘>d`@ qu  `$ 㿘H /f * '  E   H 00[a2@a1@9a @a@"4F 0!5@;0 !6@7 0;4 44  @1 0-@  24h4 ?"44  @]@h0  4 @  LdH 0㿘! 2 !! @ &!! 2 !p!@! @ &!!&!&!&!  !@@@*(" (" f &!  !*   "@ !# %s: burst size unknown %s: setting rxreg->cfg failed. 㿘!! !t!x@}!|?#$! "  ?$@@!h!i*` @  $bP!d !e*  $c !f !g*  $c!h!i*  $c$b,$b$b!%`!(% ! @  $  $ >d#Xq $!$ % ,   %  %@-@">d#pq~ $c @, b  $$b ! 2"$@b  L`$b c `$c +452 @ ;54㿘!  !?#" Ȓ "! &!%s: reset tx failed 㿘! $"0 `" `>e!q2 %s: reset rx failed 㿘! $#0ɐ `# `>e"`q %s: link status changed 㿘>e q" 㿐! HLD @  X @$ X"H"L"D"@!` P { 4 4` $ P !?&!!  ,`!(@z  6 4&!! "4 2 㿐! , @L $L@D!!'@V   `  ! J2  &! %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP㿘?? ؐ & ??" >f>fฐ p]  㿘at?a" ߒ <@>@m㿘.`* * !* @   `2LH /f * ' V> ߒc*`@ ?2@    "#8@ <"`<<8"`8> $g ($0,04&0 ?6> "pgH 0PuH /f * ' V> ߒc*`@ ?2@  ?  "#8@ <"`<<8"`8> $gW ($0,0Q4&0 ?6> "pgAH 02d %s: invalid packet size %d; dropping 㿘% >g!oq  L!.` @   L $ L  H ( `$ H s㿐!  4!#  @$# 0]# ?$#  4"?#$#@$#D$#H$#L# ($# 0M?#$#@$#D$#H$#L# ($#  4A" 7777'`@"  ? @    @;n # 22?2``$ @ 22*  * @3 `2``א$#@$#D$#H$#L# ($#  4 =6 4! ` !  ! 㿘!" ``!  !2 !  "! "@@ %s: mii_write failed 㿘!  #!*?.`c   $` ` @@ N ` @@?  3>h n 0. $`       >@ `>@ > `> > `>$`%s: mii_read failed 㿘! ! % *`@.` $` ` @@  ` @@?  >h n@!xB ` 1?#=  $` N ?I F C @  >@ `;?>@ > `3?>$`6 2*? *'$㿘 4  㿘ې L |&` x&` |!b b "b diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘`@:  "  >   `&`48@ dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintresp㿘!>i  @ > a&`4`?`>imu 0 >i  mn&c$ 2&c80 @z &c&c  [ >i`@i &b>ic `@i?&b" &b&bb耢 `$ 0&bb@Вb@`&b&c& <`@m0 &c" <>im2 >ikِ b  ` .`.`.`  `@€ _ "`-&b .``  `.`   ` .``  `@€   `.` @`.``   &bb#@ub`&b``>,">,"@&b &b@&b@]$&b@&b>,"&c  >>`c`$c>>>>bc$&c c @te&c>i`V>`0 "8 6> >ia@# />  <@   #>  `@2>  @bd > > >ia@ >  ? >  `@2>  @bL > > ab `&b@b@ #*` #*`( 㿘# t@㿘# l@㿘# x@㿘# |@㿘# @#D #Hdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKbwtwo㿘!>X  V` 25 `@‚  2. ` &` 2 % I ?  2  2 @O   E"`4 @" `4  ?倢  `@ &` bwtwo/p4model: %s, %d x %d (console) cgfourcgeightunknown%s: %s overlay plane 㿘> `<"  $ $ $$ (` @     $ ,0  @y2 $ 0 &`0 @y* &`$ 0 &`   64>j 0:`106`>X  +>j ,@@   0>j2  Ec2   E @ E"  &a&`&`&a>j "Т"Ф  >jc@f0`  &`$ $#@M! ->X_ >j # $ k4$  ?> " , * J  > "܀@ ?  > "4 > "܀@   $  `@x $ @  ">k>kj  ,@@a  @Mj `0 ,@@a   >k (>k >k >k 0jӒ` > "4 ,@@ a @K 0@K?> a0 6  a*    㿘?2  > a. "@"@"@ 0 "@  0#   @E &@[   㿘@R bwtwommap㿘> ?  2  >  ; .   @ >li!X ?T@>X @  * @ @ 㿘>X  2  2  h@@"1@Mq <@6  6  㿘>X  ` ` h@@ <@M[0`Њ@@ Ъ@@0 Њ@@ ?Ъ@@0  ` ` ` *`diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKcgtwo㿘` &`  `@T   >X  V` ~>   0@wU?@ 8@ cgtwoattach: impossible bustype: %s, %d x %d (console) 㿘> "L ` &`T&`4&`X&`\  >l#>mh= 8 &`@`0 $#@Ki !&`D>  )>X A"@* &`H>m`< X`8iy  `> " "> J   > "܀@ `ܠ0  &`&`  &`L @v &`L  $ @v&`  @@vۖ# &`>miA h@K> >mi: x> "4@  `0@Ji?> b80 6  b8*    㿘?2  > b8. "@"& 4 "@7"@?  "@ "( " "@"* 1 @,  4 ' & 4&{ &  4?&$&( 4&L&H@@g   &  `  *   (㼘@` (`A ,   *   `"@  *   `$@  *   `g 2` _  `W  㼘@` ? `< 28` 4 20`,@ " &,  2@ ` @ 2@ ` @@ 2@ ` cgtwommap㿘> ?  2   > ; 8.   @ >nf" ?H@>X  @ ܑ* @ ܐ@ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKcgthreecgRDI㿘` `&``@G  >n@A#Ѐ "   >    & 48@  model: %s, %d x %d setting video ctrl (console) 㿘> "` &``&`d`  &`h&`@    6>n    &`L  &`L>X   >n>o`h@c  #Ȧ  >o`h@c &`L`< $#@I>>n#@ؒ 2`D &``D1> `\p> `! * &`P>o`H pgA&`T"4 > "܀@   &`X`0 @t &`X0 @t ` )&` ` &   `%>  @ p >og     *    , `  `  `&`$* a" @  $ s$  $ $ ` >o>ofڐ @IyfԐ `0"4`<@H?> bx0 6  bx*    㿘?2  > bx. "@"& @ "@A"@D  "@ ") " "@"36 @!1  @ , & @& &  @?&$&( @&L&H@ #!!@ R! "@%  @&@   㿘@ ` @( 2  @ :`:(* * # #  cgthreemmap㿘> ?  2  >  ; x.   @ >pd" #@? @ #@?@  T@ >X?  @@* @ @ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKcgfour㿘` @> 2 `>X` `&` 2   ?"  @H  @"` @ &` %s: ignoring; not a pfour : cgfour/p4, %d x %d 㿘> `0" $ $$ ($ `  $ , >q@@0>q ew`0N   @s$ 0$ $# @GH !$ >q $  e_ >X   > " "> J   > "܀@   ?@rܐ&` ` `&`"2 *`"""?">qe, @Fc?> b؅0 6  b؇*    㿘?2  > bر. "@"& 4 "@A"@D  "@ ") " "@"36 @ 1  4} , & 4&u &  4?&$&( 4&L&H@ ! @ ! "@s  @d&@e  cgfourmap㿘?> Ȕ  2  >  آ; .   @ >rcA X $#@?@ @ <8@:#@ #@ H@ ?@>X  @ܑ* @ ܐ@ 㿘@  㿘@G 0㿘 0@G@ :`:( * *` * # # (# (# (#  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKcgsix㿘`@  * ` &``>X!    `x6>   0@q?@D ?"  @G ` `@ &` cgsix/p4modelcgsix on mainbus? : %s, %d x %d, rev %d (console) 㿘> `<#, $`($`$`$` 0 $`,`U  &` @qE&`   @q>&`  *@q8&a @q2 &a   `* >s#X*` `,@@  >r#>r">X  2 >r"Ȧ   >rc@_>rco#0| $`$`0$#@ED ` +>X`!$`>r` #`cV$`` ?> b`,@   > J  > "܀@ `? 8 `> "4 > "܀@ `>r@#ؕ:  c(6a@$ 2 *b$a h$"h">r>rc#> #@  0 @p &`X@E`<c#`0$` > "4`<@D- T $ $ 8?> c0 6  c*   㿘?2  > c. @* 㿐?2  > c.  b@" "@0 b@Ob@ 0"@&b@"G  @","$ b@@)  "@x0 "@D   @! ް  @& @& &  @?&$&( @&L&H@ &!ɰ"$@ U! 2ð@ V! & "V! @8 2  6! !> 3!p  " 6! 6!6!6!6!6 !6 !$`6"V!* ! 2(! 2   "@֔  w0v &r& V  " '" '@  2d   8] "* 2` :`U $# (#  F   6!  6!6!6! 6!@S&"@&" `&! 6!"6!V"!@ɳ*(^$Z!@K !6! 66!@)6!  66 !?? !  R!`4   `@" " " R R?R#RR (??#(R?38 *ii "@*@ :`:( * *` * $# # (# (# (#   @ " * * * " * R! !2!  cgsixmmap㿘> ?  2   > ; .   @ >u_"> #D`%?@ >  #@ T>X  쀢 * @  @  > # *?diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKcgeight㿘` @. 2 `>X` `&` 2   ?"  @C  E"` @ &` %s: ignoring; not a pfour : cgeight/p4, %d x %d 㿘> `0#Ԓ $ $$ $ (`  $ , >v@@0>v `g`0N   @m $ 0$  $@B8#!&`D&`H >v `O!>X   > " "> J   > "܀@   ?@m̐&``Д  `&`"+ `  "  " s" " ">v`! `0@AS?> c0 6  c*    㿘?2  > c. "@"& 4 "@A"@D  "@ ") " "@"36 @ 1  4m , & 4&e &  4?&$&( 4&L&H@s! @! "@  @&@  cgeightmap㿘> ?`  2  >  ; .   @ >w^0 J#@?@ *  @ <8* @@ 3@#@,@#@ %@H@@#@  @ 2`3?@ @*`  @  !@$@  @?>X  @ܑ* @ ܐ@ 㿘@  㿘@Bc 0㿘 0@Bb@ :`:(* * # #  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKtcxSUNW,tcx㿘>w@Zc   ` &` `?tcx: oopsTCX on bus 0x%x? tcx-24-bittcx-8-bit: %s, %d x %d, id %d, rev %d, sense %d (console) 㿘> `< $$$(`   $$, 0>w]D#` 1   a@aX""p&a@&aX  @l  &a @l*&a``>w>w^r#0[>x`@Z 2 >x`@Z $$#@@> )> { $!>x>w $ (^Oc"4a> "܀@ >x 82`22 ^< @$ @2 `b*aah$"h">x>x^' X ^# h  `0C"4`<@?Q?> `0 6  `*   㿘?2  > `. @{ 㿘?2  > `. "@"$ @ "@A"@ 0\ "@ "+" "@3 0O@ 0K @a F  & @Y&&  @?&$&( @ &P&H4&L!@d!/!@! )@0# T!& "T!@D  ! 4!h ;"h!@h "h!h "h  !" " @ :`:(!* *` * # # (# (# (#  Raa2a(("(a@(("(a tcxmmap㿘> ?  2  >  ; .   @ >y[ΐ"( ,>  (`@(?@@ > ` #@ T>X`*` *  쀢 @* @  @  >  В` @*@?diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKcgfourteen㿘`` &``@M   >X     warning: can't find all cgfourteen registers... cgfourteen with only one register set; can't find framebuffer: cgthree emulated at %dx%dx8bpp (console) 㿘> `  &`T&`X`$ &`\&`4 &`@`0 @>^#`P`8> `! * &`D&`H8?#@48>z\k @&88  @i0 <    "0&k&k &k&k&k&k&k &k 4<>zZ X` `<>z`8\@ @ k   `" #> b4 > "܀@ ">z>z\% b4\! b4`0@=U㿘> ?`2  ``.    Ho o>  "H 0  @  㿘?2  > `. Ho o> ? "" H 0 `@  㿐?2  > `.  b@""@0 b@Ob@ 0"@&b@"H  @",  b@Ր@)  "@f0 "@2 հ  4 а  & 4& &  4?&$&( 4&L&H@a! @! 2@ @L&@- 6$6$6$6$6$6 $6 $$`6"V$* %x' 2( $ 2   %@#  {0z &v& V  % '%'@B  2h   8a "* 2` :`Y $ (  J   6$ 6$6$6$ 6$@P&%@r&%`*$ 6$"6$V" @ٳ*%x@Ւ (j$f@@ $6$ 66$@"6$  66 㿘@ cgfourteenmmap㿘?> Ȕ  2  >  ; .   @ >|Y8 x #@? @ #@?@   H @ & : @ >X?  @ ܑ* @  ܐ@ +  +*++*++ & *( ``+ A(k  kA*k k(kkf j"  * ` +  A  @   *+2  㿘@ @( (       ,`  @` * ` * ` *  ` 㿘@ @( )      ,`  @@  .` .`  .@.``@ ` *`+` "@ `R$耠+` ($$+ 2a$$+ 0R򀠠?3@8   x #  " `+% %+ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK㿘 ( ) P  J  D ,   @@ * ` * ` *  ` 㿘 ( )      ,   @@  .@ .`  `.`@ ` 㿘!D@  > "au 0> ! @   s  ?! D ʝ>X!003f#!0㿘 !! D@" "H! D2!㿘 ! D*@ " "2! D ?2!㿘!H `  `1  " >X  >X' >X#   2 -! " -   2 -!    -  2  ! "  !>X! 2  %D # %"`㿘>X  !!``D `l@ !?!`D "` ! p@! D@ @" "㿘>X  ! !L      0 [0B0?%s: lost carrier on UTP port, switching to AUI portAUI port, switching to UTP port %s: lost carrier 㿘>X  2>~! ->~ W#! D ">~>~W#!H  2>~>~W#>~W#!H  >~>~W#>~W#0>~#W 㿘`@  " "`Β 8@ sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundary㿘 >aX @)>!``? @>`?ap@ 4`? ">!xW/0>W*!&a@&a0  @d &a ` 4 !``@y  2 `P 2  ` `H&ah`L>&ap&al$`Pa@R &6ad >X    ah   ah @?* @ @* >U!&al&ap`6ad&a& @&a '8>G!&aa a &>] t@=   <@    ` >] t@% ` @$ mАa>K>~#`T>K!>K>~>~>>~㨠#аaD bX&a(&a,>~>~&a &a$&a0&a8&a<&a4&a&aV   # a  #0$>X  a   #P  % K   F r 0  % = i %q>X >H"` &aa ">}#&a&a@]adiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKUnknown3e/vmeonboardmultibus/vmeie㿘` @ 2 4 6  2  L ? 0F ?  㿘 H 4(@ d4(@ H(@?Ȅ 2(@(@(2(@ H(@2(@㿘 H d,r , H (( H(ie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s 㿐`L􀠠"q>>>>>>(#ؒ`$>(#0@&a4&a8&a<&a@  &aH&aD&`D0@c `D> `&`H!?  > 쀢"#>T  @ `D &`@>S H#> Ȩ``D  @2 ``@  @ "`D>S X&`<aD€> `@#$ &a\&aX 2 >Sڐ x> 8 !  @ ?&aT``@ &a```D" J&ad>>>#lc4>0!@&a4&a8&a<&a@  &aD&`D&aH(H@b&`Hh@?4  @ * " `D@b &`<&`@hD !4hD?*4@ ? 4gaD`@€`D`@`D$|# &aT&a\&a`&ad&aXTԐ 0Va$l@ `>TȐ 0Jd >!>>?cD"$$$44$R-!> aH> a8*@ T  >!&`0&`4@\L`08 4 8>!&`0&`4hY`08  >b@ ` @"$ %s: device timeout 㿘>a0 S9  `@$ %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready 㿘!\!H` ` H(@""!\(D>(D!(F TA (D!4(D!\ ` @ @ `P `@``@` > T%! `@M& !\ ` 2!\ 㿘"8!\ X@_`,`!h  ` ;` > t`?& - t $ 2` * @  +  2   2 +` *`*2+ 2`2* 2  @ @* 2@  & 4  4  4  4  t@ @ B&" *!h*2 3  B !j #@ +`3 +` 4 @ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions 㿘#bl bH {6 6 ~*   >Ss p  4   @& '& > >  >  > SS   &  > SI    `& & !L  "l "X*` @^&!Ll d` 2`@ ?"@& `& & @ L%s: receive descriptors out of sync at %d 㾀!h.`!''2"<`? 2`*  `X 2 "8@I &`@D &@   #& 䀢 !> ! "$!    t''' $! L㿘!"@&*@ @ > bQ{ @ܐ0!@# ``\ 2` * "D2@ &*` ?# @2@ &%s: tbuf overflow 㿐 4`@9%d@ 2p`d6 4`@ ,`t l@XP*@ @ 2* *@  F2l@P@ * @X<#@@  2@@* @H2 @@*` $`<" @ ' *  +  + @ +   3 @+  3 @+  3@(@``B#@ +`+`3  0@+  `B#@ +`3 +`a\ 0@  $@` R  $`$`$ `?$`耤 Fbh@bX* @   @      *  2  %(  > Qڒ`,2  @@*h@ P*`@ d+`3` 2@ `2`@@ ?"@$@ $@ 1"d@ l"`@ h`t "l@"X"P*@ @ 2* *@  邕2"l@"P@ * @"X<#@@  2@@* @"H2 @@*` $`<" @ ' *  +  + @ +   3 @+  3 @+  3@(@``B#@ +`+`3  0@+  `B#@ +`3 +`a\ 0@  $@4`~㿐H /e * & !T !D€!X !D€!\ !D€, <$@' `, ` * `*,@ B`$, 2 , 4` @ <"@ ' ,` * *!4@!8@ d @ !\@ `@k H 0  H 0 %s: reset %s: abort commands timed out %s: disable commands timed out 㿘H /e * &  >PĐ#x  L ;6 '  @` @& >#P ` @ >#P `6 @ H 0 "x!\`' 4 !!8@>3`>X!P @* 3 30@   %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x 㿘<%6`6`6@ B&@ *!\*2`@ 26`  23@@ 2`3@!\@ `~ `$@@>!`@>!O 0` ?>@ !Ѐ`>@ "O 0>"0 Oie: bogus buffer calc㿐!`# !d!D€`X!d  3@^#< &>Nu#!,!,&`\* @&  "H,`"  `` ?  X  @ + ,`!h"   `@  ?+ `X @6 ,`!h`X`@*  B "@*`2 *` 4@,`  X!h?* @ ` 2`"P,`"  `` ?  \  @6 + ,`&"   `@  ?+ `\ @6 ,`&`\`@*  B "@*`2 *` 4@,`  \&?*  ` 2`X,`" %`` ?  \d & lh& ` & @ &  (,`"  2` <%' ! `*` `* *@ ?  B \!j X"  !\b<&bD?&*b8&b@2*&  3 B&"@*`2 *`!h 2%s: multicast address setup command failed 㿘6@#6`<c! 6` T*` !@"p`**` ** 2`@ 6` B &@ **2!\ 3 # >@ 2 > N# %s: configure command failed %s: individual address setup command failed 㿘!`< B#$ *`!\*`2  4`4"4 4 !P ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  Ֆ > 2 B> NY 0J!$ *`*`2  4`44 4 !@!$    > > N9 0*!\@   `P B!j " * @*!\2 6 3`  !\@ ` !<`@ 㿘  x 㿘 H /e * &  a@" 4a @"  4C a2@>a1@ ; (!1 6 4  L L 0,@ #$!P 4 2 4 4 ?6 4  @00@| L L`4@   H 0㿘!,  T&& T 4   @  "   "6 a L  *@ "p*`@   & 2    &!L㿐"@ "@*@ @">+ @ `\2*    @@   ?b L k?"@  (*` @P"" t#!0tڒ t֒ @ &`2Ғ  $@$ @  @  @   @  @  @  x "& & $@$ @  @  @   @      " x 2 &`s  T r  "p @  @  @  @   @       C A& Tј >   x "& &`21  $@$ @  @  @   @  @     `x  & @ &`  ??$ &@   ?y?~t?r0L & & & '     & `    (8&  @  2 & > "@ 8&   & &  $@&@`Ӣ"@ `W- @@2 *`  !"@" ( @@&@ @  ( @@&@ ( @@&@ % 2\ `2@!"D"@$*` ?# @2 @ $ diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKxdcxdxddummystrat㿘 <""> >J!8! "  H 0"& 0 0 ?& 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`> "! ""`(`?*   *  `>`aH@Ř >!K.`+ `6"@`4`>K!`>`F!`6 *2K4``  64` F4` 3,` / (,`4`Ґ"$ (㿘` @z 2" "   C ? .  Ѐ` "@ `$   `   pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrx 0 @X/ & &`T> !ܕ*` &`h>#J&`l + `X  " `t  @]#&`x&`t@#`t &`x&L    &`p>I#@t&L  `t+ `p "@ `, `t =@ `  *``t`4 * `t `o * $`t` .a.&`.a/.a0.a3.a2.a1&`&` 0#\#`    @ `2`t>J6#0ϓ,`  S,,`* * `p  " >!>@ J>J a1? `.a1'a1a. .a. ,`p" a. 'a.0>  8 Ia1? `.a1'a1a.,`.a. , * `p* @"`a. 2#`'ma.#`#\    @ `2a1 ? `.a1'Wa1,`@*``p@*` a. .a. , `p " a. 'Aa. !> h`@uI0E>"t&`0&`4`0]o>`<3-` "@s 8 0 ?耦'?2 '`@2' @?\ ' /   '@z" @?J a4>a,>X!P*,@ `    xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`0@ > !В`&`&`X  6`6`&` X&` * "@ 2"`ȑH /d * %  `ƒ  $  `ƀ >`>!ȔH``Ȑ 6`#\#`   @]   ! !1? `.!1&!1, @*` p@*` !.  .!. *  p " !. `B&!.`B`>Hq!6`!>!>Hf"`Ȑ#\#`   @  2!1  ? `.!1%ڐ!1, @*` p@*` !.  .!. *  p " !. `%Ð!.`!>" `Ȑ#\#`   @  ,  t  2!1  ? `.!1%!1, @*` p@*` !.  .!. *  p " !. `%!.`!>z"H 6`6`6`6`.`.`Ֆ <#*`2 `}2 `Ȑ#\#`   @  2!1  ? `.!1%\!1, @*` p@*` !.  .!. *  p " !. `%E!.`!>5"p`Ȓ #` #\ @k  2!1  ? `.!1%(!1, @*` p@*` !.  .!. *  p " !. `%!.` !>"`@ DG{6`ƪ`0.`23*  `>`ИGg"``Ր` &"#\>: GQ"`Ȑ#\#`   @  2!1  ? `.!1$Ő!1, @*` p@*` !.  .!. *  p " !. `$!.`!>F#`ή ``Ԡ`ՠ?740`Ȓ #\#` @Ú  2!1  ? `.!1$!1, @*` p@*` !.  .!. *  p " !. `$i!.` !>#H@ FՒQ6`    ?#@`2 `̐  " `̀@  `ԑ2  `Հ ~}`~>#hFH 00) `<"  @!0@ ` @"$ @6`  $`ƑH 0? 0  > 2 * " ` `` ( ("` ( ("`` `"`%s%c: crash dump not supported (yet) 㿘?2  > a 2 a*@ >!ؒ`F2a 㿘? 2  @>  2@ ,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * %  "H 0e  w!_  & *`` &!  @є M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @ , ƀ ,` 4 ?`4# @ `*  *  > ` @$   @ $  !2  @㿀?2  > a 6 6M a*@"G ƀ  Ȣ'  @1" ?'n@O"ƀ  )  `6! . @  "   *@$ *@$  $㿘>>   W㿘>>   K 㿘?2  @> ! 260?!*@    *@2   r " ?,` ?( 2` 2  Y ?㿀 D? @2 > `@!2` !*@   T &   (@  <  u& 4ƀ  Ȣ'  @t" ?'@"ƀ  "  < D  " < O& 4 O @ $H X  >  .` 0t.` 0r 02 .`  k.`  Ր?.``.` .`   А?6`   Ԑ?.` 0Y 02 .`  k.` .` .`  .`  .` "6` .` .`0B` .`  0   k` `  .` &6`   2 6` .` ` .`  (@ϐ.`  @, @Ǵ.`  @$ `Դ6`  (@`  &` $@`*   = .`xdnfreexdsubwaitxdcmd nfree㿘` ` \ 02i !. 25!. @z  2^ !. (!.  !.   2M !. > !1!1   2> !1 >!. 2 2!.!. 2?>A" .!. J , *  p* @@. X     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@xdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space 㿘!. 2?>A_# .!. M ,`*  p* @@ 2$>AJ#("(& (?"D X 2`  2 * D `T`*`   H @O< 2"<> Bw !.`.!. `- *  p* @"`!.  |!. |&$($&(( "%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   0-l`0@  xdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq㿘.`*  T*  p )P2!3[ !* !3 @_ !0.!3`  .!005>0?>0  @ @;`@"H * T2 *` T2 *` T2 *` T =*`  T *` !/  .!/0>0P>  @ @ `@ @e"`㿘!0 @ T B B  aS ?  B   `  ? @Ԙ ? ``?  @Ř 2!0- @Ɛ!/ 8!0" @} !0 !/ .`*  p* @`!. "    "!.%s: off-line: %s xdc_resetx t  t@L  t = @   *@ tР"@ `ː ` * x T*` T2 *` T2 *` T2 *` T*  T*   TȐ ? $ t T   t "& T t!> !@Ѣ A T *`  T  b@ ?  T  4 t>?!ؐ *`  t %s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE 㿘!.` >#@  T *`  T  b@Y ` T ` ? T   p` 0  2j !/?.!/"V!2&` t/   * 2 *  `@*  p  8 0 "`0G "2!1C  "`4`0`0("`0`$`0* "`@`0`<`,@`H p 0`@ `< 0+"@ `0!.  .!. * p" !. 2 ͐!. ɐ!1 .!1` ? @ &` ?  .!2!* !0 .!0   4@+ `2 !0!. "!0!.!0!/!. !1  ` ># @   > >#@ >@#xdc_start㿘`"!0!J@ @B !0.!2.!0Ɣ P ">>#  !0  T "!2%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD㿘 T ` @ ` !> #@w? ? >#?>>H `  *`     p   @-  t @ !/?.!/  2 "$  `$  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*  `@,@ &$ 4`  @ 4`   @  @ `,`  ` a >"@,`  ( $`!2 ?  .!2!* !0`.!0 J   ` "6 ?`0`> 6 ?:   0`0 ($`4$`0 $* $`@$`@ ,`H@}`<`< `@ 0*F" !.  .!. * p" !. l!.k  @$ !1`a.!1  @$ !1 .!1 4 7`4 %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] 㿘 #>  c  >  0  D> ` >`a@  @  @>  `> > `  ` ` >|@?>wc !> @6 (>n >  2>> >d H>>a h㿘` ``?` ?`@&`!1 .!1`?&`!1?.!1? X` V `$ + ` `("  @ &`$&` &`(``   @ զ@@x Ԡ@t@V?- ` &`  .2 *  `@.2  .6`  ̐ ?6 `` `Ԡ" @. `@G `. !2 0?. `  `` : `&`@2( ` 4$  &` .2 *  `@.2  .&`!2 ?  .!2!* !0`.!0  %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout 0  H /d * % !0!!/!. !1ؐ   H 0 W #\> =V H@Y >=O `$ >? >=G   , >=? $> >=8  *@ @ ? >=* h    2  t,  @@ @2 p>    #\03 #`=  `40 >#Д= H /d * %    p `  @" ?` ?"`  p  " ?4` > <ې  ?  H 0>X!P*!4 @ 㿈  ` {'> `*`      Q Ұ  Α* R  ǰ     `ְ 6?`!?>#ؓ*`  ` @ `Հ   * @ %6   @ `Հ 2   0  @ `Հ y  2s   @z ``   @z/0X `H /d * % `Ȑ #`#\`,`0 * *  p . p . !1? `,!1!1 !.  ,!. * p"  !. 2t!.   H 0 @yהi$ijjjjjjjjjjjjjjjjjjjjjjjjjjjjjjiih8hhjjjhhhjSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown error >* > > > > > >!>!>!0>!H>!`>!x>!>!>|!>y!>v!>s">p"@>m"h>j">g">d">a">^">[">X#>U# >R#8>O#H>L#`>I#x>F#>C#>@#>=#>:#>7#>4 >1 >. 0>+ @>( X>% p>" > > >!(>!X>!>!> !> !>!>">"rTtttttttttttttttr`rlrxrrrrrrrrrrrsss ttttttttttttttts,s8sDsPtttttttttttts\shstsssttssssttttttttttttttttttttssssttttttttttttttttttttttttttttttttttttttttttttt(ttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttt4tt@tLtXtdtpt|ttttttttttttttttttttttrH㿘\ `& & 0& & & & & $& (& & & & ,diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKxycxyxydummystrat㿘 <""> >6!!(" H 0"& 0 0 ?& 0%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) 㿘`> "!(""`(`?*   *  `>`a@x >"8`+ `6"@`4`>8"`>`F"0`6 *274``  64` F4` 3,` / ,`4`֐"$ (㿘` @` 2 2   * ? А@b@ @   pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrp  0@E & &`T> !ܕ*` &``>#7f&`d&` *`X" ܒ  H@u3 #?ܒ H @  'ؒ  @u$ H H@uHؐ H  @> 7;`0@> H&`p&`l  {  &`h>5Ӑ (@.    *`" `l`h "@ `l 4 @  *@ `l @  *@ `l @  *@ `l@ ` *``l@ ` @*``l@ `  *`ٓ*`h&`|`l`h 0&`t&`x 0 #\#`   @N `x `2  `t " g`t`!> 8@ \6Ґ>6ϐ @0l>6ː h` ">>6Đ >6  !> `@ A60S`T   >>`6 >6 >6!0C"&`0&`4`0Jj>`< (a0" @tn 8''쀦'?2 '`@2' @,X '    '@tv" @,F `>c>X!P*@ `    xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! 㿐`0@ > "0`&`&`X  a&a6`6`&`&a&a*` *   h* @&` X&` * %@ 2"`ȑH /d * %  Ȑ`ƒ   =`ƀ >`>!ؔ5``Ƞ 6`#\#`   @   t "  t``>5!:6`>!>"85"6`6`6`6`.`.`٘ <#+ a^2 a\  }2 &`̐ &``̀  `#` #\ @š  2` t "  t`2`̀` !>"0`@ 5F6``>5@"X`0.`   `>`Ԓ5/"p``ِ`KH &"#\>": 5 + @ " `̀@2 ` ـ@ >`Ԁ@>` ؀@ >" 4>3"  ܑ+ ``ؒ`Ԣ?`Ș@#\#`  @@  t " ] t`!>)#`Ү ``٠`ؠ?ߐ `Ȕ #\#`@   t"` t5`` !>#(@ ,4Q6`   ?#@`2 `А  "  `Ѐ@  `ؑ2  `ـ  ~  }` ~>#H4uH 00) aT"  @*9  >!@ے ` @"$ @t6`  Ԑ`ƑH 0? 0  > 2 * " ` `` ( ("` ( ("`` `"`%s%c: crash dump not supported (yet) 㿘?2  > b 2 b*@ >"`3a 㿘? 2  @>  2@ ,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * % !TO"H 0e  C!_  & *`` &!  @t M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @t| , ƀ ,` 4 ?`4# @ `*  *  > ` @t$   @ $  !2 @㿀?2  > b 6 6M b*@"G ƀ  Ȣ'  @p" ?'2@q"ƀ  )  `6! . @  "   *@$ *@$  $㿘>> И  #㿘>> И   㿘?2  @> " 260?"*@    *@2   r " ?,` ?( ē2` 2  Y ?㿀 D? @2 > `@"2` "*@   T &   (@ <  K& 4ƀ  Ȣ'  @p@" ?'u@p^"ƀ  "  < D  " < %& 4 % @s $    ` ` *  ("@> $ 1| . X   $ $ $ $ $$ ($ $ ,$ $ $ $ P$ 0@~ xyc_startbuf null buf%s: warning: out of DVMA space 㿘`܀>/!D `T`*`   H @o< 2<> 1.!! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   =`0 xyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq㿘 T  ,P d "@0K>0 >0  @  P` А  b@ 2>>/d"#0 /]#(@= 2  T#P"3 >/O#@*` T2 *` T2 *` T2 *@ T *` "@0>0P>  < @   `@c/!#h㿘 @w ` h`x 0 ` l 3 "`h`"  |& @ ` *`<@ @ & |  , *` h*     l*`   $@  *"  ` *`2`  `   @u ? Ӡ` @㿘@  4  TBYa     ? @ '   ?  @ 2@ @8@  2@@@  " T`@ %s: off-line: %s xyc_reset㿀 xl  x  *  2`  * @  `*` ߐ * x ` *` x `  *` x`  `  * x T *` T2 *` T2 *` T2 *@ T*   T; ? $ x T    x  " T x!>  @#/{ T b@ 2 x>.#Ȑ *` x  %s: soft reset 㿘` >!/[  T b@  ? }     h` 0  2J4"E4&` l@ ` *` ` `2  *`` - 0 "`0-4"'`)4 "`4`0`0("`0`$`0* "`@`0`<`,@m`H`0 $`"! h 0`@ `< 0V"@ `0&` ` ? @&`4`? 4@ 㿘` ,  X `" a"  `  2   ,  P%s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD㿘 T `  >.# ? G > .>-I  ` @ @*` `  *`  @    @"  ` "  `  `2 "$  `$  @ "   "    @  B2A  <  $  (`"$ $ ($ 0$ $,`$ $  ` ,` ` ` *  `@,` &$ 4`   @~ 4`  @~  @ `,` ` a >"@,` (@2` 4` 4`9   ` "+ ?`0`- ( ?)   0`0 ($`4$`0 $* $`@$`@ ,`H@l`< `$"a `< 0`@N" $    @$  z  @$   - @ 2X  %s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]㿘 #>  c  -  0  D> `#-`a`  `  `>  c>#>#` ``-@-c !> @#Ȓ- >  2>> -~#>-{ 㿘`@\``` ?`@&`` ?&` R` P  `$ + ` `("  @ &`$&` &`(`` !T @}ِ ٦@}Ԑ@ ؠ@@pt?' ` &`  . 2`  . .6 `  А ?6`` `ؠ" @}.`@f `.0'`  ``` D ``&``@ `   &` .2`  . .&`%s: watchdog timeout 㿘 H /d * %    h `  @" ` ?"`  h  " 4  > ,#p ? T H 0>X!P* @ 㿈  ' 6  0{&  v r n j "0d b  ^*  Z 2T   @jE `  |C @j`0= H /d * % Ȑ #`#\ 2 t  `. t . t"   t  |H 0@j#Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown error [>* >U">R">O">L">I#>F#>C#(>@#@>=#P>:#p>7#>4#>1#>.#>+ >( >% 8>" H> `> p> > > > >  >  > >!>! ht(4@LXdp|\P "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKsisw㿘` @ 2E >X  2@  ?2 &   24 >@` 2- > 2 & >@` 2 > 2   z ?2` > @` 2    z(?   si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p 㿘`     2> > "D"@&e   (@6 ,> > >N>O>>>b`"LP! b@  6`6&`L&`D6`:&`\&``&`d&`h&`l&`p&`t&`x&`|&`&`&`&`P&`X``'>>>>e 8a4&`&`&`&`>>#`&`&`>>>>>!"c@x&`&`&`&`&`&`'j!e &` &`e  ` &` &`&et!@&e   &e>'N!  e" &et>"&e&ex&e|  "  > @0<ex >ex (}"e>>"(8(t`> "8 >"P(k> ">`>@ @6`>9!4 @~ؐ  ?  `@ @! >( 0z  @ si_minphys len = 0x%x. 㿘 "8 >" (,& <쓐si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC 㿘% %t  `` "> (" >@ '"` #  & ! #  ِ >'"si_reset_adapter 㿘> "8 %t>'Ր#%``2" t 4 |r 4 |n 4 4 4 4 4 %4 4  t $ |`$ $  $ |Z  $  t si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO 㿘 ` @>&  p% =  >'h 01 > &   % ``>% А $  & & & `/@   $   @e  &  > ': $$` si_dma_free: no DMA handlesi_dma_free: free while in progress㿘 ` 2 >%Ő"H ">%"h " $`   @e $$ $` %s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x 㿘  '%t#0#P{ d%  > `>"&ג  $> "8 ># &̒㿘@%t  4 %t? 0%t?c0c0 0 000 0 00 0si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x 㿘 `  @%t> % )> "8  &%> &` ? 4   4      4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  >  &0   d* t  \* ` @ *@ l d *@ t  \* ` @ *@ t*  4   "8 & >&!si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! 㿘   %t>%#0 ?& `?# @4``@" `>%#0 "`, `&  p`` %& %'> "8 >#P%4  >#x%  O& $ >$(#"@8& & >#%s :` 5> %g#` `'?`  @0`?c 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` ` `* \*㿘@ %t  $ %t %t   si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d 㿘 `  @%t> # +> b8 &%> $ݖ     ?%   b8  >"$Ȓ <$ % $%  ` d*  >#$  t   \* ` @ *@ l d *@`  ># $  t  \* ` @ *@ t* >  %   b8 & >!$x sw: DMA error, csr=0x%x, reset sw: short transfer 㿘   ` %t>$[#0 ?&   ?$   "  >$L!P@ "`, `h&  W> "8  $@>#$64  >$0!p  C& $ >"А#"& &  5 `   "> )b&>  ?2 * c2 * > 2 *Ȑ " > 2 * 2 *b̐  "b > 2 *bА "bbԐ "b$ $  `> @ *@ \*8 >##ےdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘&   & & @u㿘 ] firm_event㿘` b (H /e * & = ,`>! X :@`@`@ !`" H 0` 2 4`*@.e@@ ``$#$@  `0H 0 #H 00 4`>.$@㿘H /e`* &` `0 @ H 0 7 0 H 0  H 0 > !stdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. keyboarddevice_typeserialstdout-pathconsinit: bogus stdout path %s. displayunknown console input source %d; using rom unknown console output sink %d; using rom > !> #>> - 3>c"!da& & & l& ` (`L`@*?>c  € ?`>"#00?x @ " >`@ 2>>#`"z0( c€ &>  c@>@xc Ox? `J@ 2`J@ :J` ` z$?@>c € >"E#0Ix @ " >@ >>#"-0ۤ#@ϐ>@xc > ""4# @Ð>@xc ?Ox `J@ 2`J@ : ?J` ` z$?`HJJ@ >  >     G  `@`>"c#!ݒ` > ``>>0 > 0 G˔ 0>>!P& ̒bP> > "0 "! >#a> & "a0㿘#> b> `#!$ M $ M ($ M HM> >!b> "܀ " $b@> @"b> "b$b p  $"% h  " h% F #c %˘ ( $ $  $ $ $ p@KC> > "b4 4 h>baȑ* @€㿘!> ! h>b!ȓ*`   €=9㿘> ! h>baȕ*`@ 㿘> "؀  p ( (" h> ! h>baȑ* ` @ 㿘  b@> 1> "؀     2 &" > ! h>b!ȓ*`  @ 6 @  㿘6  * C㿘6  . * > -"aL* $ @@ ( €. 㿐 H /e4 p* & p!  H 008> #`$ `T``L HHo o / 0 H 0 H  p  ?& p H53 H 0㿘> !0€ 㿘H /%4 p*& p H 00)V  H   & pܐ H5  H   p  & pH 0!@(0> Ӑ!{ H 0H( p" pH  㿘H /e4 p* & p " ? ?& pH 0 / h& pH 0  P H L?  @  *@`> #  `€Lے h` >b!Ȑ *` @0W㿐1> "쀢 6 > #     0 X  &" 㿘H /i * * > b?"bH 0 ,> ! c">b@@ >b  J     J  >b h!ȓ*`   € 㿐#> c   Ho o c    cH 0% H/` /1>X  c> ,! $ *c P `> ,! $*H 0 " 㿐  Ho o> #  / 0T@H 0㿘> !@  $@@ (%s: /dev/fb already full %s: forcefully replacing %s %s: replacing %s %s: attached to /dev/fb 㿘!> !< > !@ 25 ($!< , `3> a@ "   ( (>#` > &a@$!<0"a8!> !@ " >  ( (>#Ȓ`>  $!@"a8> a8  > !@ ""a8 (>#`0!> !@ " $!@ ( (>#Ȓ`z$!@> !@`(>#r`㿘> !@``$` 㿘> !@`$㿘> !@`$ @㿘> !@ $   ?widthheightlinebytesfb_setsize: inappropriate bustype㿐```s>>>X `k`& &  (\ `2Y > "@ , 4 0 "N '2  E"G 2  E"A 2  E2  `"6 2  `/> *` $!##$%$"!" J "$   $   %  #&@%& & %& &  qђ & : & >bP@Z& >bX@T& >"` q &@G:& >7"p4HԔJ   J* (J А 㿘   @6 screen-#columnsscreen-#rows㿘  4$` $`   & 4$` $`qu 4Ԓc 4> &> !p!$`\`\1>X@m@$` @m` `$`> " P P 2` 8 $` " Q 2` 8 $`  !> >#|@ax P` 8 #|>a@$` "` 8 $`  " $`$` @`$ ">$`$$` >!T$`@h.>! \>a"c4> @ H> @ L@#``#dd"@@d`?"@0 d0E Ed0# 02   0`#dd2 #> DŽ   "! mouse input parity or framing error (0x%x) ms_rint㿘#> Ǡb  Ӕ> Q`?4bؐ 2  4b4b * : `1*`> 0 8  8  , 4 *: @ $ 4 *: @ $ 4 *: @ 4 $  *: @?4$ >    8*L @L @)   ?"L> +!?J >? *`@ @ `@ 2"> !8"!8 "  8  @۞   "   ?"!#2 > "!8"!8 "  8  $     ?"#2 > "!8!8" "   $  $, $ 0{L 4 "L 5, 4N L 5  0n (dt㿘> Ǡ" 0   $ 0>X  2  $"`"`  @  $ 㿘!> Ǡ"ؐ $   @ $ 0㿘> ǐ" - ~@-  @}@  0" v@ @ 0> ǀ@ (  >  @  "  㿘> ǐ">  keyboard-click?true㿘>X > #$ $ `$ > #|>@Ւb >@qb  , ,kbdattachkbd: reset failed kbd: type = %d, layout = 0x%x 㿘'>XP @k> "b @k> c> ">cؔ)> ͐ %"c@ 9 & >"@P>e(! >ڐ"@> 2" 1Unknown keyboard type %d 㿘 2 > +> +> +> +ᘐ"b& & & & &. 6   ` " N   ># >#؀ 2.  N   @f .  `. kbd_translate`2  - >(*`*`2`*` *` *` *`*`?<2`R`"@`"`J`"J`` }?`"`2 `u?& "(`> +? 2  ? 2  耠 ?*``F?> ,      2  "2` 2`! ?   2 "2` 2  2 `2` \(0P8HXXXXXXd㿘H /e4 X* & X   T  `5>   \H 0keyboard input parity or framing error (0x%x) keyboard event queue overflow 㿘> ##> }c X $ X \> p   0   , 0, 1    8  ̟@\0U?, 2 , 00N 8 J, 0  ʒ  Ac`>5S> "$ T $ X \032 8 P*@ ? 4" 6 >` 0  3@ # > !8!8#  #  <$ 8-L L "L M, L 4L M  Hƒ (0 > *`05 ~1 (0, ' #     * 0       * 2 * 01#-!)!%!!#! $$$ $$$"# * 2 㿘%> `H ; "`H ``@ H /e* &`$  7  ̟@>X!P>e`(!;  #" H 0 > # " H㿘!> # 4& # 2& H @ & H 㿘> # -㿘 ~> @ R# c @" 1 Z#@Րc@A 0 Z#@" 1c@ 0Ր}@ư 0  v@" H #@ "s8# #@ 0@m 00#@" # @ 00# @8 0  -  & v - . "> + 0  0 "  0> + !"> +#> +"?c 6 t.@ "> + 0  0i "  0d> + !"> +#> +" @U6@] Q  M$  2 I& ", 3 H /e4 H* & H x  > >b!  @ H 0 5 6  ., 3: 5 &  @ 3 . @ , M!` @ 㿘> #㿘> #`  F " `1 4?  `0" `17     *`, "/ *`,+ `H /e4 H* & H x  > >b!  Ϙ H 05   ̟@ fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3 `!$: ``> >"*` >#:`2> ,>B#!x? > ,' (`` % >/#>,#!  4> cE 4>#' ? ܘN&`> i > ( B', `@2` >2` ??̀ > 8'@9 " `  !>0>0> , ?> ,a* x @ '塒 `'  嘖 `ѐ H` Ñ, &`㿈@>2` ! "2`J2`8 ` @  <  @ &  4& >",  , , @, *@- $  $ @?@  @6 ,@1  @* ,@% 0`& 0@h  @ ,@@.Z  @  ,@@L  @ ,@@K    @ ,@@<     p.9"Q$` M  @͔@Ȓ ,@`    @ @  >   > ,!XJ p.@  $ *$- `$ * ` $ * $ * $ <H\HHHHHHHHHHHH XHHHH<<HHHHHHHHHHHHHHHHHHHHHfpu_add㿘  ,@,``2   @@r ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  2    $`   $`   $`  B@#@$`@ ` 9$`?  @  @  @  b@#   `?$`$@  @>` "$`>#X b #$`$`$`$`@   , ,` " : 2"5 `2, ) &`` ` `     `    ( " 㿘  `,, `,@80`2 `@@   `,  " 2` " "!``   ` @`  ` " `!`  ?" ` @ @@`&4  @4   ` ! @ @@`&4  @4   ` ! @ @@`&4  @4   ` ! @ @@`&4  @4     ` ` 㿘`   &  & & & @&  㿘?.@6`2 `*  ?  & & & & @x&  `2  2&  & & &  ?& & & & &  㿘?.@*626`@.g<  & & & & @G&  g 2&  & & &  ?|& & & & &  㿘?#@#6*@6/ 6`..7 @ ?#  & & & & & @  @ ?2&  & & &  ? @ & & & & &  fpu_explode㿘.2`&`&` >0 >0:Hp  # 2 &@` 2&@ &` & ?&@㿘``0`) ``(1 ` (`6`@20` 0  +"   "`" `  `'`  '``2'` @ @@'`'`'`'` '`'`'`'`  0    `?㿘@ ` "`` 4` r"@@ "`` $``  2 0`1 ? #$`fpu_ftos㿘@`* @ǒ [N E2`M`4 Y Z"@@V  `@2 9   @& `,@`@2>G#4 @`@"` ` & q "11 #`,`1?*@㿘@`* @h >M'@2`&J  ="@@S  `@2 @ 5&  @& ! @8 <ؒ `@"' ` &  ?1@&1 & 4@`, &`1?@*@㿘@`* @ Q#@2`&<#@  "@@ @`@2 %@   @& $ y `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@  @fpu_implode㿘 >>& &&u&4 X㿘   ,@ ,@   2@` $` 2``        `) , ,0`1 4  @ 4@D``  `) , ,0`1 4  @ 4@D``  `) , ,0`1 4  @ 4@D`` `) , ,0`1 4  @ 4@D. ``c  `) , ,0`1 4  @ 4`      㿘 ` ` `@]`` ``` B : 1" `! B  +`"   B 3`` `   b`    B @ b`+` @  B 3``@ `   b`  ` B  b`+`   B 3`` `   b B `&    b`+`   B 3``    ` ` fpu_rightshift 1fpu_rightshift 2㿘`  & > " `r     > "! ! ! ! ! 1 `_  @   `?@   `$`  ` "2@+(@*@0@(0  3! ! ! ! ! 㿘`     `8"  @ 7`  7   /@+32*@@/` /   0@32+*@(@"@"""""?   LL     diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKWARNING: matchbyname not valid on sun4!%s 㿘>X   >`@d  `?"8`>`"`    9F (fɀ  ( 4("@/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter properties`%>X *>!>  @_w!> ,!(> "#$ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ t >А "@>@_R!x!> $ H.  \ d@) ` z >@ h#0  @>@ c@ > ֐#P>Ȓc@@ 2> ̐#  > Ɛ#$?> # , ,  0Ԃ`  ", >ɐ ( ?P@@` ?, ,  0Ԃ`  >  p@L?p_ ?p`>"@@  2 >@m>@`Ȕ 2>>  А@̒`Ȁ 2> y!> ɐ?* > "!"  >  =@?P` ?P*kernel not compiled with KGDB 㿘'> ٠@^!%> ` ` @@M   }L -y ML`1L L` @ / 2*@*@L @? ``L , : X`L : >  L?$` $`> `P`  "`P L /̠ @,@  ` 2L -  L c">  d a"> 4>  L s>  bh "bhbh "bhbh$"bh>  8۠ bh "bhtwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecd㿀!>X  2N`> "0' (''ː`J@ , `ÒJ@ , `  N@ x>@N` d2>>"> &""> &" . P?& & & `"P N`>ʒb ِ@g[#> ?`P& & &  $`PN@>N` b Ɛ@gH`P&  & /&  i l$*`N` e2 *`>"#> &" ?. `P& & &  $`PN`>N@ b @g`P& &  :  sN` d t r> ">  >S 6 2N>>"> &" ?. P>& & & "`"P 6">"> &" ?. P>& & & #`"P 6# . P&  & & "P  >"> &" ?. P>& & & # `"P&& & & `"P  > #> ,! LJ 1 :  : N@>N`b @f> P&  & & ~"P f@N` d*`>#8> 6#8 . P & & & f"P*`:  l#*`N` e*`>#@> &#@ ?. P>& & & #H`"P 6#H . P&  & & @"P:  s<N` d t r4>#@#> &#@ ?. `P>& & & # `$`P&& & & `$`PN`r >ʒcP >N@b @f`P&  & & $`Pbootpath: /%s%x/%s@%x,%x:%c 㿘> L!N >> ! B  ! < `>̐! 5`a N 2 > -!؁> H HWARNING: %s map is bogus, using default 㿘>X  ,> #  '> #|@ ">@bN  >̐"  `"?@` &` &@L *?Ѐ &@ $L 0` &@sd-targets㿘!> ,!䀢  > >> #aL $!> !L.  st-targets㿘!> ,!耢  > >> #al $!> !l.  cpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configured@ > ""<> "h$#>X` W >Y`H 8 > #(@,  &> <@ <@ *`: * @`H *` > !0@"  2$R  $ 2 2 >ߐ P' > ` '6'> ɀ "a>ΐ p` `@>@`>@_` `>͐  > @> #`x>ΐ >"`''U 2`> 耢 `\ ` [ H o@@@>X" H/ />X @Zܒ'H@=H 0PROM sync command㿘>l#%d㿘@YI#> !>Τ #@YAސ@_#耢  #@`ѐ .,%s at %s %saddr 0x%xio㿘`" 4>   4 > 0` > >Β }  no PROM root device㿘1> ! 2 &!@8 2&!>!0name㿘 " >Βa@@^ؒ @ >ΰ reghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector 㾘!@Z >Βa@w!?>͢ @?  @>@^na " @bJ  >> ,"ߘ [  > ,>ΐ"(Ә & &@a &  ,Yi>ΒbX @: ? &   >> ,"` <  & (>ΐb@! @?"  >> ," <  &!0>X  2?@ $@ ? ,   >ΐ" 㿘`@] `?**=Hled>>==8=======virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error*8>X>H======eccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsP'>X  !> > >> !@3b` >>!@@a@a>> "pa@ 6 @X!D>͐ 5>'̐ @X!D> >ʐ b'''  2>>y"x!8 !8''  2'0>>"!L &@s 5> >͒`@R>ͤ`@]& @X!D>''''͖ @_ >> ΀ > Π@X!D>͐ >''''쳖 > #   >ϒb@' > "b4@/> a> "c|> "> ِ ' >ϐ"U'E  >Β̐| 2L S >>͠ @y  @Ӑ>@\` ;>Βa@ɐ @\ 2 ) ">ϒb@\>ϐ@\bЀ > ,> ,b "b> ,"  >ΑH 0+>Β'# @ findzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%d㿈!>X  2&? "<  "<@ >"8> '''#[>   ' '耢 26 ? )>+@^ `>5b >;#@P c@>?">@N>ϐbР >  #!bX@( pre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory 8>X  >0 > ,!$ > ,!$ $ !`t > #  " & 4%>р !`0$" > !x`N Q>` $`$ @` A >ѐ!`>ѐ!ݒ Ȳ f@>ta >y!>0>">!l!x @5)`@^     @  $$    >N">"8WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d 㿘>X  >Ґ  > #` €> 0 Ȓh 㿘> #`€㿘> !ʖ ?" ,㿈  㿘> #``@㿘> #`@@search_prom: null nodeiommu㿘 >!>Π!`Ð@Z  Ր >>"`!@Z %>͠ @I >@Zxa  >@Zpbx ƒ 2 >ΰ WARNING: opennode not valid on sun4! %s 㿘!> #` >Ғʐ# `@ #`@ 㿘> #`€8@ 㿘> #  8 |@[ |€0@' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !0> #` `  @ >>Ӓ`&@`&@&  @  PROM exit failed㿘>X ? > # x"> # tPROM boot failed㿘>X ? > # x"> #`d@>֐"㿘> # l㿘> 5!%! > ,*" bp* `@`@?" >  `@$> $ >   : * $  ?2 @raidrdstxdsdxy㿘  > ,"0,`@[,@^F ``> ,? > ,0*```> , use one of: %s[a-p] %s㿘@, $> 3>> ,a`(> #@ >  `(  2 >Ԑ 8   2>!؁parsedisk㿘`J @? , : ?.> ,!Đ@X > ?2&#@ "/,  @Xߒ  2q  > *?c *   *` & 2  @X  Ԑ?  2,no memory for mountroot_hook㿘  v  2>ΐ"@@T) $ $ > b<b< $" $ "b<%s%dsetroot: device name too longroot device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right >  P?`'p> ٓ*` `@ -> 5> ,#!? 2  @2!>Ԡ"Ȥx2` `  >j"Ф 'p> 5؀  > "h> bh "bh> "h ">" >`#  a  '>x@1  @]:@Yΐ ?L@ * x ,@ t tx   t >Ԥ  G>0 p >@ ;?9'pT# >`#  bHFx@ ޒܐ`>֐!l*` ?'pt? @2  `@?`v# @* ` * 'pp> 5t> 5%"a9"ᴀ 2,( ? ,` **` ? 2`   2 ` *`@*@ > 5%?> 5"!'pp> 5 "! h> >Ԑ#(aa>    >>!T> 5> "af"> 5!>? 2  c2> 5 >#!ؠ #(a2> 5#80L@0I!?&!2 2 ? 2`  2 @2 2 2? 2`  2 @2!#!"? > 5a@> > 5!"a> "<  2> 5a2` `  @ VVV\VPVV %c㿘  ",> @ ">  % !>  #    >6!,@ >֐!?-0ѐ!ذ (0>ր >>!0Ð!,@`config_attach: device name too longx> #@>Β`1@XJ@XG >" @[@Z@Vg 2㿐ɒdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKcache enabled 㿘>X <x> ""|@>   @ > "  Т@ * Њ@@ Ъ@@> >" 㿘> > >  " * > ""| Ԃ Ң  Ң Ң> >" s"㿘!> @O Ģ @O ܔ*>  *@> "b|> "  Ԃ  Ң Ң  Ң Ң Ң>T "`"  pК@ `к@>a  "`"a>. cache_enable: can't handle 4M with hw-flush cache㿘>   @>  > ?* > > 4""|" !"x @   ТA0ТAЂA  @ @ @b :>! !$ >` "`>"p  > 㿘!> @Ok Ģ @Og ܔ*>  *@> "b|> "  ԂԢ> Ā  ̒ @ 6  ܐ ТA@ @  > ܀  @ 6> ТA0ТAЂA 2 @ @ & > >"` 㿘> >>  " ?* > ""| ҂ z a ଔ 6a Т0ТЂ 2  & a { Ң> >"r DVMA coherent 㿘#>``@N`@N`*>  *@> "b|> "  ւ`̀  @  > ТA@ @ > ܀  @ 6 ТA0ТAЂA  @ @  ֢&Ђ >>$!`> >"` > ҄ >`  > Ȅ `8   Ģ0 ``8 ` Ģ> Ғc`>X"`* * 8>8  Ģ > Ҕ>X"* *`* 8*`>> Ȅ 8   Ģ@@0 8  ĢA@> >`  Ģ0 > 8  Ģ 㿘#>a >'> Ȥ> Ҡ `2 @N "@`  . $ Т첆0`" .@ ` Т 0c  2 `6 6 z `?06>> ଐ#  ࠄ8 "  Ģ` > Ғc`>X"`* * 8>8  Ģ@ > Ҕ>X"* *`* 8*`>8  Ģ  >> Ȕ> c:? "c Ģ? 㿘㿘> Ȑ`  >  #  #>``2@M_# @`.$.@ "` ТB@ 0c  2 `?6 6  `?0c  2 `s6 0\  Ơ  ƠƠ㿘LO>>8? ? > Ȁ2>6g Ȅ o ??  Ģdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map> 22   ? 0 (  > 22`  ? @0 ` `?> 2*  > 22`6? |> 2* ? @ `2 ?@ (@* @?> -H2` ? @ `2 ?@  (@* @> 2*"?{> 2?㿘@2  ?6` " ` @LX&O&` <* & 2  fp align without being the FP owning process㿀`K   2` 2`> 3 ?`  @ K 2  ' 4`H*   '* ?@ Ka  2` *`: '2`  ` '쀢 4`H*   '* ?@ K>   4쀤`  '>!> 8W`N!(2 !( *`='`* 8"2   ' 4`H*   '* ?@J   2    $  4`H*   $ * ?@ J  n JbJɔ  X"7 *  6 7?7J G`􀤠2 !( | "2   * !("@M!(012   * *  " `H  J  2    * *   " `H  Jx  㿈Jh  2 2  2| Jz2   ' 4`H*   '* ?@JH `` 2` *`: '2` `  '쀢 4`H*   '* ?@ J#  `7 2  `? ; `*> H€( % H  2   * *  " `H  I `      @   ?"@ ? 2    * `,+?%     $ (, 04 8<  @?܀             ? 2 2 * ` `2i `? 2 * ?2   8"  diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interrupts㿘 > > "@bx> > 8А"  > aԐ   "a>"8 > ""ԁ㿘> #  > 3 > O> L 'JL > Ho o> !"!̑H 0 *L  > >  LJ` *` Async registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmi㿐!>!8''€ 2  H>>ޘ  L 8}3  H  ?p>>ސ `s> Ёintr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%x㿈Ho o> !ؑ:  >ސ!h  >X>X  7> 3>X 0>X. `!`>"!L>"!x" : ?.) 2 @2(R@"> 3?).   (R>#\#`#d!. !@@2"&`H 0 intr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xx>X 06` . !@cHo o> !ؑ:  >> 3!.  >ސ#p[>X  2>">"!L!x" : # ) 2 @2(R" @ ?).   (R>#\#`#d#*  q8  '''  N@-~   `H 0setrunqueue㿘!2   > >!H * > Βb+ "H & & " "@remrunqueue㿘!> H2 8 2 >"> ""` +`"&   * ( Hdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cacheunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory 㿈 ?H@W 5>X ?H?L !>X > > 5"b!0> Ȥ > #1>k>ߓ* #@͐ @ *@  ` >!# @")> 3>#@!` * * #`+>  `#\a ?? "a>#h3> 3'!`ad@F@@ :@  Jk&ad!` ad@Fϐ@M/a/> ȑ,쀤@  JO !` #\     2> >Ɛ#  `4젤@!`*a `#\ D > 3"aX#> р??$c!> ?0 $#>   > 3`"!\>#Ȑ #cF" c@#>#> #\  ߚ > ̀ "c>y %> Ȓ`>` @Ǔ*@ > 3!`!> XIadJq㿘%> 3d  > 3!h> I@F8 d$d1> 3!`  d &!` &!`!`  &!`!` ̓*`#3@(!`$3&!`!`> `* @Fd@@F$d!`> * &. . "`d㿘!  !$" ! `@Oѐ " ?   ? !,   $`!, ?&!,!(  #>aH#$a *&!(@GQ P$a= #$H$$$$,&㿘`    -> 3!p3> 3alal al  d > #$$! ! ``H @ !*@ `!!#!  'X'\'H'L'``'d` 'h@*@ 'l`?P'p`0't!   0'L'DxǀDDز?@._ HD ?E U >&>& DD="c"@ `$`H$`$`$`㿘D@.9 < @`23   ", ` ` !$$ `<* @  #` # `# `# `# 0`# H@  $a  a ?"a `?" @& ?WARNING: not updating battery clock attempting to power down... WARNING: powerdown failed! halted rebooting 㿘>X ' ]> ""h> 3x > c > Ґ!"cg"x(>M4!@H/` /!">a@>aG"` " >>!hV>!>!>!  >  s*a  @> ! d*  -> *!!* > *!> !㿘> 5!"2 > ,* "@p*` `@ @(> `> c *@  * $ $> 3> 3"a">   dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @%p:%d device bad device not ready area improper i/o error succeeded error %d 㿘>X Da1> 5@!?> 3! %> 3 !? 2 2 > ` p !> ,2  bp*"@ `*` @>` 8?!>Z @0`2` `*`" * >N X@(t@(W> `>* A`> "> >! >  = >0 h :."@ @8>  ?- > p5 !> !@Ζ !!@!>  @@ 2 4`  צ  " >#,  > x0> 0> 0 > 0 > 0> ےP`pFrame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p 㿈B.> > 0`%>  0> < H  $ ( ,#\ 4#` 8#d 8#h 8  4@4 " 0mapdev: zero sizemapiodev㿘> 䀢 #> ?x"` 8 `>!@ @ ? ">!X`  >X @ @ *@ . >  ` `& curproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace 㿈> #`">>`4"P#> "h#> Ƞ` > "x    #\A>ڐ" > *@ "Ӓ` *@> 0> <"  $ ( ,#\ 4#` 8#d 8#h 8 2`># g0 panicw: case 4 w: unknown case %ld w: arg not allowed 㿘N@  t>0``>0>8 P> `0  p0 0 warning: ldcontrolb called in sun4m 㿘>X  >m!  H/` /> #`2a >X ` Bϒ$` H p@` * ( 22#  *@ `  `" *`0*@2@  `*@diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘!$B P 㿘!(> 3! B! diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCK? 0        mmrwmmrw: out of space in kernel_map㿘?  2 @а #> a !> $!`!! a ! >!>   `$a>k>  ``$  2`> h ` ?``?&@ &`>  ` 2 @` > D*` ` @9 %> Ȧ> ,`#> ڠ` `>   ! @` `" @ 8 ` 7`@@ b`` ?G#@>  ?H @ > "X@ > !@ : @` 2 @"@ @ 8  @@ 8 `@? ڐ H *` A &`> >X  $  \ ` %>   > !>   *  @A$> ` 쀢@ 8 Ԕ `  "X@? 2  @ !> ! !C $!l0Lp? ->X   㿘> #  "  @ " @  㿘#  Ô &?R, ?㿐#@2> #| &`%> @> #|@> ΓHo oH p@  $> #0  c'@'  #@Nc@ܰ 0c@c@m 0Ҁ` Ho o€H 0 @` &  G 'Ho o H 0Um`o_  X xHo o H 0 @2_ ^A`C3 2SHo o€H 0@F @ $&  >w2"< Ho o@H 0> `% ! Ho o@H 0> "!& "    diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe map㿘> !\@㿘!> >k>  ` b  찒 >! @# ސ ` @!2 㿘>k>  `VA2PA: Asked to translate unmapped VA %p㿘 `#Ђ   ?.  $$Ң``  ? 1?`  ?1?** `  >?.  #@e 2`( $(2`  ?(:`  㿘>  0 Ҧ`z㿘 @   @$@ :`$@ *? `$ $@> > "━"@pmap_page_upload: no memory?㿘%> > " H  5#> Ґ $b  >!Pb> "㈒, `@> Ȕ @㈓2@ b "#> b > ِ!,     @  >   2@2^ b > ف> H 5 > >kd2 08@> ӓ*     "  # 080??  > ӆؑ* d( #mmu_reservemon4_4c called on Sun4M machine㿘/>X  >v#> %?> +?"bX"!2 @> %?> +?"bX"!@H4*` > * `⌀`@Д`> 3a @&> \#a? > >  @2 4  , @ 2`> 4 ` * 4? Є Ф>  전? 4&@&mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry type㿘 !Ђ* >`<  `T   Т@Ђ ```>0 >0> p>"@Ȑ!h>Ő!@>꿐!`< `T  mmu_setup4m_L1: unknown pagetable entry type㿘?. #+ `$چ ` ( , (> (@ ?( @ ( `  `  (@ +  z@???$ ` @ ` n"` ?˰ mmu_setup4m_L2: unknown pagetable entry type㿘?.  @, @؆  " " > ?(   `   @(@ +` z@??  @$  - (  ?԰ mmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry type㿘?.  ؆  ">  >`* @.`@  z@!(!X? me_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptes㿐> # ,#` "`" "@$ $  "& $ ` $ `"&`>  0,> Β ",0 "04 "4.`$> # #>釐" `2> >逐"0 @2>y"P` "`" "@$ $  "> ΐ  & >  0 4 0`" 0" 4 * @`$*` `2 >R"p* @@>J"1 @@ )`>:>X  2``"Ң>Ю@>!P € >X  2   *`* #@ * : *` >X:l>X    "Ң>XЮ@>X    Ҫ`  Ҳ` > #4Ā# :>k ?(` 2`@: @> ӗ*" @   @  #@  &2`@: `2`?>   bؕ*`@ * @8 @" ($>  @ !>X ` >  >  * *`:  Ҫ`> `   *`* @  * : *` Բ`>  5  ` "` $`  "@ @$ ` $ `"&``$.* @.  2 $ 4 4 me_free: no segments in pmap㿐> .`c0"* @+   $* `>X  2+ * @+ : *` >X   Ҫ`  Ҳ` > #4ހ#  :> >k ?+` 2`@: > ә*"   `  @2`@: `2`?>   bؕ*`@ * @; @" >  `` "` &  "@ 2> >  *`>   2``""`> " "@> `0`0?"`0`""`> "#"@> `0`4?"`4""> ѐ# " "@" > `0`, "`,㿘 0 6`*  $* @6`` ?*@@= >   @ `5 І@ "0?0.?@H /f * ' > ْ# >X  Ү@`> Ҷ@`> #4Ц@>  @`H 0 㿘>X`   0 4H /f>* '>x   t #"x+: |@\@"|??""|`> ""|> | t,` "@!  `@    `0&`44>X #& G&  @>!X $    ?>X   `> `` Ъ` > `` в` ? 2*>X  - - : %*` *  аH 00 !>!` ,,` p: @  z@">!X "Ң`H 0ctx_free㿘%>X>攐#H &"#>a` "aX7"aX "Ң`Ң6># @@>!    >7 ">@@>!X  "Ң> Ҫ@>>7   "Ң>Ь@@>`x$"`xpv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULL㿘7xH /f4 * '    H 00 @  `2> ȓ4`*` `$* @4` ?> *   >    2>X>!  2<` <`  | *i$@ % > "h`x@ `|@ X2 `?#@?#@(M` Ҫ@@>!L@   Ъ@@>X + 2  Ъ@`2  в@`> Ȁ` <`  <` ?* @  <  @& *@ >X  2<` <`  | "@    $ " ?$ 2g @H 0pv_syncflags: no segments㿘6H /f4 * '    H 0_  @ P4`*` $* @4`` ?>0 0* @ >  "6  Ъ@@@@>!L@ Ъ@@>X`  Ԫ``Բ``> Ȁ` <`  <` ?* @ 6 <  , @2%  @H 0pv_unlink0pv_unlink㿘  >֐"0, +>  0`  "`> & "D&     & &   ݾ& *  "& ` "` &  ?A& > `0`  "` >䝐"@ 2  2 > ""Dݕ   !   > b|   2 > `0`"`  & Epv_link_4_4c: allocation failed㿘 ` ` > `0` "` & & E& B& >  0` "` 2%! " " ! # 0 `&   > > b|  0>  "!> "D] 2> """ " " &pv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%x㿘5HH /f4 * '    H 00^" S"``>Ԑ!p $ > "h`x ``|*5@`" ?#(?#((@"Ң>!L@ 0Ң`  " >!㡒: ` & *@}``  $` "@` ?$` @`2`"H 0pv_syncflags4m: no pte pmap: 0x%x, va: 0x%x 㿘4ŪH /f4`* '`   H 0C "` `4 2 >#䟔"" Ң pҢ`  2 `<    @>!L@ p Т@` ?|2%` "H 0㿘  >"0, +>  0`  "`> & "D&     & &   & *  "& ` "` &  ?A& > `0`  "` >ؐ"@ 2  2 > ""DВ   !   > b|   2 > `0`"`  &  pv_link4m: allocation failed㿘 ` ` > `0` "` & & C& @& > "DĒ > >|#80 `"  ` 2" `  "0 `&  n > b| 0" 2 $$ $  $ $ &㿘3H /f * '  `+%>X  "@@@@  `"Ң> Ҫ@>!L@  2 >X   "0@H 0㿘>X (!> $  >X  : > "c4@ʞ@pmap_bootstrap: unsuitable number of segments (%d) 㿘>X 'D'H`'L` L>  " > > ̐ "`L> 3"a> >3> Җ &c5> &>;> Ȕ>'c$%>> ˖ bd'><> ")>d> "D+>! > "->`> L"/>t> "d> ?"x>>>!>#>> > "`Ș"Tb t`7> 9> > > > > ?&8'!!" "Ȕ "` 'L " "`+> > А "`$  T> > ӓ, c@  0"  ?> `, * c 2 ?HےLL> *`" |> * "c0@4!>D$ t%`*@7> ѐ" &> ْ#"#"`5> ΐ" &1> Ȑ  > Ґ@ *  "h@ @h"@> "?> "┐`$ \   $ x$ \&> c$>?#"?"|@ >X !2 <`  <` ?`> #4` $#>+   ?D4`D`  6 %D &%`% `""`% > `` % `""`>  00 "0% 5 5   ? ?$5 @* @2`> #4  ? ?$@* @*` `   -`  @  > c4*  @  Ф@ @ L>5 %`% `""` 0,L ",  > \ ,  @  >  䀢 <`   ?#8  ?>X >  Ь@` д@`@> > \   Ҫ@>X 0>2#h+@  #Є@ Ф@>  @@ rp->rg_segmap == NULL! 㿘>c 3> &a>> `7> & >>! b1> ;> &#'bd+>aD> >"b l/>9> '#$> )> "bx > ""> > >!>#>%>'>->"`Ș"P> > > > > ڠ!bX@ > 5> &8 b! #`D"" > Ж" "$", `@3:"(> Ԑ#@36  T3> Ԓc> ӑ* 0 " "@  ?* * c"@?#>>  |`\$`t1> *`& @$@37> Ȩ $ `\* >  ""  , @:5$`p2 <!> ΐ$!@2$9> ː'"h@2$5> ΐ& @2$  * !> "cH $(: $,``pz( $`+"h -``$ِ`(-`@ 2  cz@%  2  >೐!-` c $ -` - @*`  ,2 @ , z@?$@ ``̬  N> "ahah"`쾐> ?> "">% \   # x% \&%>?#>"`@<"`|4`*`  $* @4` !@  *>@ !2`  > b @ > cH@ >X>X 0@ >2#h@ >X>X  <`  |<` @z@@@ ɓ4`%>  !> " >> cH" " @㿘 "Ң!,   $Ң`" p2  ?!Т@ $Ң`㿘>X    >   +> $1+ 2   #  1! 2   @ 1! 2  ,"@  & & ppmap_init: no memory for pv_listpvplL1 pagetableL2/L3 pagetable㿐!>k    > Ӑ"ؓ+     " @>  +`@ >k*@  `,  2 >J#Ș 6> > Ӑ"ؕ+    @  "@ " *`@ > >"D  c#\  >X > 3 "a!> 3!> >"c$$  #\> >#\"`!!  㿘>X  > " ҂`>!  ` > #H>  "@ 2@ @ 㿘> Ȁ@  >  @@ 㿘  " @@18 @@㿘 " t++0& >X  & & $`&  & !& >  "'& (& ,  (*  z$ ( > *  c#z> & 4㿘   ? & @ "pmap_release: segment list not emptypmap_release: releasing kernel㿘H /f#>X* '#>X`    ">f#    >]#H 0 "`\ "`   >   >@#>  (@"& ,& (  " 㿘 V>  > ".u> "x)>X   "0@H /f@* '@'  6` ?`6` * ** :`* @ **  $* @ ` @  H 0>X   "0@㿐. $* @@ / @ `  Ҫ@>  &2  >!P €[@!  U@ @ O> 2H  2>k>!L@>k ?,` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ <  @"   Ц@>  @@ `(,>X ../ @: /  > \  Ҫ@ >  Ю@` ж@` ̒ ?, 㿐. $* @@ / ~@ ` z "Ң>  &2  >a i aP€d@>!  ]@  ?@* @ S> <2E?>!L@>k 6` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ > @"  ? pҢ`@ ?*   z>  @@ >` ,`pmap_rmu: no segmentspmap_rmu: no pages㿐. $*  E / >ۇ#8 9 ;> >{#P`@2d>X  2>` >`  | @G@ >> 28>k ?,` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ Q$@>  @@ `-, "% ? , # "$ >  &2@  Ԫ@` >!P €!  @ z  Ъ@@>X`  ````> Ȁ` >`  >` ?* a @ Z> 2H 2>k>!L@>k ?,` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ <  @"   Ф@>X  2<` <`  | ">  @@@ 5->X ./ .: /     `Ю@`ж@`r "% ? , f "$>X    0@"& 0 4"& 4㿐.$*  `  / >7#8  2>+#P "Т@> >  &2  P€c@` ^ ?*   U> <2E` >!L@>k 4 ` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ <  @"    pҢ` ?*  z>  @@ >` 0- >X   / . ! Ң``/   z> "ҟ% ` ? ,`  " Ң`(.@z@@ "`҇$@pmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%x㿈> Ȑ`>k 4  2@2: > ә*" @   @ #@  2: 2?>   bؕ*`@ * @ ` *z` 0H /f4'* ''   H 0 0Ҋ@' ?4`- $*  4`  `?>#*`@ `2>#-  7>  2` >X  @<` T |Q<` @ "&@ ? - ؒ "$    Ҫ@>!L@0  Ъ@@>X *2  Ъ@`> ȑ2  в@`> 쀢` <`  <` ?* ֆ:>  ؙ `@ Ц`W>X  2> >  | @L">  2> \,  Ҫ@>X  >  Ь@` д@`   ?+-  >X  Ю`ж`b " % ? - V "%>X    0@"$ 0 4"$ 4> "D9 , ' ' ' Ҫ@H 0 pmap_protect: last segment㿘 0)] @H /f * ' @6`*  $* >X@6` ? ** :`* @>!H8 ` + @@ ` 2`ز>   2 @ >`  |>` @Ɣ@*@">  @@@ #  Ҫ@@@@>  0$   "$(>aL "(@,Ц@>  @@瀦@0  Ъ@@ *2  Ъ@`> ȑ2  в@`> 쀢` >`  >` ?@y* ҂*@Т@ @ o@H 0 @pmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! 㿘(> Ȑ` >  .@  !!`  @6` ?6`H / * ' *`  $*  2 >r H0> >k p0x0`+  "`  >    >X   >`  |>` @@ @Q*@F&@@@   Ъ@@@ @=0 2+>!L@%Ъ@@>X *2  Ъ@`2  в@``쀢` >`  >` ?* @ @0.@ @H 00 0 `" H 0pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTE㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?>   bؕ*`@ * @`'` N 0H /f4* '   H 00"҂'x 6`- $*  6`` ?>#X,`@  2?> #x,   " Ң>!L@ pҢ`>` @   ":># @  z@ 3>  . -,` ! Ң`,` z> "ڒ %@ ? ,  " ( "Ң` (-@z@̒ "&> "Dκ 2  ?% %%"ҢH 0㿘 }{j0t&"H /f * ' @[>X6``+   $* 6`@ ?+ + :`* @>j!H8 ` *@  2ز " Ң)> Ȑ  '> &: 0@"`$>`  <@  @  0 (`" ( >!L@ pҢ` z @@>` @H 0"㿘&p>  >  .@     '> 0` "`H /f * ' 虒 " Ң<  2p>!L@p Ң`"  ?0` "`~H 0pmap_enter4_4c: can't fail, but did㿐>  䀢 >`  > 3i > 3! *  63 > >k `6` 2`@: > ӗ*" @   @ #@  2`@: `2`? > Ӓbؕ*`@ * @ >  ?6*   @>    @@ɖ  >P"@㿐6`,` $6`*  `?6,@ H /f * ' 5>  @"\ @6X #@  H 0В0G >k ?.` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @    Ҫ@>!L@  ,  @ j@  )> Β  >4   - `\? Ҫ@>X   Ю@`ж@` > #4?@ Т>  `@H 0 㿐$66`*  $* @6` ?H /f+>X* '+>X`   0 4# 2  :  & & 4   & 0 2" "  "&D%-  ?>  4, @@> #4 "*    &'$@ ,  - >    ` 2>` >`  | &    Ҫ@@>!  @   Ъ@@`  Ԫ``Բ``> Ȁ` >`  >` ?* 6` #@  H 0 < ?& <K >k ?,` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ ͔` >!L@  , < & < @ /@>  ">X   Ҫ@0  Ъ@@>X`  Ԫ``Բ``> Ȁ` >`  >` ?* @>X  2>` >`  | $H 0 㿘>   㿘!> Ȑ  6@`  >    첆㿐@?x*  `@` <@6> 3! 1> >k `6` 2`@: > ӗ*"     2`@: `2`? > Ӓbؕ*`@ * @ >  6* @`">   `@0@   >ΐ"    $ "  $ "pmap_enk4m: can't enter va 0x%lx below KERNBASE㿐=6#@ >"ѥ6`*`  $* @6` !@H /f * ' >` ?* @ 2S  <H 0\0]D >k 3 ` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ +  "Ң>!L@  ,   7` /@p Т@` ?*  zH 0 㿐"k6`,  $* @66` ?H /f4* '  " "  .#"$, $ 2> "/  $ ? z@`M  (2 , @  z@-`@`!@>  " 2$@  ,   ,  ? z* 2 -`@  z@k >` @  2\  ?<H 0 < ?i& <I >k 2` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ I  >!L@  , < & <  7` /@ " Ң pҢ`>`   zH 0 㿐`x* `  ``>  6@>k .`@` 2`@: > ӗ*" @   @ &@  2`@: `2`?>   bؕ*`@ * @">  7 >X   "0@㿘>  @> 0  㿘 r6`*`  $* @6`i ?* >     D# @@  !>X  2  "Ң0Ь@@ֆ@) >X >X    "Ң>XЬ@@>X   Ҫ` Ҳ`> Ȁ` >`  >` ?* ւ @ `>X  2>` >`  | @ > Ȑ  ? * *@  &   "(  $ 2`((  2` :`  >  >X2(?*@ o" 㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?>   bؕ*`@ * @ " 镐 ?$  㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?  > Ӓbؕ*`@ * @`2`    S  㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?>   bؕ*`@ * @ "  ?$  㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?  > Ӓbؕ*`@ * @`2`    Ӑ  㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?>   bؕ*`@ * @ " ~ ?$  㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?  > Ӓbؕ*`@ * @`2`    <  㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?>   bؕ*`@ * @ "  ?$  㿐> >k 4  2@2: > ә*" @   @ #@  2: 2?  > Ӓbؕ*`@ * @`2`    鼐  㿐> 3! 7>k>  `6` 2`@: > ӗ*" @   @ #@  2`@: `2`?>   bؕ*`@ * @ "> >  ?6* <> Ғ@hҤ>  ͐ Ф㿐%> Ȑ!>k  6` 2`@: > ӗ*" @   @ #@  2`@: `2`?  > Ӓbؕ*`@ * @`>! ]  ?6@6*  (@ 2: > ӓ*" @   @ #@  2: 2?  > Ӓbؕ*`@ * @` >! "  ?6@* > Ҕh<@hҤ@7>!L@ ФФ@㿐#> b 2 > 3> !h> > "ې $b> 3! :> >k `6` 2`@: > ӗ*" @   @ #@  2`@: `2`?  > Ӓbؕ*`@ * @`>! > 麐 > Ȑ >6* a   > " 0Ң`bz!> "" 0Ң`b z@㿐%>  !> !> !h> #> `"" !hl $> ""f> "b !> Ȑ #>k `6` 2`@: > ӗ*" @   @ #@  2`@: `2`?  > Ӓbؕ*`@ * @`>!  G   6@6`*  ` 2`@: > ӗ*" @   @ #@  2`@: `2`?  > Ӓbؕ*`@ * @`>!      >6@* a `` > " 0Ң`z> " 0Ң`> " z > "!> ">!L@"" 0Ң` z@> " 0Ң`> "  z@kvm_uncache: table entry not ptekvm_uncache !pg_v㿐>X  2i" Ң `">  ޖ@  ">k> !h 4 ` 2`@: > ӗ*" @   @ #@  2`@: `2`?  > Ӓbؕ*`@ * @`   Ô  澔 " ?  0Ң`|@<2> >!L@>  첆"0] \ &>k> ʒ! ?,` 2`@: > ӗ*" @   @ #@  2`@: `2`?  > Ӓbؕ*`@ * @`   2- ,2> >!L@>  첆kvm_iocache: 4m iocache not implementedkvm_iocache !pg_v㿘>X  2> % ҆`& >  @Ҧ>  첆> 2$$  ` *` (`"8> 䀠@:88> " "@㿘>X   >݋ 0 >Ң㿘 H /f4> ɐ* '> #  >d0!`>X   "Ң0 Ҫ@H 0㿘> ">X *`  @>  > c4 * > Ȑ   >㽀7>X   "Ң"  Ҫ@"#ʤ 'Ѭ9> Ȓ `)> * "?$'`# # >    "* @# #  > Ԣ#!@#  `> 5!ƀ" `? 4@  #   > 5!ƀ" `4  ?2'" +> ِ!,      ?? #   > 5!ƀ" X`4">  A/>  @0>X  `> `> #4Ѕ' #   > 5!ƀ" '`4 `@>X  >   Ҫ`  Ҳ`耣 > 5!ƀ"㿘H /f * ' >  >aH.€ '>X  "@  "Ң Ҫ@ >     H 00/ 0Ң`{. 0Ң`{ 8>ք H 00Ф.֤>!H €  "0@H 0 diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF 㿐> Ȓ``  @("`   2 >X "`&&>> `0 > 3"ȓ.  > 3"> # 2 > Ҡ! $!$ *!   "_' L 0, \  0& #> ʀ ဦ $䀦 0 > " ဦ 0 뀦 퀦 0 > ? ?n > 4!h >> Ԛ`'  :  4>! Ő!5 2'`&&     !(  > Ӓ * !> 3a?!$!(>  , 2 '  ɖ   #>a W!(}$a &@   ` >` >!0H` H @  ` "$`>!@V@ݐ  H` 1 @ ْ `X``( @ В ` ?>!Pa$`!, ˈ "v' ] a>ϐ!`!($a!(' M >Ʋ!'  E ' ?  `'&&6 F>Ɨ!AƓ! `'&& " !, 0$!,ƃ! `'&&  K  耢`  ,( @ D > 4 ! ,!l    ,@ "l*@ $ ,`Ԑ$`>   " ,i   耢`  ,( @   ,  >  `" !> *c@>!*@&㿘! ` ` 2 x  xT @ 2??  @$` 㿘\! " text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b 㿐'> Ȕ> #` "> Ҡ!  д>  䀢 >  n @ @   @1. 2! H/` />>!>Ī" ">X >'# @K>X 2H! =#@ >k `7 9! $!$  @   ڒ &( @O @  Ԁ@  > "2  Ȁ8& "  @ܳ + @ !   ``H/` />>" Ř!>?"'`o'`@'     @b  耢`  ,( @  > 4 ! ,!l    ,@ "l*@ $ ,`Ԑ`>   " ,  c 耢`  ,( @   ,  >  `Y"ɡ !> *c@@>!*@'@text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b 㿐)> Ȑ  > ` " > Ҡ! Ѐ + `` `>!t@`  `  x@  > 4apn"ap$Ђ`  h@#Ђ@ `@.  @` @2Z! @3` 2! H/` />>"Ġ>G" ">X >'# @8>X 25! =#@ >k `~Ԕ &! $!$ ~Ȕ  Ԁ@   > "2  Ȁ@8& " (@@"'!   ``H/` />>"H">"&k&  􀌠@b F 耢`  ,( @  > 4 ! ,!l    ,@ "l*@ $ ,`Ԑ`>   " ,Đ   耢`  ,( @ p  ,  >  ` "U !> *c@>!*@&syscall cpcb/ppcbsyscall trapframesyscall nargsp> Ȓ`` "`> #@ @">X> b" ! @">Z##@@" >R#$!$,``0 Ц 3`  0`0`4  >^" @  `8  . `* @@T`2 $">%#`Hؓ,  \U* 22 *`4''`И? ?0 2 Ѐ &`0 &`4$  `     @*@`&@&`&`  `+ @`@@&`0&@&`&`A 耢`  ,( @  > 4 ! ,!l    ,@ "l*@ $ ,`Ԑz`>   " ,   耢`  ,( @ k  ,  >  `"P !> *c@@>!*@&@㿘!$  耢`  ,( @ 6 > 4! .!l    ,@ "l*@ & ,`Ԑ`>   " ,[   耢`  ,( @   ,  >   Ԕ!> *#diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.herror == ENOLCKvm_map_lock_read: intrsafe mappagemove 2㿐> #$>   2> >!"!>  €>    @㿘>k `@O 㿘> Ȣ ` .i >  X 2&@`4  &@>k ` @. "  㿘> Ȣ `@.@@>  X `6@   dvma_mapin: null page frame㿀> 4!x >  #!x> Ȕ @  8  :@ @ Ho o > !x##\?@ #`#`#d ?0#!x? @#\ #`#`#d H 0`; ??-> #$@ 5> >'# >X*  'љ  > !>   @ ?@  ?'>a 2aH€dvma_mapout: extent_free failed 㿘>  >X.``.0>  ⱔH/` /> #" >"!ؑH 0>a aH€vmapbufvallocwaitvmapbuf: null page frame㿈 0@2 ,>")>    H& L`8 "@  `   %>k` Hc''#`#\   >`%& H> #$ 2>>o"! >  '> ! >  @    @ 'vunmapbuf㿘 0@2> >I p >k H8 " @  `”  L>& H& L   @ <H"@ cpu_fork: curproc㿘> #! a tH $`> Ґ!>!" !(`>!2 */  * !&a(!(!%&a(% @ &a$ P& H $  & & 4& 0P$  " >'" $ $ $$ 㿘!(  #>a2$aؒ **"!G 8 !\&66&(!$ P! !( `'>!2!(ѐ !(!@!"(H ''   '#\#`#d#h#l I@ !\ #\ #`#d#l#hI/   &sdcd㿘  =`>#@!   > @  .>X``$ ``N` s ` 4 `  2 4N` s24 4*@, @  "$`disk label read errordisk label corruptedno disk label㿘<  #&< 6 *" " * #" @&& W&u(' D' T' @( ' 0' <@ 2 Hٔ" ' 0֐ >11>7!!쀦@2 R. ", 6"@2@@ג! !W@@ 1>!0! R  @"1>!H 㿘`8 "; `( !25 @, !W@2- ` 2) ǐ "  `* @ .* @   @2  @   j ?W! 㿘@ ( HH"$ D$ T$ @($ <$ 0@<㿘`D `<*  @`8 ):` `(6 `T 2 `0@22 $$`46 `T  $`@ ,  $`4$`<`( {2` `T`8@$`@`0?($`0SunOS disk label, bad checksum㿘"  @`@ *  1>!!W&`&@`ɔ "&`(! &`,! &`0!&`4!A!&`8=!&`<!6`B!!&`D!`6`H!6`6`J&`&`+$` $@,` > 4!  ,` $  $`,` 4``a " "*   gG#ꀢ@216`  Ȁ@  @`@  2#6`  a?$  $, > 4!  , $  $ , 4   6`6` 㿘 ("2  , "  0 r  : H 6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`6aa  @ߐ M@<$$@` 6"6a       `  "4(&`gG#&`!  @ ,`@$`" ``Ȁ@  @`@ &`  ,`"@`"@&`b @ 6a@`@ 6a 㿘 @- @"+ =?  @28?@ &  66  F6  26  .6   J6   B6  H6  F 6 6@   8` .  @8 " 8 "@&& **`@ @  }* (@ 6?㿈\`d ?> 4 `!*` 55  4"@ 4"@`     @ 4"@  4"@ % ##\#`#d@%!`?   @ 4"@  4"@   @I㿀\`` d  2:?` ^ * @X & : *  @O * @ I &`` `;`+` ; ":`+ *`" "" #\#d#h#`#l#p  " , , @, @   * @ & : * @ *  @ * @  & : * @ϴ `2 °?O?$o > 4!Г* ? @8> 4*#P  + #@  `> 4L $I > 4!Г* @  > 4*#P  + #@  `> 4& $$ > 4!Г*  @> 4*#P  + #@  `> 4  * @*`@z F   " @?g * @a & : *  @X * @ R &``.( *`;`+` ; ":`+ *`" "" #\#d#h#`#l#p @ 㿘  Ģ`   * @  & `@ : ,""< ,   * .> 4"P.` > 4.b@ b8 `"``"Y?" U?  *   $ * 値`C > 4> 4.`PbБ.@ 868 ,``"``"%?" !?  *   $ `" ``  ? ?#  2#8#  2#  ?`"``"?" ߰?  + @# # * ,̰  ^ * @ X & : * ?` " `..`  : , , /` " , "  ;* `-> 4"P.` > 4.b@ @8 `"@``"@?" @?  *  #@ * @@怤`u > 4> 4.`PbБ.@@ 8h8 /`@ `"@``"@W?" @S?  *  #@``"``??;?# 2#8# 2 2#`"``"?" ?  # ,  @# * @@/` 㿘`'L &l \dp  ` * @ *  / @ @@ h*@ @%h/ *? ?@   @@ @ @,?&@ S* @ N*   Bh 3> 4"P- > 4bЗ.@ դ8 `"` `"̰?"Ȱ? ,   @ @#   #-) ޞ > 4"PbЕ-. `@ 8 8" h*`?!`"` `"?"? ,   @ @#   # `"` `n?j?8#  #  # 2`"` `"A?"=? (@    @ #  @#-) % "" h*`# !`"` `"?" ? (@    @ #  @#?`"` `??8#? #? #?2`"` `"?"? ,   @ @#   #-)   e"hb> 4> 4-bP@> 4LЗ. @+8 " `"` `"?"?* @  , ** @ @#-) ޞg "d `"` `"Z?"V?2 @  , 22 @ @#-) ޞ> > 4> 4"PbЕ-. `@ 8 8@"/ h*`L * 2?)`"` `"?"?3@ @  ,3@  @ @ #3@  #+@`"` `?(?'3@8# +@3@ # +@ 3@# +@2!`"` `"?"?2 (@2 2  @ #-) l @" h*`#?2 2 $`"` `"y?"u?+@ (@+@ +@  @ #3@`"` `V?(R?'+@8#?3@+@ #?3@ +@#?3@2"`"` `" ?"?* @  ,* * @ @#-) q 㿐@#\@㿈   \%`@ 8%`,= `  A 45    0 .  +@*` *   `, `,  4    $`  ` `  ܦ 0@*` *    `` #\#`#d 6`? #\#`u#d & ?` `  Ԧ  㿐 > >! `X@` 0 /@Z 0H /e4 p* & p!  H 00> & pH 0 H d>  @/H /e * &  p ? H & p`& p  V  H   p  ?& pސ H 0㿈 (   P   #\#`#d ?< PH/` / 0   & 0  & 0H 0 0& ,H 0  @ >X!P `@ N㿘H/` / , "  0& ,?& 0H 0  @ >X!P@z * `0& ,H 0  @ >X!P@h  `rcons_init: linebytes assumption botched (0x%x) 㿘> c& P"c > " "`" `:`>!#0j"  " \& X @9  @ 4&  \@0 @ 4& )> "  2  2` 2` 2` \ $2  :  ?& H   "@2`@:`& L & @  ? $& @ \   `& D $ 2 (> > & & $""@ @>! & (>!b `{">! "`́㿘 (2,  @ "   "? `    @ @ @ې@`,H (@   ( # 3& (& 88& < @Ő2` ?@? ^ $ $ "@@4  6` 6 @ ^( 8 @?&@@M`<@ ( @㿐 \ $ H    (  2 L    "  P " P  P u#\ $@"@ $  & " @ "@  @@Ӓ 㿘`;>#!*`  $3" $ .?,&  '?%&  $"@@f"0 @ "@  @@ 00  $` "  $ & t<X㿘`[`; ( 73$2 ( ;-(   ($! >& (& 8 8*` * ?А& 8(" =& (& < <*` * ?А & < @ΐ@ ( ?& (㿘`3>$!8*` @ 80  8" "  $ 8 "  $ $ 8" " $ &i&0g $"  8 "   [Y& < $?"@ $@6 "@?"@ 8 ?"@ @6 ?"@<?:"@@06@֐03@ 80/@Y 80+@ 80' (!2& 8 8  ( & ( ?& (@l 0@h 0 (!2& 8 8 & 4 (& 4 `& (@W  0Ll000P\hx0000000000000000000000000000000 㿈 \ $` H   Y L P  #\#`#d|  ( & (㿈 ( `2 P0` P   #\#`#da  X (8 `& (& X㿈 $      P  X #\#`C#d0@  \`   L D  X  P H @#\#`-#d㿈 \ $   H P L @  X"#\#`#d㿈 @4 "@" @ &"@ \  L P  H  @ D#d##\#` D L#\ X" P H @#`#d㿈 $ " @4 \@@ $@ `@ H L  P @#` " #d#\ \  @ H"@ L@ X  P#\#`#d㿈  " @4 \`d @_[ L H  P@  @ D #d##`z#\ D L" X P H @#\#`m#d㿈 $ " @4 \@@/ $@* `@$ H L  P@ @#`"  #\B#d H \ L@   P \` X#\#`.#d㿈  " @4 \` @ L P  H@  @#d D ##\ #` \ L P  H @  X#\#`#dxboxSUNW,xbox㿘>&@ 2 @ model: model %schild-presentfalse: no devices write0-key P>&`>&o>&`>&@a 0>&b!0   &`P<   &`TH   &`XT  ߖ &`\`  ٖ &``l  Ӗ &`dx  ͖ &`h  ǖ &`l   &`p   &`t   &`x   &`|   &`a4 " '>&@` 2'8 '>&?a @`P* `&`<&`@ "`<@`P`8*  " d@)`0>&!0!D8 `'` ''>'$  ranges%s: PROM ranges too large: %d 㿘>&# @^ o   & L>&# 01 @ t& H @ L" H $ `< 6 H  L`8 @2     " `8 L  @"`` H%s at %s㿘`>' w! @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   &    "    (+  2 2 " 2+J " ?  #+ 0 `**   "+ 2# +  @(*`  *02 @"@ @b 㿐  `   ` @`>X b    ?2    *2@ 2  &  4 @     `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  `   `  @  ` " @ ` ?  2  H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   & @@7  ?@3 @ ? @  &@k@㿐 @6``2  ?7 x 8" > 4c   @   @U XP    @'@"'5ک/@ @  x@@ 0`(` @/@:1@ #V@@ 7`/`  @)@@   ے@  7 /  Ĕ(@0os@ "@ 1 )  /@ @ =_#@ @ 0`(` @̔/@@ "*@@ 7`/`  @Д)@* @ "@ 7 /  Ԕ(@?Q@ !@ 1 )  ؔ/@ `&@  ؐ@@ 0`(` @ܔ/@"=@ #@@ 7`/`  @)@?֒@ #@ 7 /  (@"W5@ #@ 1 )  /@ @ !"@@ 0`(` @/@?f@ !@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =@ !b@@ 0`(` @ @0,@ #@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@ 0`(` @)@@  S@@ 7`/`  @(@@6(y@ "@ 7 /  /@@ 9#Ȓ@  1 )  / xs@ !@@ 0`(` @)@0@ #֐@@  7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@ 0`(` @)@@ ?;#@ @ 7`/`  @(@@@ "ِ@ 7 /  /@#J@  @ 1 )  ?@!B@@ 0`(` @@!}@"@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@ 0`(` @Ȓ@@#@ @ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ɛ@@ 0`(` @@:I@#@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@ 0`(` @@9@!@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= H "D@@ 0`(` @0@ʿ #@@ 7`/`  @7@*@ #@  7 /  7?$@  9@ 1 )  1V֒ !Ð@@ 0`(` @0@#3  @@ 7`/`  @7@?@  }@ 7 /  7!a@ !ѐ@ 1 )  1 "O@@ 0`(` @0@?9 "@@ 7`/`  @7@(P@ #@ 7 /  7@ !@ 1 )  Ȓ1=ߒ "@ @ 0`(` @0@/N "5@@ 7`/`  @7@ "@ @  7 /  :ᴐ7c@ @1 )     @& & & & @= @  `*@ 0* @*  @* `      +` *   (*   @ `   @* * @ * ** 8  %c㿘 j ">,   (`("`  ` `>,#.%`>,#ذ?آ>,#آ?0Π >, >,>,#0Ð#. J@   J@J`  ?*  8 B  ?*@    2@* *@ 㿘  `  `  @/# @*   & &@&&`?;`"   ` 㿘?#@6 6` ` @ & $ @$@&@ 2   *  , "@@ 4 "  "  , @@ 4    -`@@ 5`  @@*  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X2J  J@ `2J 㿐@Q㿘 J J 2" 2N@@  @` *N &* J " "  ` ?2  㿘@  H'T> 4#@R T ?0T2 7耦(7耢 2: # 4`44`44`4`ؤ466ȕ4'Ā66A ? 29`@`@`*  @@`*  @@`*  @T @T ;-`2 -,`- 2` ΰ "ĸ?` `"`` ?8   đ. ?2@ Đ"* c'Ā@ '.` @ '  @@? 7'7+ 6```+@, @@6*`2 .2, @ ( 6`? #  -. $$6`@?6"@ #? @ "6` 5  -. ?  @26`5ĺ`5  'T "`.  "@ : *  2?. 4@*  *`@T:̑*  ΰГ*`@     :( 2? + @( 3@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  ?* J" @ J2  @(*`   * 4 ?: :  *2@ :    4  * *  @    2J@ "J`  2J@   88 @@ @   `@ @ "`"  ?*@    2@* *@  @( *` @ (* * @ @ ` ``z @Z( 2 "" 2 @  &㿈@ '''㿈` @'''$@sun4c compatible0 0 f8000000 15c6a0 map-pages@spurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(4"D1vEHI@HuG-|5wF@ @  0 0   PH@80( :789:;cd[\]^#$%-./ !-.#$12`a(630e144ac330ad(33ad(3D3\ad(3p3ad(3 38ad(3 38b(d33ad(33b(d33bXd3X3pb`d3X3pbhd33ad(33b(d33bpd33bXd33bxd3X3pb(d33ad(33(ad(33(b(d33(bd33(b d3H3`ad(3H3`b(d3H3`b0d3H3`b8d3H3`ad(3H3`b(d3H3`b@d3H3`bHd3H3`bPd33ad(33b(d343Lac3x3ad(3x3adD3x3ad433b|d$33b|d$3X3pac33b(d 3p3ƈb(d 33b(d 33b(d 303Hbd303Hb(d 303Hb(c 3\3tb(c 3̈3̠b(d 3̈3̠b(c 3̸3b(c 33ad,3,3ad,3H3`b(c 3xt0bd3xt0b(d 3xt0ad3xt0b(c 3xt0ac33b(d 33bd33bd33bd33b(c 3 38bd83`3xb(c 3`3xb(c 33bd33bd33b(c 33bd33bd33b(c 3Ϩ3bd3Ϩ3bd33b(c 33b(c 33b(d3tpad03tpad@3tpb(d 3tpbd3tpad3tpb(c 3H3`bd3H3`bd3H3`ad83H3`ad83H3`ad83H3`ad83x3ѐad<3x3ѐad<3x3ѐad<3x3ѐad<3Ѥ3Ѽb|c33ad833ad833b|d"3p3҈b d83Ҝ3Ҵbd4`4xb(c xphX0LXPH8( 03` ::::::::-Pa7171PXxHTFlPNRRCESTNMtCL0PL0REX@RRCESTSLRRCESTERCESTX$4XHXyp$P$|,\(,Xh4d`(T0 \x@ ,tD `8874vHX<<$PX|,\(,HX\P4\d<<<<(<T<<<<0 \,tD P887hw@ɜ Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2002 OpenBSD. All rights reserved. http://www.OpenBSD.org nativez 28DD(4> 8 < P9X[x^OM Yf h\ u  u?Fdyw$w8 |   `  d`de0Iv@wkX wx~P~d py\ c\ 'xOt0>H P X x    w|tvxh ߤ @q  ~p  p< L   , h  kgTr@ l[p0tul( xJX S4z{0{{za btc Yv 0_op ` ]mv0 Hؤh >x wP iv  LtJKThWXz{`T   08@H@h$t444$dpWPWHW@W8W(W WWWWVVVVVVVVVVVxVpVhVXVPV@V8V0V(VVUUUUUUUUUUxUhUXUHU8U0U(UUTTTTTTTTTTTxThTXTHT@T0T(T TTSSSSSS?? 0 XxB@dH T T4TPTx nxnpnhn`nXnPnHn@n8n0n(n nnnnmmmmmn mmmmmmmnmmA@p$lTØ<ØĨ`ňŰǀf`ɤttyclsttyopnttybgttyinttyout@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@LL`H $ t        0!x!ttBpgj gh0hiXPnetconnetclsnetionetlckffs ~v`cd9660XnfsTP ` wx2lockf@` 80(  HXP4=>X0\>t,7p l   p  H `t   P$P @|0x,X  X   HL x  @(T `  80\ p( p4H8t$P|,X4d(T0\ 8dHX@$PP|xxxh,,4d(Txx0\4`t, x8x87#,devopndeviodevwaitdevindevoutdeviocdevclsHX<<$PX|,HX\P4\d<<<<(<T<<<<0\t, P887%|` 20123456789abcdef^^#$%&'()*+;,-.;/;0;1B@C= D$E= F$cdeB@LK@B@ H0 -CD H,2KR`0VKZt,$28C>4)`61DI<$X$X8[$Xb^$X]pfhT<$X  | dX}E#(D<8Q @X,2Kg(@AAA==(A* d @@@@@@@@@$ @      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''"&2L`l~0Nv@x ֜HX8r q$P|!hE ,wXlX4 dl`L(ؠT4ED0\ 8  lt, 8 d8 7#(HX<<$P h| !h , X\P4 d<<<<(<T<<<<0\ lt, P8d<87K?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@hhhh 8 @ Θ | t $ | g d| ( N Zt sxHX    `$ P d| p T 8 , X 4 < ,4 d L , | ( T    `0 (\ @ h   <t  8 ,d "86xHX<<$P P| p T 8 , X\P4 d<<<<(<T<<<< `0 (\ @ h <t  P8d<86f4( ... ...  < h ' ' )( , 0 5h 7 8, 9$ 9 vmmapbsy\ {h ~ ~ l 24 ",  ھە (<   @2<@ . .. ftpgzip#XgunzipXgzcat#X sed basename  grep  egrep  fgrep9 rsh  tsetJ reset less more#!/bin/sh MODE=upgrade . install.sub THESETS=`echo $THESETS | sed -e 's/ etc / /'` ls -l /dev > /dev/null 2>&1 while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done resp= while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem=/dev/`basename $resp` if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${_root_filesystem} is not a block device." resp= fi done echo -n "Checking root filesystem (fsck -fp ${_root_filesystem}) ... " if fsck -fp ${_root_filesystem} > /dev/null 2>&1; then echo "OK." else echo "FAILED.\nYou must fsck ${_root_filesystem} manually." exit 1 fi echo -n "Mounting root filesystem ... " if mount -o ro ${_root_filesystem} /mnt; then echo "Done." else echo "ERROR: can't mount root filesystem!" exit 1 fi for _file in fstab hosts; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /etc/${_file}!" exit 1 fi cp /mnt/etc/$_file /tmp/$_file done cat << __EOT The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __EOT echo -n "Enable network? [y] " getresp y case $resp in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << __EOT You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __EOT echo -n "Escape to shell? [n] " getresp n case $resp in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; esac ;; esac echo "The fstab is configured as follows:\n" cat /tmp/fstab cat << __EOT You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. NOTE: 1) this fstab is used only during the upgrade. It will not be copied into the root filesystem. 2) all non-ffs filesystems, and filesystems with the 'noauto' option, will be ignored during the upgrade. __EOT echo -n "Edit the fstab with ${EDITOR}? [n] " getresp n case $resp in y*|Y*) ${EDITOR} /tmp/fstab ;; esac echo munge_fstab < /tmp/fstab if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi echo "Checking non-root filesystems..." if ! check_fs $_root_filesystem; then rm /tmp/fstab.shadow fi echo "...Done." if [ ! -f /etc/fstab ]; then exit 2 else mount_fs fi ( if [ -d /mnt/usr/X11R6/lib/X11 ]; then cd /mnt/usr/X11R6/lib/X11 for xf3dir in twm xkb xsm xinit rstart; do if [ -e $xf3dir -a ! -L $xf3dir ]; then mkdir -p XF3 mv $xf3dir XF3/. ln -s XF3/$xf3dir $xf3dir fi done fi ) echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp y case $resp in y*|Y*) get_localdir /mnt ;; esac install_sets $THESETS ( if [ -f /mnt/etc/sendmail.cf -a ! -f /mnt/etc/mail/sendmail.cf ]; then echo "Moving /etc/sendmail.cf -> /etc/mail/sendmail.cf" [ -d /mnt/etc/mail ] || mkdir /mnt/etc/mail mv /mnt/etc/sendmail.cf /mnt/etc/mail/sendmail.cf ed - /mnt/etc/rc << __EOT 1,$s/etc\/sendmail.cf/etc\/mail\/sendmail.cf/g w q __EOT fi ) finish_up  . ..@ bin dev etc mnt@mnt21sbin1 tmp usr varinstbinupgradeinstall install.sub.profileMIh install.mdh#!/bin/sh FILESYSTEMS=/tmp/filesystems FQDN= MODE=install . install.sub if [ ! -f /etc/fstab ]; then if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK= while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi md_prep_disklabel ${DISK} cat << __EOT You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __EOT if [ "${DISK}" = "${ROOTDISK}" ]; then cat << __EOT The following partitions will be used for the root filesystem and swap: ${ROOTDISK}a / ${ROOTDISK}b swap __EOT echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done echo _i=0 resp=X while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case $resp in /*) _mount_points[${_i}]=$resp break ;; done|"")break ;; none) _mount_points[${_i}]= break ;; *) echo "mount point must be an absolute path!" break ;; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done for _mp in `bsort ${_mount_points[*]}`; do _i=0 while [ $_i -lt $_npartitions ] ; do if [ $_mp = "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]= break fi _i=$(( ${_i} + 1 )) done done rm -f /tmp/fstab.${DISK} done cat << __EOT You have configured the following devices and mount points: $(<${FILESYSTEMS}) ============================================================ The next step will overwrite any existing data on: __EOT ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo -n "\nAre you really sure that you're ready to proceed? [n] " getresp n case $resp in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's/\/dev\/\([^ ]*\)[a-p] .*/\1/'` while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done fi cat << __EOT You will now be given the opportunity to configure the network. This will be useful if you need to transfer the installation sets via FTP, HTTP, or NFS. Even if you choose not to transfer installation sets that way, this information will be preserved and copied into the new root filesystem. __EOT echo -n "Configure the network? [y] " getresp y case $resp in y*|Y*) donetconfig ;; esac if [ ! -f /etc/fstab ]; then ( while read _dev _mp; do if [ "$_mp" = "/" ]; then echo /dev/$_dev $_mp ffs rw 1 1 else echo /dev/$_dev $_mp ffs rw 1 2 fi done ) < ${FILESYSTEMS} > /tmp/fstab munge_fstab < /tmp/fstab fi mount_fs "-o async" mount | while read line; do set -- $line if [ "$3" = "/" -a "$5" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp n case $resp in y*|Y*) get_localdir ;; esac fi done echo '\nPlease enter the initial password that the root account will have.' _oifs=$IFS IFS= resp= while [ -z "$resp" ]; do echo -n "Password (will not echo): " stty -echo getresp -n stty echo echo _password=$resp echo -n "Password (again): " stty -echo getresp -n stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp= fi done IFS=$_oifs md_questions install_sets $THESETS cfgfiles="fstab hostname.* hosts myname mygate resolv.conf kbdtype" echo if [ -f /etc/dhclient.conf ]; then echo -n "Saving dhclient configuration..." cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf echo "lookup file bind" > /mnt/etc/resolv.conf.tail cp /var/db/dhclient.leases /mnt/var/db/. cfgfiles=`echo $cfgfiles | sed -e 's/ mygate / /'` echo "done." fi cd /tmp echo -n "Copying... " for file in $cfgfiles; do if [ -f $file ]; then echo -n "$file " cp $file /mnt/etc/$file rm -f $file fi done echo "...done." remount_fs _encr=`/mnt/usr/bin/encrypt -b 7 "${_password}"` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 finish_up  @  @D, @'j$p+#@  /0@Z / "%< %< @<@`@M`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h!{ Р"$   Ŗ ?$   `{""4      ؐ        ?@ ?# @! ?a ?@ ?# @ `     | ??"  #\@ #`?# @!  3 @@! -? ?c@  ̀@ ! @ ̀@? ?c@ ! @   @! @     #d#h  Ŕ  ( ? $ ( !    ?#\#`ؔ@ ?# @!   a ?@  ?#  ?FB?? ?# ! 2 ?1@! ,? ?c@  ̀@2 ?@ ̐ ? ?c@ ! @" @! @2 #?:  ?# !  ?/ @! )? ?c@  ̀@ ? @ ̐ ? ?c@ ! @   @! @   #d#h   Ř u ?  ( o  l 䀣 !  #\܆    #d#h`#`  R ?2 j ( L  I jbp0< $ $ $ $  ` ?2 @  !1 `  ?2   h %  "  {""4{`@\"4㿘{"4€ 㿘{"4``@?㿘{"4€ 㿘{"4 ?Service unavailable㿐{"4     ?1 !P  @*`:` J " %s: %s not compiled in instbin㿘@U@ J 2@@H@@IE /  @0 @`"@ÿ 2    z  a@ɐ!@"㿘 ?@?`ÔUsage: %s ..., where is one of: %s㿘z  c @ޞ!0`@ `@) + @e@  O4@ދ#X@@ކc``@ @~#X@s hostnamedmesgexprmvsleep-shshkshsedmkdirmtrmmount_mfsnewfsinitfsckfsck_ffschownchgrpchmodgzcatgunzipgzipcpedhaltrebootdhclientmount_ffsftprouteinstallbootmknodrshumountbasenamefgrepegrepgrepmount_nfsmorelessresettsetlsifconfigcatpingcpiotarpaxdisklabellnsttysyncmountdfmount_cd9660dd㿘@!/`4`/X4/P7T/H4/@4@@/84/05/(5$/ 5T /5`@@/5|skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈{{ "bX"`#"  #{ $b8%{C+{) 5 7 / - 3 @8 $8h@ې @E = 2,b8#x@Ґ  L b8b8@ɐ  '` @3H #x@  "c@  €$  $8`@"@ $` @ @Z#`{ `@ "P` ` @ c  <!"@!   < $%c `8@f {"P` "X ` @] #%cȠ"X  c` % `h@L  ? @   2` $ 8 `  @`   `$   ` @"?㿘@K@㿘@{{"bh"㿘@{"bP㿘@{ "b?"b㿘@2"a㿘{#`@{"bh{ p㿘{#`@{"c{ 㿘@{:㿘@{:x7 76 6 6666 6 6 66666unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 ,'D) % !' # 1{D@Y#'  @ẘ  {@B `"`c0@9 ` `"&#D ߐD㿘@X@%s%s: illegal numeric value%s: %s㿐@ߔ ?2{"8`0@Y  2J{"8`8@ `k`m`b". `w . . . 8{ 'J`x 4{``*2{ @p{"8! X@ "@Ɛ "8`8@ 㿐 @)Ւ    {"8`0@X 2K{"8`8@  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @"{ 'J`x 4#{`%`*2{  @ַ @{"8! X@ "@D "8`8@? 㿘{#{ {bX  "@    *ТbX``$   $ @   $`$`{`{ ؁㿘{"@?`$){"X  "X     "X"X" "  "X@"@ "X"X?"`"`%@{"X# "@ {" '{`P@8{#Ā    +@ `  0 +@`    "X`P*`"X` " "`?"`P Ā  P @g" *#` " "` %` "X  {"X`? "`  "X` ? %@"`#`P` ` $` $`@> ` `"X"X @ " 㿘{"X` %!{{☤#` "@ "@  {c `` `  X !{ "P@" "P "㿘{#+{{bX  ??  @? ?,@ bXP@ <bX{#Ш   P@?*" ?   " " " @@$$ $*@` $@ P @ " % bX   bX@"@ bX  $ %s: short input record㿘{bX  2  @W !bX  %{   bX ? *bX "?bX Р$  `@^``@$`$` `"* "㿘@'@9a@  a$@  @ૐ"{b? 32@Va??&a@@  stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘{"X   #`$  $ @m $  ch@V) X@2!` {  {cp@ #  # $ $ '){{c# "& @>! $ #" & @2! $ `$ ` ` @Uch@# @2XX`` @ ? $Xc@UҐ $!{ "P@*"P@ @  $X`"P@ @ $c@U XX`$"`$ ` " @  $@#@&#  #   @     @Ϩ #"@L{`!&b{r{#Ĕ *  +@ ( 5s{!hĔ *  +@ ( $r{# { *  +  s{!h { *  +   Đ@s  @ g` h ch@U1 <     a@      @ ?  j"x`  & 㿘 ){{{bX#Ъ"/1{""` {# -{` @ `X @ `X  @  h$ 6. $2  #h@TՐ #h@U@K        @ @ @T{``$` "@  $`%"   $ "@  $ %" $  $  $ ` %`` `@w&`$`@@ X`"`` %``@`{` Ȓ@€$`x{㿘{c#؀@Z{ @ { <@{{# !{#`#@  " @  #@  #`"`# `@ %s: end of device%s: short write on character device%s: short write on tape device㿘{#Ш #``{#3{5/+-  ?# #`  {H 2 `` "H@TV`#` "$` @ 0@ bj@  "x` h@Sڐ b  > B; Ǥ@2   # #  " &   #   #@"@ #  & %u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) Ȑ@巒 {bb" '"@ 'Вb@ ?2*"@ !ȑ*`" *  *  ' B?8 ?8`   d #\@̐@D @ i'@ $ "0 "H"P @岒 d-`@ Q%% {" ("X "H"P @嘒 d-`@ 7%%``!"p@D##\@?2aЁ B d8-` ª`@v;`@ %%@  㿘!jg"x$"x㿘a@H %sskip reached end of input㿘{bX 2   @/     @ ?CAa8@R  9 +-X@  "  &!D?D? {2a ?"a@@  #d @Ra8 a8@R X㿐{#      @Ԕ      @L ?vt a8@Rc   $  '7a@  c a8@RR    X $ Tc c@>  4A6  a8@R8   7 'a@ ? a8@R(  D 4c, $ (cc @    a8@R  D 4c $ c0  D4c $cЁ㿘@`V8V(V VVVUUUUUU Uupdateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %s @8 '+)j'%/i5 0* c@€    " @ @w@H??H* & @ @h@?` '' ' '''P@ R j"x`-bX@ < b@Q7 @z WWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWWWWWWVWVWWVWWWWVusage: mount_cd9660 [-egjR] [-o options] special node 㿘z`@>!@3 ,-o %s: option not supported㿘@  @Pܒ 1' n L  o  @: = 2*`"@H 2   @2    &*@&a@  @2 2L@㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@ 5%!';/-2+j)+9 $&* @€ $  $ ( $$ $ ($  '` % |"` bx@2 @b@J@զ"h?Ґ?i!H$*@` & |` @Pt@2@[  2@b@P   !@ Y@g@ `R' @@K  @@ @@P"=`< @ @2 @@@@ 2-`%a@K@ !`  @@@P#`@z D 2 ac@@PD` @@Oސ"`@  @`  @ 4?a` $ | @ǔ0@`@ϐ [\\\\\\\\\\\\\\\\\\\\\\\[[\[[\[\\\\\[㿐@ݫ  @6  @ ` T@! 㿘2#  ``?  #|@    2`@ empty type list㿘 N  n`(@  |N  o|| "` "  %2  @p , ` @*  $ @N $@ , `$@  @Y , 2*@, $@㿘 `2#`  ` @ ., ' D  @"!s  `@! T@!a!!2&' 2. ȁ 22ЅB# ؁ 22B 聩 22B  33B B 8 0B %5.0f%cBKMGTPE %5.1f%c㿐??3  B3@,#00   #HJ  #8@, 0#HJ  #P@, 㿐 ' 3 B B? ' B?  D?%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s 㿐  @,g     " F `  @6 @@  @ @n ` @ @@ @@Z` @ @@  @@F @, ' 3`(B'3`0D?@  @+ `$ (   `"@ ' 3(B'`3`(B30 B?@  @+Ҙ @+ΐ  @+ʒ T Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 㿐 `#p@D'#x㠘@+ (` #$'@/'@:#㠘@+t $`"@+l#@+i ` !1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s x (`! $!0"@ې!@㠒@+&`n T ` ``" 2'@  ?3' 8 ‰ F?@`!x` @6 `@Ð@x` ` `@@` ` @6 `@@ #\`@@#\`  @  @@` #` @@`#`#l#d#h@*a!a㿘@{ @Lf"?@^ @  @  ?  df: %qd: %s 㿘 @@ j"xz!`P  @3@E  usage: %s [-hiklnP] [-t type] [file | file_system ...] 㿘0 <za@*!@ ffs㿘|   F\!T@"&;?4&0&(& 8@W̘ d &<(#  ; @<  @t d$"@&@B,?&Ȑ&& ;&$ !`T@c Z@_ ZDah@  lfs㿘#|` d `!b@"&E?  d& &   "@ 2 &    $"@ 2 & T @" @J d& $ 8 &  " : && (& d@ $&& &$ߐ "T@ Z@ ZDb@+  ext2fs㿘-| $$  ;`8#S@H?`L (&B?`$*&`4 * &@`(``` $@4 ?@`@$& ` &`"@ &&`& &&$  T@ Z@ ZD` @͔  㿘@unionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿀@ՠ "   75#j%3/+2'쀢 8-* (@€ (  %&X"bJ@ @u \ b@ @(b b@  %@ ?@@dbȀ?ː?iaH * & ^@   0\06.`? @  @  @ @   @  @Ր     @q#\ 2 @w 0@  @c @I  @ D "@ǐ!@Đ\ @@t@@^@ '@c0@k @j T 2& @cX@a ) T@]@  @C@ @cx@O  @{  @u   @o " @c@8    #\ 2`@@Ѐ #@@U 2`@#\ @@ `&@I !c@ے  @Ȯ  @f ? jbx `@H @ʐ@-uut|uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuutuututuuuuuuuutuututtuu,㿘N@ n N` o `@] # n J` o  `@} "   @} 2 `?  @ b 2J@@e/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %sX@뤒 `" # O@ ##@֐@c@A \@( %@} Ӣ@ Z @   @`#(c@n@&Z  @QcP@Jc@@BcX`$@D'h $'@[* $  '* $  X* '$ @&#p  6 #,  @&c , @& #n @?  30-@G#@q^ "D;9j5$c@@$"x`@G  2j"x`#@G@ @H@% @G#+   >  0"  !@.#@G  @` @鬒 #@G\ 0@n %s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemcd9660norripgensextatt) h   T  (@%) D>`@ *   3   @`H@% 3!`` D#3!` `- + ) @`  2 @`H P@$ ,@`  뀌@`  X  H  P@  p# @$ؖ@   4'Ԓ@  x@$/c@    @!  H  P "    @$   @G  @  H  P@$   @  H  P     @$   @ @  H  P  @$u  "  @  H  P  @$c  @"  @  H  P  @$R  @ @  H  P  @$A@  @    H  P  @$+@  $@    H  P  @$@  (@    H  P  @#@  , @    H  P  @#@  0 @    H  P  @#Ք@  4@    H  P  @#@  8(    H  P  @#a @c  @2Β̦ !(  H  P! !x@ !8@#a@@B 7 @  ! l   p @ !H  H  P    lX p@#d!`@  t̀ !h  H  P  @#Oxa@ { @  ! l   p @ !H  H  P    lX p@#)!`@  t" x !h  H  P  @#x x   @  H  P  @# x   @  H  P  @" x   @  H  P  @" x K  @  H  P  @"Д=@a 7! l   @  H  P  @" l   @  H  P  @" l   @  H  P  @" !#@"㿐@]  @6  @7  @0 T `@! 㿘3!\  `0`?  #@    2`0@ empty type list㿘 #N  n#ax@Đ  N  o "`0 " 0 %3  @ , ` @l*  $\ @C $@ , `$@  @ , 2*@, $@%s,%s㿘 L@ @@ @A # @Cy @`@,`@R-o㿐@'!%  -, &@ =  ,  .&c@y  , # c0, &&  @Cޒ 2N&@usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘z#$$$$c(X h`@G!@< ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s㿘 @c؀  @{DcЀ 2( @O "" @  $ @` 2 b@ 2 $@C   $!0@C   ,-o %s: option not supported㿘@W  @B 1'$ n L  o  @ = 2*`"@w 2  $ @2    &*@&b8@d  @0 2L@D㿘@㿘@ @㿘@ :80 (     werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscardxprprntflushbrk㿘@@option requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %s㿀%a$c'  @  2%a@ @ 2] `&` 2 N%!@Aޒ@ gN u2 N%a@ "  N <2  %a@  `( 4*@  @y `%!ؒ @A@ <J`%"@A@ 2 `(* N ^N `(`? `-   * `(*  &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 &&`@ `8@ gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘 &  @h $cȀ c%&   @ @[  2 @K@& @M:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@- : 'H H+& 'H/&-&@ = 2,@,@`p@ N@ c &ax@ϐ 2N@s&  i2 N@&a@ 2N@f& i2N@&a@ 2 N@a@ U& $ l2 N@&a@ 2N@H& o2 N@&a@ 2N@;&  o$&a@  $a@ \*& (#Ȁ` #'& N@J@2  @q 2  ? @ ?  , 2 H H  H@@Ēh N@ ittyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakall㿘@@illegal option -- -%soption requires an argument -- %s㿈@L@ -2&` &``3'c!' @3 2 # 2  ` '!8@@@   "  & &`'!P@@@  @ 㿘   D@ 㿘  " $@0 " `  & & & & $㿘@q  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@Ö 㿐    ``'@   '``@ & 㿘 @q @ &  @$**@"" "$@$   """$ "     " "  " 㿘 @qg @AR & 㿘  @0 @ 8  ?` # & & 㿘@qI  & 6 D   $g`  ˒  " " " " $" %d %d 㿘( F!@2 D%d 㿘!(!@ΐ @'TIOCSETD㿐 `'@ (b@> TIOCSTART㿘@`n (bH@> TIOCSTOP㿘@`o (b@> 0(  #3#3233#@@@x@ph`PH@-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5 @@xph`XPH@80(  -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrkXPH@0 @@x@h@` P @ 0 ( @@ C$CC$Cph`-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho @@xph`-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘(bȀ bȢ @Ր 2    ` *@&`   &` U&`  2)!4`!4 @ 2    `*@&`  &` ;&` 2)#`# @ 2    `$*@&`$  &` !&`$ 2+ `` ` @ 2    `*@&`  &` &` 2 tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ& `+``" ++`"++@#@#+@# @#@#@Ӑ@~ , @Ӓ, (@͒,`@@Ő 8" ,@ P ,@ X! 4 , ` `@@  4 , h `@@$ 4 , p `@@  4 , x `@@  4 , `@@  4 , `@}@ , @s@  4 , `@h@ @ 4 , `@]@  4 , `@R@" 4 , `@G@ , Г4 @=@4 , ؒ `@1@4  , `@%@4 , `@@4 , `@ @( 4 ,! `@@4 @",! `@@,@ސ!  4 ,! `@@! 4 ,!( `@ܐ@ @ 4 ,!0 `@ѐ@  4 ,!8 `@Ɛ@4 ,!@ `@@" 4 ,!H `@@$ 4 ,!P `@@( 4 ,!X `@@4  4 ,!` `@@ ,!p @@  4 ,!x `@w@  4 ,! `@l@  4 ,! `@a@ "  4 ,! `@V@ ,@>! ,! @H@  4 ,! `@=@  4 ,! `@2@ @ 4 ,! `@'@  4 ,! `@@  4 ,!Ȓ `@@  4 ,!В `@@ "  4 ,!ؒ `@@ ,@!(2 #4 ,! `@@ #!","  4 ,#4 ,,@ؐ!4 @Ԑ! 4 ,@ϐ"4 ,@ʐ"4 ," `@Đ@4 ," `@@4  4 ," `@@4  ,"( `@@$ 4 ,"0 `@@4 @,"8 `@@4 ,"H `@|@! ,@b"P$#Ȁ`#Ȣ%,` @@ dX@i@b` @ 2`@G 0C@D $#Ȳ#Ȁ`2 ,,"hbp d,`` " ` @%@B`( @c@7 2 ` @& @"` @ ؀ !,"p@@(㿘! p ,@  P$ p" t%s: %s %s %s㿘! p   t/@"$ p@ p@`H //@"/"@ $ p@ܐ" p@$ p%d㿘 ?  1 h/8@ϒ 0%1/ #@  h M. h -*  ^* ? *4* ^*@** h-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@'Hi"!D '#i'H @y?2 e"  f a aH+ gaH% !j"@  '0"`(@6ې  aH@H*` 0@X`aHH*`@ 0aHH* @'H 0`0@ `@ 0`@@6 `h@ `0@6Ґ P` `H H` HHH''@ GH -0+0 4Hђ .H (Hyb  `  @hȐ @8@'`@  H`'`h@6@1H 'H Ő  @ 0`@63    `g@텔 0@6T  usage: %s [-a|-e|-g] [-f file] [operands] 㿘0 <1z`8@_!@T 㿘@ Ffhns.%s8@+1)'%!#15i/9A7G -* b@€  %   $ $| $ x@@X`??H x* @ &!p0 "  . " `. @1@`@c @ @^@@?@ 1`@5 <  "@@@  @@? `@@@ѐHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH$H0HHHHH0HHHH<%s: is a directory%s/%s8 x`@ǡ 1U  `<  1@5#PG  |`!"€ <  @!Ò /  1h@NJ$ ` @l j"x`2 1 € 1 @5  0 usage: %s [-fhns] file1 file2 ln [-fs] file ... directory 㿘0 <2za@%!@ 㿘@fRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABEL㿈@ '74!5)'5j#-+%/29_'쀢 8Z* 0@€ |  @& $ |N' |  @ E$ | |  @  ':$ |!0 6%!0L 2$L |  @ )$ | |  @  $ |'aH $aH@ %@ |  @  $ |aT %aT8 $8@@v??iH |*@`&  $ | aH !0L    | "@ | @` "4  `@A^!D  |2!Db@3Đ ?`4*` € @@ @ @z @@o !D@ @m @n@] @@Ґ  z@o0z`@@ R? @R@X@2`@jB 2`b@3e @  4/aT . @값`m '2c@3P ? (`@$`  `X@]!@@@飔!@ u @@qdPψ<ˀ˨`̰l|̌unknown disk type: %s㿘@ 4a@ې @D!&&& `&$@g+ DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO㿐!P ` 4@2ϐ!!!44@2ʐ!!44@2Ɛ"4@2Ð"H  !W&&6@aHp6aT   e`f@駔  j"x  4i"x!8`4"  aD + 3` @;   aD + 3` @ ;  @T 2H'  @ 6 4"' `m@f 62@#@ 4"@t 0%T !' `m@K  2@d# !T`2  e`g@9  4"@J 0 %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘j"x   20 205@1ڐ!x05@1֐!0 5@1Ґ"05@1ΐ"@0@1"reading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO㿘!H`t!8`  * 2`   :  @@5 #  @  @ !@@ c 4 @!D2b@1  !W@ @ 5 @ *  bP5@1H#hP#`5@"P # !W !52  2   #P@ *  8@#P (2@1"2 !0` `s@ 5c@0 !L`!Xe`r@ 5c@0 !Xe`e@  5c@0 5#@0& Bootstrap doesn't leave room for disk label㿘`( 2 @"&`&`( @!@J !Ԁ@ 6J b@g *J\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:㿘N`6`#@6cH @\`N` 6cH @S`6#P@\`8 64#x* 6cx@C`(c@>`(6@9c`,6@4c`06@/c`46c@*`86c@%6`<c@ `H6c@2b`J6c@2b`L6c@2b`N6c@2b`P7`@2b`T7`@ `\`'7, @ڔ,` L 4#)@977757/7-7+7@ 76@@= @ (@`0@ ` a *@@8 ` @@ `  2` ` ,`@< P@`@`X`@ ¢` @ @Ash `*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %uH. `@  s ah*   /??* : 5@ `  : H*` €' 5 B`('`5 BD?' 5 B'`5 BÉD' 5 B`8'`5 B?' 5 B'`5 B' ?5 B?`($@t' 5 B艠?' ?5 B?@[$' 5 Bg' ?5 B?`(@A' 5 B؉?' ?5 B?В@(' 5 B4' ?5 B?`(@' 5 Bȉ?' ?5 B?@' 5 BĀ`5 / 8#\`0a@7  : 8#l #\#`#d#h`@@'a  4#* 8`X@ 8``@  82!8  h@V2 "#8 `@J@`@ .m8`@i `8`d!8@~ @ِ@m`8  ?`&  @& * *@Y?`&  @&  * &@Y!8 `8  @L??@`8@9  ?`&  @ * ** &@Xݒ ?`&  @ ) )* &@X̒ ?`&  * &@X 8 p@# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐!D:`x@Ӑ` *4#x :`@Ȑ::`@:``@ :` @`:`@`X`:`@`X :`@`X :`@ ?`&  * & @Wݒ`(:@``,:@a`0:@a `8:@{a8`4:@vaP`<:@qa``H:@lax`J:@ga`L:@ba`N:@]a`P:a@X`T:a@S:b @O`\`    ,``"`&  4 `':, 0@4 $, `:@+b8 :"#`::bP"#\@` @    ``@@Ɛw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) No changes.re-edit the label? [y]: 5 `@?;@a袒 ?2@2"@+K| ;@˿#@@zs ;a@Z;b@V@-2/2+P); !@Ԑ@ @  ْ@[!a@r @Ɛ@ V#z`@?`? "`@n ?  $? ? n%z``? $`@Y`  $`` 2` n N@+  `@a 2`@*Ғ@` sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀<<bPX<''"`'@' <"h@ᔐ5``@Ꮠ@/  <<@*"xI b@uZ' @Ԑ  @ѐ  @Β 1j #<@C @G &"x<"@\@ߧ @*o"@( '@#@  ``@ᨑ:  @ߟ  @ߜ  @ߙ 䀠 `? 㿘=@ʜ`XL  㿘= X@L   , @ʃL  # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐&`  &``@a ,$ "@ : =!@) ,=a@W 2==2 "a @] 42!4#x`<@@ "`@] vx`@*@@[f '=!(@)Vn6`aP@! :='􀤠3L /-=+='=#=א@ X  '@ah  '@p  'ax@)  L 0&`Xa@  &L "`\@[ ,`$  `L `=a@ ? =!@( 6``6`=2"ؒa@ = `a@ =`@\ǔ a@ =@ZƐ 'a"&`(=!@(˨ b@~ =@Z  '=!@( &`,b@i =@Z  '=!@( &`8b0@T =@Z  '=!@(u &`0b@@? =@Zq  '=!@(`y w&`4bP@* =@Z\  '=!@(Kd b&`<b`@ =@ZG  '=!@(6O  L6`Hbh@ =@Z1  '=!@( 9  66`Jbx@ =@Z  '=!@( #   6`Lb@Ӑ =@Z  '=!@'    6`Nb@ =@Y  '=!@'ޒ &`Pb@ 2 @Yڐ  '=!@'ɒ &`T =L  =*`: `@ `=Ȑ"6`*` @>@Y  '="@' &@="@' %@Y  '=#@' $4, 4c `P@  @ "`@[ `@*@yb  `  @Yb'$@ : ' =#@@'L' ,  "^#YӐ@YA Q$="@'/H @Y1@߶'>, ="@'5 @Y -$="@' $ @Y @ߑ'􀤠, ="@& @X 4$@: 6`#p@& #@[ >=@`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  @" , 2 0@" 2 4@#@&    2 H@# @&   H 2 8@#8@%  8 2 < ,@/ 0& 8 < 2  8@' 4& < @#X@%  @c ( @@%א#p @#@%ϒ  @R ( @@%Ɛ# `@#@%   \)@ 7A5A3A/A-A+A  a  @%= @, 8 ,`:`@%P @# 8 ,`:`@%`2  "    A@%   <@,`:`@%  < ,`:`@%u( 2    ,`:`@%ia` @  4, !Aa  " @%O! h`!@PȒ!@KȐ'`LX'P'T7'@! usage: disklabel [-nv] [-r|-cd] [-t] disk%s (read) disklabel [-nv] [-r|-cd] -e disk%s (edit) disklabel [-nv] [-r|-cd] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)x'2Bؒa @ڋ@<#za,Ba@dBa@_Ba@Z!B"(@'?@QBbp@LBb@GBb@BBc c@=BBcP@7Bc@3BCc@-@"  (   @*`2 RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) 'P0@!P    @  C @ے   C @Ւ  2CCb@g Cb@,@1((@w$@y@   Cc @L  䀢 2CC@#P`8$  7$ l'$ , 4 , C@ؐ#`' z'z 2D 7zD@Ð (`@؃!05zD@N,h$@W$? D  ?`$ * &@M  q/0/1D p@} D@w @*`:` p=* G@@€ C"@uDȒ!@>@:!`@9@6@@! `@"!`DِȒ!@!@@#@! 2DАȒ!@!@@v@͔! 2uDȒ!@!@e`r@Д D@\D@! xȒ!@А@̔!`@ː@Ȓ@<@! `@״!`3DkȒ!@ת!@צ@ @v! 2DbȒ!@ה!@א,(@q@]! 2DIȒ!@{@w!`@v@s@ٔ@=! `@_!`D` Dz @MaD@R@O@<@k "D@BD  L@D @; D@ ؠ DL DD D`@ D!5"@ʐ @@ @ ͒@ D!T`D!`P@K@˔! 5DD!8@(ݰ %D#D Ph@a  r c*  R  y n r #*`@ R` y !@ D@! @ ! @ mD@!4D DDD!Вa@ DL $DD`@W D"@ YD@D@b! Ȁ` @ D@"DȒ!@w!@s!@o@ "`@kD@"0D!T`D@!D`P@@%! D@!8D!@] D@ /!D@7!D(D`?H`"(D"XD"h@+ DȒ@!@!@DDL@@"pDt                                                    H                              l\$ H    x ` <  #!/bin/sh . install.md getresp() { local _no_shell=0 if [ "$1" = "-n" ]; then _no_shell=1 shift fi set -o noglob valid= while [ -z "$valid" ]; do read resp if [ ${_no_shell} -eq 1 ]; then [ -z "$resp" ] && resp=$1 else case $resp in "") resp=$1 ;; !) echo "Type 'exit' to return to install." sh continue ;; !*) eval ${resp#?} continue ;; esac fi valid=true done set +o noglob } isin() { local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" = "$1" ]; then return 0; fi shift done return 1 } addel() { local _a=$1 _seen= shift while [ $# != 0 ]; do echo "$1" if [ "$_a" = "$1" ]; then _seen=yes fi shift done if [ -z "$_seen" ]; then echo "$_a" fi } rmel() { local _a=$1 shift while [ $# != 0 ]; do if [ "$_a" != "$1" ]; then echo "$1" fi shift done } cutword () { local _a _n _oifs=$IFS case $1 in -t?*) IFS=${1#-t}; shift;; esac _n=$1 while read _a; do set -- $_a [ -z "$1" ] && break eval echo \$$_n done IFS=$_oifs } cutlast () { local _a _oifs=$IFS case $1 in -t?*) IFS=${1#-t}; shift;; esac read _a; set -- $_a IFS=$_oifs [ -z "$1" ] && return while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } firstchar () { local _a=$1 while [ ${#_a} != 1 ]; do _a=${_a%?} done echo $_a } basename () { local _oifs [ -z "$1" ] && return _oifs=$IFS IFS=/ set -- $1 IFS=$_oifs while [ "$#" -gt 10 ]; do shift 10; done eval echo \$$# } isnumeric() { local _a=$1 while [ ${#_a} != 0 ]; do case $_a in [0-9]*) ;; *) echo 0; return;; esac _a=${_a#?} done echo 1; return } get_ifdevs() { /sbin/ifconfig -a | egrep -v '^([[:space:]]|(lo|enc|gre|ppp|sl|tun|bridge)[[:digit:]])' | cutword -t: 1 } bsort() { local _l _a=$1 if [ $# == 0 ]; then return fi if [ $# == 1 ]; then echo $1; return fi shift while [ $# != 0 ]; do local _b=$1 if [[ "$_a" != "$_b" ]] ; then if [[ "$_a" > "$_b" ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi shift done echo -n $_a if [[ -n "$_l" ]] ; then echo -n " " bsort $_l fi } list_has_sets() { local _list=$1 _f shift for _f in $* do if isin ${_f}${VERSION}.tar.gz $_list; then return 0 fi if isin ${_f}${VERSION}.tgz $_list; then return 0 fi if [ "$_f" = "kernel" ] && isin bsd $_list; then return 0 fi done return 1 } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } get_localdir() { local _mp=$1 _dir= while : ; do echo -n "Enter the pathname where the sets are stored: [$_dir] " getresp "$_dir" _dir=$resp if [ -z "$_dir" ]; then echo -n "Are you sure you don't want to set the pathname? [n] " getresp n case $resp in y*|Y*) break ;; *) continue ;; esac fi if list_has_sets "`ls -l ${_mp}/${_dir}`" $THESETS then local_sets_dir=$_mp/$_dir break fi cat << __EOT The directory "${_mp}/${_dir}" does not exist, or does not hold any OpenBSD ${VERSION_MAJOR}.${VERSION_MINOR} ${MODE} sets. __EOT echo -n "Re-enter pathname? [y] " getresp y case $resp in y*|Y*) ;; *) local_sets_dir= break ;; esac done } makedev() { local _d=$1 if [ ! -c /dev/r${_d}c ]; then if [ -r /dev/MAKEDEV ]; then (cd /dev; sh MAKEDEV $_d) else echo "Device nodes for $_d are missing, and MAKEDEV" echo "does not exist to create them with. Sorry." false fi fi } getanotherdisk() { cat << __EOT Now you can select another disk to initialize. (Do not re-select a disk you have already entered information for). Available disks are: $_DKDEVS __EOT echo -n "Which one? [done] " getresp done if [ "X${resp}" = "Xdone" ]; then DISK=done elif isin $resp $_DKDEVS ; then DISK=$resp makedev $resp || DISK= else echo "\nThe disk $resp does not exist." DISK= fi } getrootdisk() { local _defdsk _defdsk=`echo $_DKDEVS | cutlast` if [ "${_defdsk}" != "${_DKDEVS}" ]; then _defdsk= fi cat << __EOT The installation program needs to know which disk to consider the root disk. Note the unit number may be different than the unit number you used in the boot program (especially on a PC with multiple disk controllers). Available disks are: $_DKDEVS __EOT echo -n "Which disk is the root disk? [${_defdsk}] " getresp "$_defdsk" if isin $resp $_DKDEVS ; then ROOTDISK=$resp makedev $resp || ROOTDISK= else echo "\nThe disk '$resp' does not exist." ROOTDISK= fi } addhostent() { sed "/ $2\$/d" < /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } addifconfig() { if [ "$3" = "dhcp" ]; then echo "dhcp NONE NONE NONE $5" > /tmp/hostname.$1 addhostent 127.0.0.1 $2 else echo "inet $3 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 fi } configure_all_interfaces() { local _ifsdone= _ifs _ouranswer= _reprompt=1 _IFS=`get_ifdevs` resp= while [ "X${resp}" != X"done" ]; do if [ $_reprompt = 1 ]; then cat << __EOT You may configure the following network interfaces (the interfaces marked with [X] have been successfully configured): __EOT for _ifs in $_IFS; do if [ -z "$_ouranswer" ]; then _ouranswer=$_ifs fi if isin $_ifs $_ifsdone ; then echo -n " [X] " else echo -n " [ ] " fi echo $_ifs done echo fi echo -n "Configure which interface? (or 'done') [$_ouranswer] " getresp "$_ouranswer" case $resp in "done") ;; "") _reprompt=0 ;; *) _ifs=$resp _ouranswer=done if isin $_ifs $_IFS ; then if configure_ifs $_ifs ; then _ifsdone="$_ifs $_ifsdone" else _ouranswer= fi else echo "Invalid response: '$resp' is not in list" fi _reprompt=1 ;; esac done } configure_ifs() { local _up _if_name=$1 _if_ip _if_mask local _if_symname _if_extra _hostname local _dhcp_prompt set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` _up=$1 _if_ip=$2 _if_mask=$3 if [ $_up = "UP" ]; then ifconfig $_if_name delete down fi if [ ! -x /sbin/dhclient ]; then echo "DHCP install not supported\n" else _dhcp_prompt=" (or 'dhcp')" fi resp= while [ -z "$resp" ] ; do echo -n "IP address${_dhcp_prompt}? [$_if_ip] " getresp "$_if_ip" if [ ! -x /sbin/dhclient -a "X$resp" == "Xdhcp" ]; then resp= fi _if_ip=$resp done _hostname=`hostname` resp= while [ -z "$resp" ] ; do echo -n "Symbolic (host) name? [$_hostname] " getresp "$_hostname" _if_symname=$resp done if [ "$_if_ip" != "dhcp" ]; then resp= if [ -z "$_if_mask" ]; then _if_mask=255.255.255.0 fi while [ -z "$resp" ]; do echo -n "Netmask? [$_if_mask] " getresp "$_if_mask" _if_mask=$resp done fi if [ -n "`ifconfig -m ${_if_name} | sed -n '/media/p'`" ]; then cat << __EOT Your use of the network interface may require non-default media directives. The default media is: __EOT ifconfig -m ${_if_name} | sed -n ' /supported/D /media:/p' echo "This is a list of supported media:" ifconfig -m ${_if_name} | sed -n ' /media:/D s/^ // /media/p' cat << __EOT If the default is not satisfactory, and you wish to use another media, copy that line from above (e.g. "media 100baseTX") __EOT echo -n "Media directives? [$_if_extra] " getresp "$_if_extra" if [ -n "$resp" ]; then _if_extra=$resp fi fi if [ "$_if_ip" = "dhcp" ]; then ifconfig ${_if_name} down ${_if_extra} cat > /etc/dhclient.conf << __EOT initial-interval 1; send host-name "$_hostname"; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "hostname-associated DHCP attempt for $_if_name failed..." ifconfig $_if_name delete down cat > /etc/dhclient.conf << __EOT initial-interval 1; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "free-roaming DHCP attempt for $_if_name failed." ifconfig $_if_name delete down return 1 else echo "DHCP attempt for $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else echo "DHCP configuration of $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else ifconfig ${_if_name} down if ifconfig ${_if_name} inet \ ${_if_ip} \ netmask ${_if_mask} ${_if_extra} up then addifconfig ${_if_name} ${_if_symname} ${_if_ip} ${_if_mask} "${_if_extra}" return 0 fi fi return 1 } isalphanumeric() { local _n _n=$1 while [ ${#_n} != 0 ]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } enable_network() { for _netfile in hosts myname; do if [ ! -f /mnt/etc/${_netfile} ]; then echo "ERROR: no /mnt/etc/${_netfile}!" return 1 fi done for _netfile in hosts myname dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done hostname=`cat /etc/myname` hostname $hostname _didnet=1 ifconfig lo0 inet localhost route -n add -host $hostname localhost > /dev/null route -n add -net 127 127.0.0.1 -reject > /dev/null for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|""|"rtsol") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "X$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -n add -host $name 127.0.0.1" ;; inet6) continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done < /mnt/etc/hostname.$if done if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route -n add -host default `cat /mnt/etc/mygate` fi get_fqdn /etc/resolv.conf echo "Network interface configuration:" ifconfig -am if [ -f /etc/resolv.conf ]; then route show echo "\nResolver enabled." else route -n show echo "\nResolver not enabled." fi return 0 } get_selection() { local _next=done _f _sets=$1 for _f in $_sets ; do if isin $_f $_setsdone ; then echo -n " [X] " else echo -n " [ ] " if [ "X$_next" = "Xdone" ]; then _next=$_f fi fi echo $_f done echo -n "File name? [$_next] " getresp "$_next" case $resp in +|-) resp= esac } glob_selection() { local _selection=$1 _src=$2 _sets=$3 local _action _matched _tfile _f if [ -z "$_selection" ]; then return fi _action=add case $_selection in +*) _selection=${_selection#?} ;; -*) _selection=${_selection#?} _action=remove ;; esac set -o noglob if [ X"$_selection" = X"all" ]; then _selection=* fi _tfile=/tmp/install_case.$$ cat >$_tfile << __EOT case \$_f in $_selection) if [ "\$_action" = "add" ]; then _get_files=\`addel \${_f} \${_get_files}\` _setsdone=\`addel \${_f} \${_setsdone}\` elif [ "\$_action" = "remove" ]; then _get_files=\`rmel \${_f} \${_get_files}\` _setsdone=\`rmel \${_f} \${_setsdone}\` else echo "Unknown action: \$_action" fi _matched=\$(( \$_matched + 1 )) ;; esac __EOT set +o noglob _matched=0 for _f in $_sets; do . $_tfile done rm -f $_tfile if [ $_matched -eq 0 ]; then cat << __EOT The file '${_src}/${_selection}' does not exist. Check to make sure you entered the name properly. __EOT fi } display_failure_msg() { cat << __EOT The following files failed to extract correctly. Choose which one(s) to retry or 'done' to exit selector. You may de-select a file by prepending a '-' to its name. __EOT } display_selection_msg() { cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT } display_extract_msg() { cat << __EOT You will now be asked which sets to ${MODE}. Some of these sets are required for your ${MODE} and some are optional. You will want at least the base and bsd sets. Consult the installation notes if you are not sure which sets are required! __EOT } get_sets_list () { local _f _file_list=$1 _src=$2 _sets= for _f in $THESETS ; do if [ "X${_f}" = "Xkernel" ]; then if isin bsd $_file_list; then _sets="$_sets bsd" fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then _sets="$_sets ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then _sets="$_sets ${_f}${VERSION}.tgz" fi done if [ -z "$_sets" ]; then cat << __EOT The directory '${_src}' contains no OpenBSD ${VERSION_MAJOR}.${VERSION_MINOR} ${MODE} sets. __EOT echo -n "Search for other *.tar.gz and *.tgz files? [y] " getresp y case $resp in n*|N*) return ;; esac for _f in $_file_list ; do case $_f in *.tar.gz|*.tgz) _sets="$_sets ${_f}" esac done fi if [ -z "$_sets" ]; then eval echo "There are no *.tar.gz or *.tgz files in ${_src}." echo -n "See a directory listing? [y] " getresp y case $resp in n*|N*) return ;; esac echo "\n${_file_list}\n" return fi } get_get_files_list () { local _src=$1 _get_files= _osetsdone=$_setsdone for _f in $_sets ; do case $_f in base*|bsd|comp*|etc*|game*|man*|misc*) if ! isin ${_f} ${_setsdone}; then _get_files=`addel ${_f} ${_get_files}` _setsdone=`addel ${_f} ${_setsdone}` fi ;; esac done while : ; do display_selection_msg get_selection "$_sets" if [ "X${resp}" = "Xdone" ]; then break fi glob_selection "$resp" "$_src" "$_sets" done } install_get_files_list () { local _f _failed_files _src=$1 _public_src=$2 echo -n "Ready to ${MODE} sets? [y] " getresp y case $resp in y*|Y*) ;; *) _setsdone=$_osetsdone return 1 ;; esac while [ -n "${_get_files}" ] ; do _failed_files= echo for _f in $_get_files ; do echo "Getting ${_f} ..." case $_f in *.tar.gz|*.tgz) ftp ${_ftp_active} -o - -V -m "${_src}/${_f}" | tar zxpf - -C /mnt ;; *) ftp ${_ftp_active} -o "/mnt/${_f}" -V -m "${_src}/${_f}" ;; esac if [ $? -ne 0 ]; then _setsdone=`rmel $_f $_setsdone` _failed_files="${_failed_files} ${_f}" fi done _get_files= while [ -n "${_failed_files}" ] ; do display_failure_msg get_selection "$_failed_files" if [ "X${resp}" = X"done" ]; then break fi glob_selection "$resp" "$_public_src" "$_failed_files" done done } encode_for_url() { echo "$1" | sed -e 's/:/%3a/g' -e 's/@/%40/g' -e 's/\//%2f/g' } install_url() { local _f _file_list _url_type _url_base _url_login _url_pass _oifs case $1 in -ftp) _url_type=ftp ;; -http) _url_type=http ;; esac cat << __EOT This is an automated ${_url_type}-based installation process. You will be asked questions and then the files will be retrieved iteratively via ${_url_type}. __EOT if [ -z "$_proxy_host" ]; then _proxy_host=none fi echo -n "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none') [${_proxy_host}] " getresp "$_proxy_host" if [ "X${resp}" = X"none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi if [ "${_url_type}" = "ftp" -a -z "$ftp_proxy" ]; then case $_ftp_active in -A) resp=y ;; *) resp=n ;; esac cat << __EOT By default, ftp will attempt a passive connection and fall back to a normal (active) connection if that does not work. However, there are some very old ftp servers that claim to support passive mode, but really do not. In this case, you should explicitly request an active session. __EOT echo -n "Do you want to use active ftp? [${resp}] " getresp "$resp" case $resp in y*|Y*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi [ -z "$_ftp_getlist" ] && _ftp_getlist=y echo -n "Do you want a list of potential ${_url_type} servers? [${_ftp_getlist}] " getresp "$_ftp_getlist" case $resp in n*|N*) _ftp_getlist=n ;; *) _ftp_getlist=y ftphost=129.128.5.191 if [ "X${_resolver_enabled}" = X"TRUE" ]; then ftphost=ftp.openbsd.org fi ftp ${_ftp_active} -V -a -o /tmp/ftplist ftp://${ftphost}/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist > /dev/null cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE ;; esac resp= while [ -z "$resp" ] ; do if [ -f /tmp/ftplist ]; then eval echo -n "Server IP address, hostname, or list#? [\$_${_url_type}_server_ip]\ " else eval echo -n "Server IP address, or hostname? [\$_${_url_type}_server_ip]\ " fi eval getresp "\$_${_url_type}_server_ip" if [ "X$resp" = "X?" -a -f /tmp/ftplist ]; then cat /tmp/ftplist | grep "^${_url_type}:" | cat -n | less -XE resp= elif [ -n "$resp" \ -a `isnumeric $resp` -eq 1 \ -a ${resp:-0} -ge 1 \ -a -f /tmp/ftplist ] then maxlines=`grep "^${_url_type}:" /tmp/ftplist | cat -n | sed -n -e '$p' | cutword 1` if [ $maxlines -lt $resp ]; then echo "There is no ${resp}th line in the list." resp= continue fi tline=`grep "^${_url_type}:" /tmp/ftplist | sed -n -e "${resp}p"` url=`echo $tline | sed -e "s/^${_url_type}:\/\///" | cutword -t' ' 1 | cutword -t' ' 1` host=`echo $url | cutword -t/ 1` path=`echo $url | sed -e "s/^${host}\///"` path=${path}/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH} eval _${_url_type}_server_ip=$host eval _${_url_type}_server_dir=$path resp= echo "Using $tline" else eval _${_url_type}_server_ip=$resp fi done if [ "${_url_type}" = "ftp" -a -z "$_ftp_server_dir" ] ; then _ftp_server_dir=pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH} fi resp= while [ -z "$resp" ] ; do eval echo -n "Server directory? [\$_${_url_type}_server_dir]\ " eval getresp "\$_${_url_type}_server_dir" eval _${_url_type}_server_dir=$resp done if [ "${_url_type}" = "ftp" ]; then if [ -z "$_ftp_server_login" ] ; then _ftp_server_login=anonymous fi if [ -z "$_ftp_server_password" ] ; then _ftp_server_password=root@`hostname`.${FQDN} fi _oifs=$IFS IFS= resp= while [ -z "$resp" ] ; do echo -n "Login? [${_ftp_server_login}] " getresp "$_ftp_server_login" _ftp_server_login=$resp done if [ "${_ftp_server_login}" != "anonymous" ]; then resp= while [ -z "$resp" ] ; do echo -n "Password (will not echo): " stty -echo getresp -n "$_ftp_server_password" stty echo echo _ftp_server_password=$resp done else _ftp_server_password=root@`hostname`.${FQDN} fi IFS=$_oifs fi if [ "${_url_type}" = "ftp" -a "${_ftp_server_login}" != "anonymous" ]; then _url_login=`encode_for_url "${_ftp_server_login}"` _url_pass=`encode_for_url "${_ftp_server_password}"` _url_base=ftp://${_url_login}:${_url_pass}@${_ftp_server_ip}/${_ftp_server_dir} else eval _url_base=${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir fi if [ "${_url_type}" = "ftp" -a -z "$ftp_proxy" ] ; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else _file_list=`ftp -o - -V "${_url_base}/index.txt" | sed 's/ //'` fi get_sets_list "$_file_list" "`eval echo \\$_${_url_type}_server_dir`" [ -z "$_sets" ] && return display_extract_msg get_get_files_list "`eval echo \\$_${_url_type}_server_dir`" [ -z "$_get_files" ] && return cat << __EOT Fetching files via ${_url_type} may take a long time, especially over a slow network connection. __EOT install_get_files_list "$_url_base" "`eval echo \$_${_url_type}_server_dir`" if [ $? -eq 0 ] ; then eval _installed_via_${_url_type}=1 fi } install_from_mounted_fs() { local _f _get_files _file_list if [ ! -d "$1" ]; then echo "No such directory: '$1'" return fi _file_list=`ls -l ${1}` get_sets_list "$_file_list" "$1" [ -z "$_sets" ] && return display_extract_msg get_get_files_list "$1" [ -z "$_get_files" ] && return install_get_files_list "file:$1" "$1" } install_cdrom() { local _drive _range _part _fstype _directory _n if [ -z "$_CDDEVS" ]; then echo "No CD-ROM devices were found. Aborting." return fi cat << __EOT The following CD-ROM devices are installed on your system. Please make sure the CD is in the CD-ROM drive and select the device containing the CD with the installation sets: $_CDDEVS __EOT _drive=`echo $_CDDEVS | cutword 1` echo -n "Which CD-ROM contains the installation media? [$_drive] " getresp "$_drive" case $resp in abort) echo "Aborting." return ;; *) if isin $resp $_CDDEVS ; then _drive=$resp else echo "\nThe CD-ROM $resp does not exist.\nAborting." return fi ;; esac _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive. Aborting." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else _range=`md_get_partition_range` resp= while [ -z "$resp" ] ; do echo -n 'CD-ROM partition to mount? (normally "c") [c] ' getresp c case $resp in $_range) _part=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT There are two CD-ROM filesystem types currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= while [ -z "$resp" ] ; do echo -n "Which filesystem type? [cd9660] " getresp cd9660 case $resp in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: '$resp'" resp= ;; esac done fi rm -f /tmp/label.$_drive if ! mount -t ${_fstype} -o ro /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive. Aborting." return fi resp= _directory=${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH} echo "Enter the directory relative to the mount point that contains" echo -n "the file: [${_directory}] " getresp "$_directory" install_from_mounted_fs "/mnt2/${resp}" umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { local _drive _def_partition _partition_range _partition _fstype local _fsopts _md_fstype _md_fsopts cat << __EOT The following disk devices are installed on your system; please select the disk device containing the partition with the installation sets: $_DKDEVS __EOT echo -n "Which is the disk with the installation sets? [abort] " getresp abort case $resp in abort) echo "Aborting." return 0 ;; *) if isin $resp $_DKDEVS ; then _drive=$resp else echo "\nThe disk $resp does not exist.\nAborting." return 0 fi ;; esac cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 0 fi fi resp= while [ -z "$resp" ]; do echo -n "Partition? [$_def_partition] " getresp "$_def_partition" case $resp in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs __EOT _md_fstype=`md_native_fstype` _md_fsopts=`md_native_fsopts` if [ -n "$_md_fstype" ]; then echo " $_md_fstype" else _md_fstype=_undefined_ fi resp= while [ -z "$resp" ]; do echo -n "Which filesystem type? [default] " getresp default case $resp in default) _fstype= _fsopts=ro ;; ffs) _fstype="-t $resp" _fsopts=async,ro ;; $_md_fstype) _fstype="-t $resp" _fsopts=$_md_fsopts ;; *) echo "Invalid response: $resp" resp= ;; esac done if ! mount $_fstype -o $_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk. Aborting." return 0 fi return 1 } install_disk() { if mount_a_disk ; then return fi echo "Enter the directory relative to the mount point that" echo -n "contains the file: [.] " getresp "." install_from_mounted_fs "/mnt2/${resp}" umount -f /mnt2 > /dev/null 2>&1 } install_nfs() { resp= while [ -z "$resp" ] ; do echo -n "Server IP address or hostname? [${_nfs_server_ip}] " getresp "$_nfs_server_ip" done _nfs_server_ip=$resp resp= while [ -z "$resp" ]; do echo -n "Filesystem on server to mount? [${_nfs_server_path}] " getresp "$_nfs_server_path" done _nfs_server_path=$resp echo -n "Use TCP transport? (only works with capable NFS server) [n] " getresp n case $resp in y*|Y*) _nfs_tcp=-T ;; *) _nfs_tcp= ;; esac mkdir /mnt2 > /dev/null 2>&1 if ! mount_nfs $_nfs_tcp ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server. Aborting." return fi resp= while [ -z "$resp" ]; do echo "Enter the directory relative to the mount point that" echo -n "contains the file: [.] " getresp done install_from_mounted_fs "/mnt2/${resp}" umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT _tape=`basename $TAPE` resp= while [ -z "$resp" ]; do echo -n "Name of tape device? [${_tape}]" getresp "$_tape" done _tape=`basename $resp` TAPE=/dev/${_tape} if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." echo "Aborting." return fi export TAPE echo -n "Rewinding tape..." if ! mt rewind ; then echo "$TAPE may not be attached to the system or may not be" echo "a tape device. Aborting." return fi echo "done." resp= while [ -z "$resp" ]; do echo -n "File number? " getresp case $resp in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= ;; esac done echo -n "Skipping to source file..." if [ "X${_nskip}" != X"0" ]; then if ! mt fsf $_nskip ; then echo "Could not skip $_nskip files. Aborting." return fi fi echo "done." cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= while [ -z "$resp" ]; do echo -n "Which way is it? [1] " getresp 1 case $resp in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." resp= ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } get_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [ ! -d $_zoneroot ] && return cat << __EOT Select a time zone for your location. Timezones are represented on the system by a directory structure rooted in "/usr/share/timezone". Most timezones can be selected by entering a token like "CET" or "GMT-6". Other zones are grouped by continent or country, with detailed zone information separated by a slash ("/"), e.g. "US/Pacific" or "Canada/Mountain". __EOT if [ -L /mnt/etc/localtime ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#${_zoneroot#/mnt}} fi [ -z "$TZ" ] && TZ=GMT while : ; do _zonepath=$_zoneroot echo -n "What timezone are you in? ('?' for list) [$TZ] " getresp "$TZ" if [ "$resp" = "?" ]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [ -d "$_zonepath" ]; do echo -n "Select a sub-timezone of " echo -n "'${_zonepath#$_zoneroot}' ('?' for list): " getresp if [ "$resp" = "?" ]; then ls -F ${_zonepath} else _zonepath=${_zonepath}/${resp} fi done if [ -f "$_zonepath" ]; then TZ=${_zonepath#$_zoneroot} echo "You have selected timezone '$TZ'". ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { if [ ! -s /mnt/bsd ]; then cat << __EOT Warning, no kernel (/mnt/bsd) installed! You did not unpack a file set containing a kernel -- this is needed to boot. Please note that the install kernel is *not* suitable for general use. __EOT elif [ ! -f /mnt/bin/cat ]; then cat << __EOT You still do not have a /bin/cat in your filesystem (i.e. a sample random file which you probably want). This seems to indicate that you are still missing important distribution files. __EOT elif [ ! -x /mnt/dev/MAKEDEV ]; then cat << __EOT No /dev/MAKEDEV has been installed yet. __EOT elif [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then cat << __EOT One or more of /etc, /usr/share/zoneinfo or /dev is missing. Did you forget to extract a required set? __EOT else return 0 fi cat << __EOT You will now be given the chance to install the missing set(s). You can enter '!' at the prompt to escape to a shell and fix things by hand if you wish. __EOT return 1 } install_sets() { local _yup=FALSE _have_nfs [ -f /sbin/mount_nfs ] && _have_nfs=true cat << __EOT You must now specify where the ${MODE} sets you want to use are. They must either be on a local device (disk, tape, or CD-ROM), an accessible NFS filesystem or an accessible ftp or http network server. You will have the chance to repeat this step or to extract sets from several places, so you do not have to try to load all the sets in one try and can recover from some errors. __EOT if [ -n "$local_sets_dir" ]; then install_from_mounted_fs "${local_sets_dir}" [ -n "$_setsdone" ] && _yup=TRUE fi resp= while [ -z "$resp" ]; do if [ X"$_yup" = X"FALSE" ]; then echo -n "Install from (f)tp, (h)ttp, (t)ape, (C)D-ROM" [ -n "$_have_nfs" ] && echo -n ", (N)FS" echo -n " or local (d)isk? " getresp case $resp in d*|D*) install_disk resp=d ;; f*|F*) [ -n "$_didnet" ] || donetconfig install_url -ftp resp=f ;; h*|H*) [ -n "$_didnet" ] || donetconfig install_url -http resp=h ;; t*|T*) install_tape resp=t ;; c*|C*) install_cdrom resp=c ;; n*|N*) [ -n "$_didnet" ] || donetconfig if [ -n "$_have_nfs" ]; then install_nfs resp=n else echo "Invalid response: $resp" resp= fi ;; *) echo "Invalid response: $resp" resp= ;; esac else _yup=FALSE fi if sane_install; then echo -n "\nExtract more sets? [n] " getresp n case $resp in y*|Y*) # Force loop 8@HPX`hpx(08@HPX`hpx8@HPX`hpx(08@HPX`hpx8@HPX`hpx(08@HPX`hpxto repeat resp= ;; esac else resp= fi done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do case $_dev in \#*) continue ;; esac case $_fstype in ffs) ;; *) continue ;; esac case $_opt in *noauto*) continue ;; esac _opt="$(echo ${_opt} | sed 's/,softdep,/,/; s/,softdep//; s/softdep,//')" if [ "$_mp" = "/" ]; then _mp= fi echo $_dev /mnt$_mp $_fstype $_opt $_rest done > /etc/fstab } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do if [ "X{$_mp}" != X"/mnt" ]; then mkdir -p $_mp fi if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } cleanup_on_exit() { local _bad_devs echo "\nCleaning up..." if [ -f /var/run/dhclient.pid ]; then echo "Stopping dhclient" kill -HUP `sed -ne "1p" /var/run/dhclient.pid` > /dev/null 2>&1 rm -f /var/run/dhclient.pid fi if [ -f /etc/fstab ]; then umount -av elif [ ! "`df /`" = "`df /mnt`" ]; then umount -v /mnt fi echo "Done." } remount_fs() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do if ! mount -u -o $_opt $_dev $_mp ; then exit 1 fi done < /etc/fstab } check_fs() { local _dev _rest _badfsck=0 _root=$1 while read _dev _rest; do [ "$_dev" = "$_root" ] && continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck this device manually." _badfsck=1 else echo "OK." fi done < /etc/fstab return $_badfsck } get_fqdn() { if [ -f "$1" ]; then FQDN=`sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' $1` fi if [ -f "$2" -a -n "$FQDN" ]; then sed "s/\\(.*\\)[[:space:]]\\(.*\\)\$/\\1 \\2.$FQDN \\2/" < $2 > $2.new mv $2.new $2 else echo -n "Enter DNS domain name (e.g. 'bar.com'): [$FQDN] " getresp "$FQDN" FQDN=$resp fi } donetconfig() { _didnet=1 _nam= if [ -f /tmp/myname ]; then _nam=`cat /tmp/myname` fi resp= while [ -z "$resp" ] ; do echo -n "Enter system hostname (short form, e.g. 'foo'): [$_nam] " getresp "$_nam" done hostname $resp echo $resp > /tmp/myname echo "::1 localhost\n127.0.0.1 localhost" > /tmp/hosts rm -f /tmp/hostname.* rm -f /tmp/resolv.conf.shadow cat << __EOT If any interfaces will be configured using a DHCP server it is recommended that you do not enter a DNS domain name, a default route, or any name servers. __EOT FQDN= get_fqdn /tmp/resolv.conf configure_all_interfaces if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf fi get_fqdn /tmp/resolv.conf /tmp/hosts resp=`route -n show | grep '^default' | sed -e 's/^default *//' -e 's/ .*//'` if [ -z "$resp" ] ; then resp=none if [ -f /tmp/mygate ]; then resp=`cat /etc/mygate` if [ -z "$resp" ]; then resp=none fi fi fi echo -n "Enter IP address of default route: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp=none if [ -f /tmp/resolv.conf ]; then resp= for n in `grep '^nameserver ' /tmp/resolv.conf | \ sed -e 's/^nameserver //'` do if [ -z "$resp" ] ; then resp=$n else resp="$resp $n" fi done fi echo -n "Enter IP address of primary nameserver: [$resp] " getresp "$resp" if [ "X${resp}" != X"none" ]; then echo "search $FQDN" > /tmp/resolv.conf for n in `echo ${resp}`; do echo "nameserver $n" >> /tmp/resolv.conf done echo "lookup file bind" >> /tmp/resolv.conf echo -n "Would you like to use the nameserver now? [y] " getresp y case $resp in y*|Y*) cp /tmp/resolv.conf /tmp/resolv.conf.shadow ;; esac fi if [ ! -f /tmp/resolv.conf.shadow ]; then echo "\nThe host table is as follows:\n" cat /tmp/hosts cat << __EOT You may want to edit the host table in the event that you are doing an NFS installation or an FTP installation without a name server and want to refer to the server by name rather than by its numeric ip address. __EOT echo -n "Would you like to edit the host table with ${EDITOR}? [n] " getresp n case $resp in y*|Y*) ${EDITOR} /tmp/hosts ;; esac fi cat << __EOT You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __EOT echo -n "Escape to shell? [n] " getresp n case $resp in y*|Y*) echo "Type 'exit' to return to install." sh ;; esac } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } finish_up() { get_timezone echo -n "Making all device nodes (by running /dev/MAKEDEV all) ..." cd /mnt/dev sh MAKEDEV all echo "... done." cd / md_installboot ${ROOTDISK} populateusrlocal [ -x /mnt/${MODE}.site ] && /mnt/usr/sbin/chroot /mnt /${MODE}.site trap - HUP INT QUIT TERM EXIT cleanup_on_exit md_congrats exit 0 } ######################################################################## ######################################################################## ROOTDISK= VERSION=31 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR _DKDEVS=`md_get_diskdevs` _CDDEVS=`md_get_cddevs` THESETS="base etc misc comp man game xbase xshare xfont xserv site $MDSETS" local_sets_dir= _sets= _setsdone= _osetsdone= _get_files= if [ -z "$EDITOR" ] ; then EDITOR=ed if [ -x /usr/bin/vi ]; then EDITOR=vi fi export EDITOR fi trap 'cleanup_on_exit' EXIT trap 'exit 2' HUP INT QUIT TERM echo md_welcome_banner if [ -f /etc/fstab -a "${MODE}" = "install" ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT echo -n "Skip disk initialization and p" else echo -n "P" fi echo -n "roceed with ${MODE}? [n] " getresp n case $resp in y*|Y*) echo "\nCool! Let's get to it...\n" ;; *) md_not_going_to_install exit ;; esac md_set_term cat << __EOT At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. __EOT No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. 㻘 Hz @Ja0 N    , zH!`8@  p0 `E  `AzH!@`x0 -H` +H   , @`2  "    a//%z)H'H@ܔ p@-` N,  ` @ @ǒ    6 ,     6 & &&& & @ &.  . $  &. 6@ " {&$&@ .   +  ". +      "  +  2  `+ . @[  2N& ϐ@J H!0@ a&&@ 28&@c 21&!(`" 2@ 2"&@ 2&@ 2&" &$ @ ? @Cpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. 㿘II!a@; 2JIz!@Ia07*   & zH!a@͔`0&    `zI!a@0 `   * 5aL*@ zI!@b0@partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and size㿈II#pc@ 2JIz!@I2a0,`    `' ' '' @&  zH!a@I`0    zI!a@;0@ w    `  " ` `      zIc!@ , &" &@d D@ 2T$ N$@ڔ J@E $ $@ #!(`"'   2! @L @   2 @  $$ $ $  a$ @? @ϐpartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. 㿘JJ#hc@ 2JIz!@H$a0q*!  j" `  " "``""` &"`"`"`"` `0O   .zH!a@(`:` `  ` zI!@a(`  Jz#@Gےa` a$!      ` &" " " " ` .@ @ρ&@device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐!D.K@"x 5! * K@"K  @"K  @" (K@" ,K@" 0K@" 8K@# 4K@# <K@#(K@}#@ HK@y#X K@u#h>ϐKc#\KK#㸔@e  #z`> 㿐@ b! a !$ `@@   * @  8? @ ?   + @@  @  #@S    "&@+  "@ @    +  +   `+ &@@^partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk 㿐LL#c @ 2JIzj!आ   ,zH!a@L`0o `  zI!a@@0cL@@\#XL@# ` L`##\`  #`@ڒ??Iz/!2@Lz)# 9 `   # @ zM!@`0'" &@"@ @ &@ ` < Mz 0@Ea0`a$  $@@˔? @㿐@  @! a$  @ # `@@T@"@%s: [%s] 㿘 M#@*`'zC"ؒ@``$@Nb 2` ` ,` X ?4  " X* $ X @Dΐ $ `@L $L?L ", L ?@Ɛ L` L`@Mq#,#L` ?`%s: [%u] Rounding to nearest cylinder: %u 㻐 8` \@ۦ z `/+N@^`$@N  ` /X ?4  "X* $X @Dl Ӱ?@ ?L@ O ,@O ?O@dO ? *`O `tr p`&? @ r #*`@ `?* : ` O ܓ*` € 8 (,@  ($ ( (@w,@O + -   !j'$"x@d"x "4?J` $"x-? 5' B! '@Đ '5 ! 7ā@' B'-:  + -"'`@?> '5"B 8' 5"B5"5B!7ƅB' B' @ѫ"8@Ѥ" @ў"N @o:p:h:::::::::: Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] 㻐@ܒ  0@˧ @`@ sz  O-`,`@@   `l?l""@2 2``a`a@ O@;!8  荚   膚 Ŧ/O -z`'%"$* @p`/$@L O X` ?"` X* $ X@B # O` ڐ?*  *  @ @ @5&`@ -`(2 @@# Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.`!@̰DO@#5 ;P9P7P5P/z P5*`  Ғ`( "II@J    a  , @J 2  )@@B0ภ #z)Pa %P, @} @B"`  , `` ?"``* $`@A   PP6  В` 2 Iz!@Aa0" &@Iza@A!@@!0ޒ@J- . ')P'P%L#z ,#\#` !(8Ś ?〤?@A֒a ,& ,)P'P%L#z 0#\#` !Xh ?ˀ?@Aa 0& 0)P'P%L#z 8#\#` ! ??@Aa 8& 8)P'P%L#z 4#\#` !} ??@Aa 4& 4)P'P >a$ <"@ zP!@b <"@ 4 P@  4@ #\#`L ?j?2  <Lz#@AZa <#Δa$ˀ @$ @P&@@Ԑ"a$8$a$& <)P'P%L#z H#\#` # ?@ ` "`@_$@`<@㿘   `" `2 @r ` ``  /dev/%s%s%s%c %s %s rw 1 %d x @ |   , @ " "@ "    `e[#@tՔ  N r [@$@ / "`N@`r2G [.@$@}`.@@?,_ |@o̔ D@Aǒ`  )  "[5#a|   @*  ` a*@ @#\#\@  `@ 2@@ Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. 㿐.` K\c!!z-I+L)\'\%\ ` #\`   #`< @6N!% 2c@6G! ` ! !@q! ` !$ !@h ` `!@_0 ` $` Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors 㿐.` %K%#]``2   < Mz7 0  "N$ " @&E$z]!@a  `#\``  #`? ?Iz!@5a&  Lz#@5a " z]!@`  a$ z]!@` $ fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block size㿐.` -]+])I%z'L`#\#`hcx, ??!@5> @58` 2$`]@#$` block sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. 㿐.` ` 9^, J Iz!@4ڒaC 7^)z5L/^-^+^ @M@I#\#` 淪?߀?@o: @o!@ @s @v aP@4! @l,  cpgNumber of filesystem cylinders per group. Usually 16 or 8.㿐.` ^^b")I#z%L   #\#`R ??!@4ea  24 @4^a  FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).㿐.`  ` `(5!L*` ^^#cఒ   , @@ *&@Cb@z z"(@3a@a؀!_"   _Iz!@3a b @; 2N@  @@&@ 㿘 2 @@ 2  2@ `?@nmCan't stat deviceioctl DIOCGDINFO8@Y? _c@$ @! #eCb@ `r@q 6 &@`e@j 6&@_c@  &[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. 㿘  ``` `H 2 Izg!?* : `3da *` €2(`zU!& (,& ,0& 04& 48& 8<Q& <`2`(`zB!& (`,& ,`0& 0`4& 4`8& 8`<>& <2(`z/!`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ `z!@2Sa0`z!@2Ma||㿘 " " " "   <& 㿘@9ŔFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`G"?"H@xH#ĨGG?զ $""#`"#"" (r#bc ( € a!@"`$" @!  $"j"xaH@I "R#`N @ K"  a!h "`$"&@!  $"j"xax@I֐ " $("+#`' @t $"  a!h "`$" @k! $"j"xa@I  "a!G "" " ?1 "@ j"xa @I #"@/ 6  j"x a@I "< @  aa@ID "@??$"$(@2 "a@3   @" $  @ ?2 $2 $j"x`2$ `2$(#Ā  `#GG ""b s##ib#*` €c?#Ā  c#ԀG""Z"c̐c @>c? !"#"c#Ā ! G#G>""?;"b#Ā !#Ԁ  : c@ 0@%#?"#%G1G>$##̀  : c@ 0@#̀ # $##Ā ?# &"&""G"b"%G $  @@8@<<%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿀Gb   "#"b"` # G"`#G#`'H?`" * " @/m  0c@`@#Gb( #@ H <   H 4 0 H@`$b(H#Ā` 4` !G", @ ",@ @p `G"`2 !H#c@/ H#@"c"?$ H#Ȣ"`"Gb "b f"##`'H?`" * " @. $#cȀ ! `0cؒ`P@@P>"cc 0@jl x c֐ c`   @~%Ք @p0 0@jM %c 0Gcb`?#\#`#d@V#h@$?cG"`Gb   %G#?@? 4$ Unable to truncate archive file㿘G"G"b$ 1G"  @    "@|   j"xd @GN ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘G"`da@F ?#`` #d 0b@F ? Failed read on archive volume %dEnd of archive volume %d reached㿘G" 3G" Gb@^   """!""#`b@L  "b $" jG"xd"@Fʐ 0G"db@F Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘G" Gb @  G"b"$6$" $" G" @ & : !b  @ .  > b b@{Ԕ $  $" j"x?倢` E0 j"x  dc@F $" C    $"  G "$ "b$  e` @E 0' G"db@Eې 0 HjG"xe"X@E 0#``"e@ ee`@E 0`@E Cannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐"`g?Gb b HcĐ? eWcP" "bG" 4=#"9#@ #"2$ Gb7  a'@] 6&$ % #"b %G"%G  @Ж  > @~E@ d@–   $ #" ec@E1  ec@E+ ?Foward positioning operation on archive failed㿘  >2@ `(= G" 4G5"`21 !G"  @   #@ 0C 4 2 > 4(>0@ b >0  "@f   j"xf @E?$b ?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐G" 6G" K  f{ `(y$  @Dxbp? !Gn `(l$ "  @   j"xf @DX?b G"`f @DQcHI?    "@̖ B j"xf @Dmp7?@r 1Հ "#0 `(.$  :`@})@ f@D#c? 7@{G' a@   j"xf @D7Ȑ?$ ?$  Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?cG"  `'G?c @Z? 4  j"xg8@Cݐ }?  7'!  @!   j"xgX@CȐ h?7'!@  ?j"xg@C W?#@!?  j"xg@C F?@? 4  j"xg8@C 6? 7'# a@\  j"xgX@C #?!%b @ fc@CH ? 7@'a@:  j"xg@Ca ?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈Ւc @ j"xhx@Bt  @  j"xh@Be b  G"$`c0 @d 0h@A!a @dah `a@da@ {G" w u  G"`h@Aؐ!h@AՐ" H"`h@Aΐ"8h@Aː"`HcĐ?  hh@A" ;h $"0 @A";h7h5h/h9G!h+h3h'h)h0@Ab@A@A@A8@A, @dc`  O ?%0ch@A'" "#`O 2#x`Y `s`S#x0 `y#x` `@Aw0@As#'i#x@An0G"h@Ag#'i!i @A`0@A]@A[ (@Aj, hc`@dS O G?0h#h%@AF#" 8"# 2ii@A= 80`X@d9 i@A3 `0@ ,i@A* 0Q i!G"0 @`$"0@[ X$`G? " i%`@A; ?could not pipecould not fork-c-dccould not exec㿐@ jaX@Ð @ϻG`"",jah@ @L0@H@@0" @> @; j ax@6 @3 ja@m@k@ ja@ ?#p@x@ \H#Ȫ`D Tc`  N ` @  E@  @@[,  x %z@ (c@,Ð #c@1 @,G c@- c2@ @B c`(Ւc @ܐ *@+Cannot chdir to %sCan't fchdir to starting directory?#p@@ H#Ȫ`D c`  @9  D`@6~ @Z f/@1;  x @#` ?#耢`8?#@ 0` c耢 8 #@ ( xq@c耢  ? `@(  `` `8 V`@+ c@,א c @4 x E@cĀ  #Ȁ`B?#@ 9cĀ #Ȁ`8 +֐@ ( %֐x@cĀ  ? `@( `8  ֐`@`x @ @B0  H#@ H#@Ր "c  "  "@  jx kH@?   6 4? @@А x @ @ @xB` @4 n#`jH#ؖ `?"`@* "@@&v Y$#@ c x @ @ @KB@3ې0F? < @ `#`H#ؖ `?"`@* "@@&? $#`2 ?# x @ @B     @`< j"xk`@?  @ c@* c`( @& t@8@*=Unable to open %s to read㿈H#Ȕ?`'@2 @  #`, #D` 0@4 @Y  /5@$@2ϐ       @Y  'j"xl @>(0@+U @ɒ@3` #` @  ֐@@3 0֢  H#@ː H#@ Ր "c`ŀ" @|` ` #`H#ؖ `?"`@* "@@%V $c@t0H#Ȕ @ @h`  #`H#ؖ `?"`@* "@@%. $c 6耢   @耢 ( x`  ` x @ `@A `@.  ?+'@3T $`#`4@K @ R @6@cCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. H#Ȩ?cp@   #Ȁ mc@=m 0w#`D q#`  k`  @2 b# @49 X`   Hcm0@{3cՐ "c x `  @2ϐ "#@4)  @1 #@.  @;B #`(@2 @#   !# H#n@$ $#;  `@2 @@ H#`D ?#p@ directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %s?b?@?#@֔? ' H @V:,ln ?L+ /?`H&b#@M / /*@-`,"`H@u  j"xn`H@< 0I<  n`Hc0@@0 :@r 5@5  0 D`@2 '@B50'??'@-D  #` 2 #耢`; * :  /`? @UΔncX@<( 0@  !-` c耢  8 @ c耢  @ 8 @@0A ɒ@( Ē?c @* cĀ  #Ȁ`(֐@ǒ 2"#Ā #Ȁ` 8 ֐@ #Ā  @ 8 `   H#@Ր "c $`"@, @G  f#`bH#ؖ `?R"`0U   ? @ @  @02   @R ?b  'j"xl @;(0 @% 6@@00"@@Y@ #`H#ؖ `?"`@* "@@"y $#@  @ @4v@Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐H#`h ? ' 5p-H1p9p "b?  @ `P Ā A @:ʒ! h@䀥 cȠh $€ #c` ``8 % ` Ā  @:"8 `@  Ӑ` "`8@ 0pa+ ?pb@: ?c  "cCannot identify format. Searching...Sorry, unable to determine archive format.㿘H""` H!*` * & 6@ o?@H* @*`@"Ȑ@Yc ch " 9H7q Tq@ N"  ch#Ā K? @: P @ 4H b@ H!Hb#h@*` *  . `@  2 #Ā ? @9P  @Y""@Ơ"ch¤ q`x@9ې ?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘c԰ Ր#h "chH#`&##? qbؔ  !qc   "" qcH  @9~?0`G"s"c̀  #h #h ?#Ԕ  @8"cl##p Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘H#Ւch"#h#Ԁ? r` r` "@9)?0"`   ?c#hՔ֐  ##p:#cl ?hG h"#́"bCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘 (`rb0 Ԁ  #G"Ԫ "bG""  slը #p " b  @ :; F@p!@r  @b :@ D E@d (#h`%#hb@$p@ %#lp̔ -p#l $pph"  : hb $p%#lb$p@ %#l`Ւ@bb  %;`&8  H "c rbh @8V?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘G"`L H#Ā`s`@8+ C? ! 7? ;  #hB@ "#l8"cp(   :!#G  : #h4b    sa(@7 0^ #h ְ?㿘cp" "cp@㿐  p?clժ p" :   2 @#p  #p@fU%#p#̢ :`@p @o@q  :?@ f @ B D (8. #p"@:`   ` @:   2@#p#p  d%#pcl#p 㿘#cpch !#l "@Ӓ #lGb@$cp㿘`$" '#%Glcp"@  @@ @?cp@Ecp&@@$cp` 㿘`$'#lcp"@  @N &@ cp@cp&@$cp 㿘' #lp"  G@eb &!?< 2 @p p@] p@ < f $p `հ Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archive8 H@' #lp"  G@b &G>: 2 @p p @,  p@ :d $p 4`8Հ  jt"x  tc@6i !>@6  jt"x8@6 >?8 tcP@6I > Unable to obtain block size for file %sActual crc does not match expected crc %s( H@  '@ "  ؀ 2   O>j"xu( @6?  >'/0-Ւ :2 @   p#\@ #` :#p   ##p p: $p  @ d l` p"@%@ Ē   H`4   `@ 4 Հ` # ?#`2   @uaP @5  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(HP  * 2`  *` '     "2  @   @# j؀ 2  '"xu( @5p'#'Gch@ #\@ <@ Ech@⸠ 怦!j x u@5C 0 H    @   v` @5 @В   8j xv0@5!   v`H @4   H`4 `@㿘Gb  )  $% # !Gl ֐  :ch" ֐ "`(? ch> B@"#l8"cpUser specified archive volume byte limit reached.㿘#ؘ#ؠ ` 4+  1%###ت  #'% @3'Gvc@4o   G  ֔ =ci"("#h  Ր "cl@=c] && %'G  =c Mh "cl&& h⸢@ `c <`B=c #l@<hh⸐ &"cp$ h "#pch@ <`C &!Ւ=c@$#pHch @$#p@Œ ֐ "`(?Unable to allocate memory for user id cache table㿘!G#  1G# 2?!=@v  $#   #w &#bX@3ѐ ?Unable to allocate memory for group id cache table㿘!G#  1G# 2? @v  $#  # w &# c@3 ?Unable to allocate memory for user name cache table㿘!G#  1G#$ 2?!=@v  $#  #$w &#$c@3} ?Unable to allocate memory for group name cache table㿘!G#  1G#( 2?!=@vi  $#  #(x &#(`P@3R ?%lu㿘G# `Y >1x!=@Ő# * @ "!G`$!G $2 !G`28 `2'1x3 #  @餐 #`$# @~ (@K   & x& $@' `21x!2& $  @L  &㿘G#`+ >1x @m#* @ "!G`$!G $2 !G`28 `2'1x3 #  @ᛐ #`$# @& (@A   & x& $@ϒ `21x!2& $  @L?  &㿘@[ "[?N VGc   &N?@,&!=* @ #G  @UK  #G 7?! $c  @ c`$c  @,!=@ (, "@  @0 ?` &@ @K @$  $` $ $&@ $?㿘@ "[?N VGc   &N?@+Ŕ * @ #G  @T  #G 7?! $c  @ې c`$c  @+ @a (, "@  @- ?` &@ @K @!  $` $ $&@ $?㿘@%TRAILER!!!㿘yb@T   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@% ? %?p#` @ʐ $yb`" 4 ` $b ` H`t`#$$, $ 4 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘lzah@1 ? 2 zL 2zN   za@1 ?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H   @   4!  H H@ z@0ʒbH? H,   @"&,z bp,@ N,  zb@0 ?070707㿘`K zc@U   ?㿘 L h! x   :` @  & `  @  & ` @  6` @  $& ` @  (& `$ @  "6 `* @  ,& `0 @  @&  H 8&  0& `A@E : `;@Ӕ ` &0 < (  @ &,., W z?  W㿘@'File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@'\ ư?``x   :`,& ",    A4  #`H  A @  `{a A @~  !ǒ @u  ~#`   @k  t`   @b  k`    @Y  b`$   @P  Y`(   @G  P`"   $@>  G`,   *@5  >`8   0@,  5 ; @$  -  L  `  ``{a     2 ,, 6 `{a@/6  ? {b@/.  070701㿘`m |a@Tu   ?070702㿘`m |a@Te   ?㿘Ր @#,"c㿘#` n ђ n #`x  :` @ k `& ` @ e ` 6` @ _ `$& ` @ Y `(& `. @ S `@& `8& `0& `6 @  `H:`& @ B `"6 `> @ < `F @ 7 !?# @ `*  * `& `N @ ' `V @ "  @ `*  , `,& `f @  `&`^ @   ??&j 8 n ` "  .< (  @   @  b  `:&,., |   @  b v ` ?  |㿘Ր @%("cFile is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@%q? #?` ``,&#`!’ @   `   ! @     @   ` "(`x  (x% #x#`H   `  b `x ;@ 6 @   `}ÒaH,   ;x   ;@ 6 @ `  %   @ V      @ M  $   @ D  (   @ ;  8   .@ 2  "   &@ )  v `  >@   l'? @ `2 @ F @   _, `  N@   U V  2  @   I ^ @   Aݒ n  ؒ   n  $   }"ap    # 2! ,, & , $   6 }a@,  ? }a@,  ` (:`((!Dž0: 2`(0 ?x   x?㿘ڒ  #x! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``*#`8`@`0& `B&& :` ! 3` < @ (@ `H   &,.,   `  b`x ;   @  b  ` ?   &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@" !D?  ?  ,& ؀ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) cH, x; ;  , ; *  ` **   : .`.`.`.` )x   :(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8: ::*` @ `*  * (`(`(`J(`<  *` @ (` ?(`9  3    |   "cp    $ 2" ,,   , "  Z 6  c@*P  ? c@*G  Unable to create %s㿘%   c*`.@x4` 6*@ސ !? ,j bx ( $ @  (@*A  ?&@w4 &ְUnable to close file descriptor on %s㿘`@ @r  j"x  @*  @`  ( $ @Z `  ``  36   @ H#̀`H#Ѐ` 08  @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @w  j"x X@) ?<   @g cx@) ?㿘`    @P  Unable to copy %s, file would overwrite itself8 @wA  L`  2    `@)?   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@w >%j L`2Q @@`@ aP@) @?<   @ %j j@ %j+ j"xx@) "?@) ?#ր  x` @`   @ċ `, tarcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8  c   ` Z *` €"x0 @( +? 0@K@#( ,#Ѐ`, @ #?"j,@v? < ( ,2`@v: 2' &,*  2`@F,2`@u c`, @ c@(# ?$j!"x  @ɐ `` ,`  $ ( @ @(, ? @`` $( @ ( @_ `t`     36    @%`J)H 0@J#؀ B@-  * @u j"x @'ؖ *`2`@u0  c@pa   6@[ @  )H  #̀ H#Ѐ` #@F @  #̀ 2H#Ѐ`"  08 @   p ( 0   x `   Unable to remove directory %sCould not unlink %s8@u5 ! L`2&?<  @_ 6 `j "x @8 j  "x@'Q ?8L /? " / @` @@,  6,@t 2 , c@Βa$@ , @> / ,@tՒ @tؒ! ,?Unable to obtain file stats %sAccess/modification time set failed on: %s8G#"#%$ 3Hc̀ H#Ѐ`c@t jc̀ H$cH#Ѐ` c $ "x @&Жc@Ӑ j"xؖ@&Đ paxUnable to set file uid/gid of %s㿘@А 6  03j@IN#耢 bx   ` bx@ 2 ?bx@& ?㿘@̹ 6  03j@I'#耢 bx   ` bx@m 2 ?bx@&l ?Could not set permissions on %s㿘o@ j"xP@&S File seek on %sFailed write to file %s㿘\H%j-+ 2 '&"&`"& N  @ `@ L@ "`@ 2'<   @g  x @xa@& ?2&Failed seek on file %s㿘??@>   Gj"x@%ސ 0c@S  j"x@%А 㿘@ @?&@ `  0   8  File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8  `  &a  X @8 :D  ? @  @?@  #`H `   ``?#@  `8`j"x0  ``H@% ?  @  `j"xp@%2 ? & Unable to allocate memory for file name buffer㿘#Ր  "c  "#`【 "#`【 @"H `@5,Հ "cbH@$ǐ ?@  ? ` @? 6 Invalid file name argumentUnable to allocate memory for filename㿘 N cp@  c@$ ?@M?`$HN /". H`$$  $ $ H`  " "` H" "` 㿘H ` "` 4`Ր "c P` ` H H` @" WARNING! These file names were not selected:%s 㿘 ` @FH  )'z%  4   2 `2 @$"! @b8 2 Can't fchdir to starting directoryCan't chdir to %s㿘H  -H@S$`1j+%z)'`H!#,@` ##@: 2/*.ՠ  "$  $ +? ` "@@`<  "x!@# ?@O@  "x @#?0 !%c# @T# $` File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐c %H|"c  %H#H@  $`q а? 8?` 5#*` € `` @ @ ` `0` c@#M 0`  ` @#n 0`  ., `x   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X ;`X< "9("140NO``K -0 H?`7:`  2&  8 0@ (`$ " @ & : & , @m, 6 ,`jx @" 09&,  & ` @ 0 ` @ג?`& * & @ @0 `@oy  82  ` ;!@@##@$O` @ђ @ /`  `H `  #h #`#d`#\ @` ` ? ?` 2   `` @` `0`0@`@ А`&@  * &@ ? @` ?` @  8, @S  2 @  @, @G?`& * & @ @%s%s %s @ 8  8;a @<1 4##%8@#@; @ "/  @nÒ"@!r 㿐@uV` N N N @d5@ L N 2N0@ D   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0*2   0*2    0* :* ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? %s: unknown option %c %s: %c argument missing 㿘#j "b`4`I?"J@ -i c *c "aHJ#`@al3 . :  "㐐"'?@7I  :2J @z!`P :2. iH z@!`h@^  ?*@$"H. > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@P /֠`" 0`@$ 0 0@BȐ! @0 0@B" @0"$ 0@Wab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  5O-H`8J#ܓ*` €E#jb@!$#Ԁ`=bb@m @5Ր "c/֐ "`P*j""`$֐ "`D ֐ "`L@֐ "`$֐ "`4jb@  0j"-* : `#*` €H"#̒ HH"#"@"##H"#֐  "`@֐  "`Lc@ @l L  ӤѤj@ b ɤ֒ " ä ֒ "  ֒  "  @!j"H!'  @b HH "c"c(@ѐ z #@@a '+@!@\`  `H!@}ch0P#p"c!j@":آ "  ccx@ @cؐ a c @"@]Ւ "#W !j" @AX# G?J"b@ "G D"bc@u 0j@Db 7Ւ "#1 Ւ  "#+ @"#& j@b j@b Ւ "# Ւ "#  Ւ "# @@_UȀ??B  zsې H"cخ !%qȐ   @@  !  @  ! " % @a@S@Z Ā `H"hH"cĀ`A#*` €!i!i!H7!H *@ @ !H@6!H $!H0&i!H@c@ʐ @%?. @"`H!HG!H *@ !H@!H $!HG""667,7,611111111111111113\5T345T4h45T5T5T45T5T5T45T5T5T445T5T5 5$5<5T5T5T5T5T5T0H0P005T05T5T05T005T11$1D5T22 2@2X2p225T3Hb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578write_opt=nodirUnable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-I-rUnable to open file '%s' for readProblem with file '%s'-CTAPE㿐H "#'    )H7;H`J"*` €#jb@!Հ` $#bb@ܐ @#ԑ* $#Ԑ %#G""j bJ@ -2 J` "  '" 'H}"#@t 耢 w @s  "`@m"֐ i"`4 f%#j@+b a@w]Z%#`  U"` ֐ Q"`D H"#L%#0#pj"D"` Ր @"c@-`  j @n`@U jb ,"?'"?Ր #"c!'#Ր "c!("c!8 !H !X!h!x!"`@ϔ?I?iH *`@ & #Ā 2zz!z 'c#Đ?  #Ā?@ #Đ?  HH"  "cH"h "ca@ @#Ā   y֪ -;97T5` 7@> )z `@]a袒 !Ր !@ܔ@ !@  @@M !@> #@QI# ! @@@@>0 2 @`@ )`%  ` @` 6 @@ @@>d؀  `@ 2 `"  p+G  k+G@Vh` D В  !@F!@>8! z `a@ Ր !a @S@. ! @%@Đ !@> #@P# (b@4 @!@@=b0 2@`@ ".%b`  @  y` @@ @@=Ԓa؀  `@ %b !  "J @Ր"8 $ J !8$ <<=8=8== =8==$=8=8=8=8=8=8=8=8=8=@<$=8=8=8=8<8 archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘!z!@}!@y" @u"X@q""@m@ Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘 N c `L@` `\*`: @2``gc@  c@L t?,@@ @rk$`@8 @Ð^?`,@ J \2N22 *@Ȑ @*c$ $J + !*:  P" g G" 0  p"0 $ $@ @,@ 8@ ?J  Hc $Hc " "cH"#"c Empty pattern stringUnable to allocate memory for pattern string㿘 N  b@  b@ ?$@o$ H$ $ `$ $ Hc " "cH"#" WARNING! These patterns were not matched:%s 㿘H#  )'z%  2 `2 @x#آ @Re  2 Pattern select out of memoryPattern list inconsistant㿘H#`   4`   \$  W  P`22# 2 *`2)#2*@.   $`@+  ` /*@6$  ` /*@$ @?$ J / * $ $ & #       2    @" &`@ ?㿘Hc  & 4`/#`4?2   #@.         J@ /2 @9 2  cc`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@  P`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  Removing leading / from absolute path names in the archive㿘H#Ԧ`! N  /N    . .  @ǐ@}r&Ԁ   $Ԓa@ Ԁ )HN, /%H `HN, 2,  . ., , @@}H,&,Ԁ 4 H $Ԓa@ɐ H#` @B  )     ֐, ,@2  D`@j     ,, @ T, ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐 0@ #-+)'#!e@ @`P@ x@ , %@4 @`0@ݐ,O@ 0〢  .@ !  O  @Ր  ?!@Β @_@+,&`? 㿘 @ ? ` ,, @ ? File name %s/%s, too long㿘N@`/ "@l$&@b@ ?  ?*@  * . ?*@ .  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s H?#Pc@ڒPPB X/ @~ۘ /\  ,@` @* @!@d 6 @ UȔ@F W d@\"  L  ͐2Ũ>@0,@` @@L  @,@L  $c@ $ OP OP  z!`@N OP!`(@NOP  @*,& 㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @:&* &.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appending㿘@G @^W#ր  "`<j"x @e (@R#࢒ L@ #@  ' %J?`/"?@  $c@H A( @PՐ" /* "0@w &+(@ %H#Ā`"$*` €ϵ(*(#`` @˶ Ҏ (_(((nmmmnCpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 "` "b8@ 0b`@ސ dž@ $ `@@ LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @y   ?@kŒ @y~   ?@k @ys   ?@k @yh 2?@k @x"   "8@   ?؄|ؔ"#  '''@   Ȁ    @ Zj @  Ȁ    @ Hj @  Ȁ    @ 6j @~  Ȁ    @s $j @l  Ȁ    @a j 'ؐ @X @R    j"x @5 ?㿘I (`I@ 2 I ,`I@ 2  I `" @B   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "S?N #I`(   !=@Q  $`(8bN # \N  #" @~ 2 b@ ,?  @ @-!=@`(, @ " 2@}  `(c@v ?, "  "" 㿘 $!=@I`(* `"  @ 2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "S?N #I`,   !=@Q+  $`,8`N # \N  #" @H 2 a0@ ,?  @o @!=@`,, @ " 2@}O  `,aX@  ?, "  "" 㿘 (!=@ZI`,* `"  @ 2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N cH@ / "N,@`N & ?А , *: * :  .2c` 2c` @ : J 2 @|  `c L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ c@  S`L@  @@'j N$`$ @ 6  c $ (IL $@~  6   `@ @|_$  $  @ ` @  @|M?I` $ I" $"`   I`$ " "`$`H@  ?I `A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@d@#j . "$@, @ 2a?L?Г* @L *`В@ `=$@T?@?`8N?"|*` €N?Г* @N *`А@ D$` d$` N?Г* @N *`А@ $`?$` N?Г* @N *`В@`$`  N?Г* @N *`В@`$` N?Г* @N *`В@ `;$`@j&@?? ~,}$}}$}}$}}$}\Cannot allocate memory for hard link table㿘1I l 2 )@Nݒ  & l b@ ɐ ?Hard link table out of memory㿘I l`m%`"`b )@1`l-  5      @ 2  @ 2  ,@%#, ` &,  &  ? $  $@z@z$ @zҐ  @%Ȑ  $``$  `"$  - `l $ @ $  "@ @zސc @ M ?㿘!I l 8#`"`3` / - +`@) l*  "  2  `   @ 2  @ 2   #@z@z㿘I`l   l*@  "@`@z@z`2lCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %s㿘1I p 1A !G@MՒ  & pb@ Ð 5?#" "1* * * * * * * * * * * * * * @V#I "`#@ 0 j"x#@  ?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐I p`  1@Gp- @`;+j-@2&``!I   @rɒ ` `  bx@ f [?@rҒE@/ ```2@`  8`  ?$`= @y|  .!I   @r  <` @rj 8- p $`$@ $`" "x8j"xX@   `j"x `x@  `?@yk?Cannot allocate memory for interactive rename table㿘1I t 2 "@Lϒ  & t b@  ?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘I t`cX@  I @,"`t, @`0` `@@,O 2```@,F + @x`@#͐ &`c@xʐ @# &@@#  &``t,   &` " @x@@xِc@ H ?㿘!I t @@ޔ" t* @ @, 2  @"˔&@ 2Cannot allocate memory for device mapping table㿘1I x 2 !=@L  & x a@  ?㿘` @  ? Device map table out of memory㿘I x`-!=@~n`x, @` `2` " @x2  `x, ""  "" b`@  Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘I x ` }  @ 2  " *     +2$`& `W& `R y  B`25I"5I@w 9"" "$ 5I  &\   @!S  cP  &` @w  `"" "$  &   &cP @ c@  Cannot allocate space for directory access time table㿘1I | 2 !=@K   & | a@ ?㿘I`|   |*@       2<|Directory access time reset table ran out of memory㿘I |`6!=@}I|,`@     2  2  @w   @"  $|,`$ $ $ $  $ " @w b@ 㿘!I | &!=@} |*      "  2  2     "@ & &@v@v0?Unable to create temporary file for directory times: %s㿘!I ?2 #" "1* * * * * * * * * * * * * * @SC#䀢  $ #`@! ?#@~& Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sxI /  @ow  ?aД@ 0"`'  7'' @o'؀  @o} c "cb@ɐ Unable to set mode and times for created directoriespI` R  9'Ւ@oL >ؖ   @o( 6  @o=Ѐ .ؖ   @o & `쀢 HWH#̀`H#Ѐ`߮ 㠀  ??@n   @n 㠐? $ c @b 㿐`@  @6` `   *  `'  * @{㿘 -$ $  J" ?`   " @ 2(* * * *( ( 0(2    0( :( ?   @  2*( ( ( (* * + 3` ` 03 *   0*:* ?  !    ustar㿘a$?N `(!@*˔     Ғ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘-)'+/$%@( ! @'฀  H `@#   cĐ?   @  ? % ۢ  㿘" !?  &   "6 & @,&`d q  / 6`l j  $& `t d  (&  `|ʒ  H :  W` @&     ; 8& 0&  x:N` `1`2,``5"'.,   & `,@Q,  (  &  6`,@E,  @ 69&,@  & 6 6., .&,., &,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ` -!8*` €#`$%°  ` ` a a8, d, aX%   c ax !@vL  d@l x :?, /,  2  1,, @Q d l   c!H ,lʘ  Va" @  b a@ . .. catchmod0chgrp0 cp dd df edexpr0hostname0B ln lsmkdir0 mt mv pax tarcpio0 rm ksh shstty0sleep0sync0# $OpenBSD: dot.profile,v 1.14 2002/04/01 01:31:39 deraadt Exp $ # $NetBSD: dot.profile,v 1.1 1995/12/18 22:54:43 pk Exp $ # # Copyright (c) 1995 Jason R. Thorpe # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Christopher G. Demetriou. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing # XXX # the TERM/EDITOR stuff is really well enough parameterized to be moved # into install.sub where it could use the routines there and be invoked # from the various (semi) MI install and upgrade scripts # terminals believed to be in termcap, default TERM TERMS="sun vt* pcvt* dumb" TERM=sun if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/rd0a / # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T 9600 # get the terminal type _forceloop="" while [ "X$_forceloop" = X"" ]; do echo "Supported terminals are: $TERMS" eval `tset -s -m ":?$TERM"` if [ "X$TERM" != X"unknown" ]; then _forceloop="done" fi done export TERM # Installing or upgrading? _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall, (U)pgrade, or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi # # # # # # # # MDSETS=kernel ARCH=sparc md_set_term() { test -n "$TERM" && return echo -n "Specify terminal type [sun]: " getresp sun TERM=$resp export TERM } md_get_msgbuf() { # Only want to see one boot's worth of info dmesg > /tmp/msgbuf sed -n -f /dev/stdin /tmp/msgbuf <<- OOF /^OpenBSD /h /^OpenBSD /!H \${ g p } OOF } md_get_diskdevs() { # return available disk devices md_get_msgbuf | sed -n -e '/^sd[0-9] /{s/ .*//;p;}' \ -e '/^x[dy][0-9] /{s/ .*//;p;}' } md_get_cddevs() { # return available CDROM devices md_get_msgbuf | sed -n -e '/^cd[0-9] /{s/ .*//;p;}' } md_get_partition_range() { # return range of valid partition letters echo [a-p] } md_questions() { : } md_installboot() { local _rawdev _prefix if [ -z "$1" ]; then echo No disk device specified, you must run installboot manually. return fi _rawdev=/dev/r${1}c # use extracted mdec if it exists (may be newer) if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_native_fstype() { : } md_native_fsopts() { : } md_checkfordisklabel() { # $1 is the disk to check local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Label on disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac # display example cat << __EOT If you are unsure of how to use multiple partitions properly (ie. separating /, /usr, /tmp, /var, /usr/local, and other things) just split the space into a root and swap partition for now. __EOT disklabel -W ${_disk} disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_welcome_banner() { { if [ "$MODE" = install ]; then cat << __EOT Welcome to the OpenBSD/sparc ${VERSION_MAJOR}.${VERSION_MINOR} installation program. This program is designed to help you put OpenBSD on your disk in a simple and rational way. __EOT else cat << __EOT Welcome to the OpenBSD/sparc ${VERSION_MAJOR}.${VERSION_MINOR} upgrade program. This program is designed to help you upgrade your OpenBSD system in a simple and rational way. As a reminder, installing the 'etc' binary set is NOT recommended. Once the rest of your system has been upgraded, you should manually merge any changes to files in the 'etc' set into those files which already exist on your system. __EOT fi cat << __EOT As with anything which modifies your disk's contents, this program can cause SIGNIFICANT data loss, and you are advised to make sure your data is backed up before beginning the installation process. Default answers are displayed in brackets after the questions. You can hit Control-C at any time to quit, but if you do so at a prompt, you may have to hit return. Also, quitting in the middle of installation may leave your system in an inconsistent state. __EOT } | more } md_not_going_to_install() { cat << __EOT OK, then. Enter 'halt' at the prompt to halt the machine. Once the machine has halted, power-cycle the system to load new boot code. __EOT } md_congrats() { local what; if [ "$MODE" = install ]; then what=installed else what=upgraded fi cat << __EOT CONGRATULATIONS! You have successfully $what OpenBSD! To boot the installed system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT }  (L׸M>$4sa:!   `d} < $  `lt 3 (  `tk * 8  `b  !!ː` X   !  W  ?       a@C  0H`x㿘Ϟ ?  ?㿘< ?a  ?㿘a$?N `(!@(c  2?  ᇔ i"? ?㿘ߒ"  ?# `"6  `& `& &NaY   aY@, /,  , @t"&`d O  /` 6 `| ᴒ `H :  A``@& `8& `0& `(.aHa)~ 6`$`t / &`$.a(a  ``l " &``x  ;@ :`,& ., &,N``7m"*` €  @ 6 x&     "  &6  6 L /2g &c,N` 4 `  ` `  ` & 6 aI ֔  aQє ?c , *`  ,:&N` 2 `  (` &  6 `   `"` &  6 6 `, @ǔ,&,`H@`  a"@   b  6` `x& ` a: : ((0Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠`  `b    , c, c  @ c@ !@s'x    :,Y@   /, @ d ?` E*`# € 53,` ` 4 3,` , ` aI>  ? @ `2 @aQ 1    6,` ` 1 2,`,  d@Ő` `|   % `  0 7,`! H @" a  b  x ;@`| +   bc``( @ac @a!   `d  J $`l ז  A (`t Ζ  8 8  `Ŗ  2/  @Őa В  @a)! `   a!  ɬ  ?       c@  pdppȀ`c`  H /" J J/2 J" `4 ` /dev/ttywrFatal error, cannot open %s㿘 @N3  @>T`!I  $!`@>LI  "a@5!@h D` ``@3 ?㿘!I!'H'L'P'T'X H@N@h!㿘` I!@ϒ 2. ?@ 2* %s: 㿘'L'P'T'X L֐ "`( ` !z1# H@hcؒ!@s` &# 0!b(@=Ґ@N@sQ  <%s>㿘'P'T'X P֐ "`( ` 1z!# H@hncؒ!@s3 $# 0!b(@=@NV` !"@ @=@s 㿘@icmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom@5  //#@A'''/ 'c@r@   @m ֬ "ac@2 @ @:#j@%@>+IIaĦ Ȕ'T'`'d'h'l'p'X/9I'P'\'t'x'| 3* @€b @ ր #ab` @q  $/$ @$@r  ! H@  @qݐ z`$@υ b@쮒 @b 2 b`P@qŐ  / -  -  - "$b@Z I =aIb Ib`p@q " a@'  a! @ ̐ @q Ib )=a $/ {%@  " b! H@  @qv  @  ib`@qk  _$b@ \$X S$ O$ K$b @ I`"b`@qE ?#@9b`@q;  $b@ )'ba@q,  $b@ /ba@q !$b @ I  "baH@q  @ @>`??iaH* & @ @ aID(#bpbp""֪!’    H`D" @o@֒ *-`@뷒 "@ 2 a`@p̐ -` @o2 @!#a  Iax@p !` "` @lo' a@  I @ ,`@@m?c ##b`< 8  %!"! +aЖ *" "" @  a@l  @?c @  ?c @  <` 8  %$ d $ da@p@ %  @ɘ !<* @ *@@ "aa, `4 4 4 , ` $ , $  <` 8  a@p    '/// T @ ( 6@u"0@m? 耊  ` @  bH@ 耊  d @q  bh@ڐ 耊   @a   b@ʐ  '!?#h#l@H` b@ @1?#p`@?  1?b@ ! #"< '"b@ # "@'  "?@4 `b@ ` `'@X0Ia@ !PI@cL@l !@l |@lސ @2 2@ 2 * @k  a@L |#'  @ ''@n 2 * +  & P  @X  ' \@t  xjx @ch'@lǐ \@Z @l !Ā` @j@@l> t\t ,Ll|Td㿘j"x@Ea@l4 aĀ!@  bp @n $x!` I @2k `" I!cL@l @D$x㿘!j"x@N $"xping: sendtoping: wrote %s %d chars, ret=%d 㿈+IaĐ -- I! 5 `5 "ᠡ, 4 5 #a@S: @S}   @*@* ,@ @H''a** * * * * **I!`@a  5 ֨!`5 @5 a֒! @W  @`6@"!"@  Iaɐ @c  packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xx @G `*`@ !a !' @ߐ@0&@ "@ a   V"  / / / / / / //?" "@ ''Вb@ ??I*`" * "* * :@B:@3IIa ! !B;aI(I8I! !1I @!:1I!!@RF: L@RA <  ̢ !`?"'!@R1: !@R-   *@ , !`j`IaȐ @b y!'@6 @b@^!a`!! #@0  @28# @I `@D! I!I  `E @ a@0!(a  7)#  2 @#!` @ aha  &  ޒ`!a  *  @&@ !@!p@@s!+)  "    `E " @ِ!   ` '#'z` ?"`* "@     *   @ *   *  @@@a`Ӥz    n`X '``@DX '!  '@}! S%'``$`X@jk$`X@k!в '#`'3z` ?"`* "@߀     *   @ *   *  @C@?@<aԲ`@5!@1!  `@,! "  5 ! z ``?"`  * $ @: @` `  ` `? (?888* 2 --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms 㿀z `"@  * $@ɐ @`7 !!@"!!@" @#֬ à`@# !! "@x#8*` *  !#` @\2* @j`?"` * $@ކ !_!`[̐: I@. I@. @1,@ @DdI )#x #@.? @0#  #@.z  #@0I  #@.l  #@/#\ #@.`#` #@/#d @㿘     (   @.@@B: 2   B* 2`@ : b`D 8 怢`  㿘 @gӐ  ! @g`?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d 㿐`ޓ*` T €@y#x0 `O *` €@k#0@g#0@c#0@_#0 `@X 0@T 80@P P0@L h0@H 0@D 0@@ 0@< 0{@8 0w@4! 0s@0!H0o@,!p0k@(!0gd!@"!0a  " "@ ! @! @"  @"0 @"X !'"x@Đ@01@"0M@" "@ 0D@"0@  #8@Ӑ#0@ϐ#0   @Ɛ#`0 #@@ 0@#0@#0@#0@ 0@ 0  @ 80@ `DTdtلٔ٤ٴؠذ Xۘۨ۸Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐 ` *`@L  2` 2`  @B  8 ?* 2` @9!  ! @2)z !'!0@@( @'@!` ! @!8` `?"`  * % @0 %s (%s)㿐!` ' @  2!' H@ܾ#֖`@A!`!"'@ܰ#֘`@A!`TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘j * `  * *`@ @#80`   * *`@ @#hpatterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ ĠȢ̂ЈԖؘܚyⴐ  `D`0@f H 2#l;p#\#`#d#h;x;#``@{ؔ ?#" 8ք @ @ `. @ ( !`@   @ #@a8`@&@ < @2 2 2`((  ``? usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘zb@0!@c 㿘@benstuvusage: %s [-benstuv] [-] [file ...] stdout㿘@)c@ /%#)!+-1z'5i-9 8"0* @€ $!$b %"$" $b %b %$" @ú   $"0 <z!@0Nc@cC @3x㠀?А?H* `@" b  b  " @,0@~@' c@Ԑ @c"DTdp|stdin-r%s㿘zaؠ ` "+)'% a @Π``  !@p @$   %@@'h 2%6d 㿘   %z$` "`` 2  "`"`` b@/ `@2 ` ` "`` $?"`` $* $@ِ $Ò`+"`` ^?"`` ^* $@غ ^` I?"`` I I{*"`f`/` M?"`` M* $@ؐ Mz` -?"`` -* $@z -"e `yb ` ` /` ^?"`` ^* $@[ ^E` ?`@`? "`` *:    * `? "`` ,`:    `* $@)"  ? & @*  &  @ "@!  " 6  `@c@b 㿘z `R aآ "+)' a @z   @> !@n$ T` %@T` @Y  2buffer8zR`"`)+@cJ "a@ d*$ @_%b %"` @ %"@@Y 6@ @"@Xb 4  "@! "b㿘@0x(xxxxx\\\D X 8 8 ` `p `X$H.@L0L LLIpJMM::::7:QRpS0xp`XxPxH x@x8@x0x(\$0instinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0deletetunneltunnelgiftunnel-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangevltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-nwkeynwkeynwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupX+ABt i@i]\P5|EF ixi^p]XH5H i@i\\@8@K i@i]\8;TLp i@i]\0?<M40iti] ]isoipxnsatalkinet6inet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRH@%   @`@``@? E @@`h  < @@`p @@`x  ,"#@@` @@`  "# @@Ւ` ! ?"c `@@#@ ?@#@ ?` 7I)5Ь;c4"#̠@ " #@@ 2`$$#̰?`#̐# ` * &㌀ $ @] @_@^ Р#@V  X@Q @^ ?"p@"t  @^ Y)5/!P`"@k@ 2  2 c " $   `@a$ 4  +? @ ` @a ?`@` "``@` ?`@ # %#? `@㌀  I `@ W ㌀   >`7 8`@=3 -   @_.  @_*aT    @_  @_aT  @7 "  @ϐ`@#`Ԁ `@ aT`@_` Ijbx 1 I@aI ` @q aT` @_` @a @] 㿘#Ic?!@U9!T @ $!T?$c$csocketSIOCGIFFLAGSSIOCGIFMETRIC㿘Ic!T !0cx@< !@_ 6V @a#!?"`aT!@_ 6 @S#"#"#aT0a~@_u 6 "#"# getifaddrs%s: no such interface 㿐@I   `@ `~ #Ѐ `@  2p@`@ - ` ` # @^!  `"##$ $ $ $ $ $ $ ` @Ȑ`  @^5 @` `  `y &B@@  < " ` `@ 25@` ``#̀`"*@#̀  ` T   @ ` c4 c4` T   2 $ @  $ 2` ` ` " @` @0􀤠 z!`@)@\ 㿘  `I""#" #̒8  2`error in parsing address string: %ssource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRX  ????R ''@; " !@J*#x@_  @-  !@J#x@_  ` ` " c@^ !`!c@^  "@]ŐcД @@]P@]KaT @^3aJ @#@ق@ـSIOCDIFPHYADDR㿘aT aI@^耢 @!㿘#` € 㿘#` € 㿘@  I"""c㿘#`!   `6$ #` ` @\ `$  I" "" ԁNote: trailers are no longer sent, but always received 㿘@ڐ"㿘#̒ c #cSIOCSIFFLAGSx#@`ߔ aT 0a@] c@? cД @5W`" А @@"А  7Ta@] ch@! ` Xd dXd d㿘"@㿘"@invalid %s%s not allowed for the AF㿐@ @ด @`Ȕ@] #R``ؔ@]ِ b@  !X@" p " h@ b !X@" t" lSIOCSIFMETRIC㿘!#cД @@$ aT @]a @Ԑ!ȁSIOCSIFMTU㿘!#cД @@$ aT @\a @"8bad hexadecimal digitshexadecimal digits too longstrings too long㿘N 0  r #*`@ R` x`?`2 )y['r"@ ` D     `D` "@[  `"@"N %"  `y* 㠓*@R`*"  `㠓*@R` +@ N \2 `" N @y 2 ,  N` ``@j ` $ 6&"@[Ȓ &"%.*s"%.*s0x%02x㿘 `  0 r c*  R `xy" `2    J `2 2€ 2€ 2!!@"0@!   #@a( &SIOCS80211NWIDh '̠̐В   !#/ВcД @aT0$ @[ڒa怢 @"Hpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY 'Ԁ''] "@ے 'Ԑ!'Д?"? 6"H "@  yа !'y" ` ( N  :$ *: ?'԰  )¤| ܲ'|# 9|`$$? `` @l#0*'| | !|''آ ` ܑ,`@""@```cД @aT @[Ca耢?@#(SIOCG80211POWERSIOCS80211POWER㿀cД @ΐ#aT0a@['?aT@!@0  'a@[?@!P㿀cД @#aT0a@[?@֐!@0@ 'aT a@Z?@Ȑ!P nwid nwkey *****%d: powersave on (%dms sleep) off#"#$  cД $ $ $ $ $ $ @naT 0a@ZƔ 2 #z`Ò@"h| ?`$ ` * $`@   ???????cД @?!T0a@Z  z Ò`@N"p @  " " `? !T0a@Zy?@C"xl      , `"   yb  `   :"    "@׍   @V" /¢ ` ,?"``* $@i ,@`@ภ  ݢ``?"`ฒ * $@J   ???cД @!T0a@Y z`@ε"`@"0@C5"SGIOCGIFMEDIA%s: no link type?p#`#  ?????cД @kaT0 @YĒa6  j"x`Ēb@^ "## b@ZS SIOCSIFMEDIA㿘#`!P#c`ؐ * !#$ccД @2caT$ 0a5@Y Ēc@) only one `media' command may be issuedmay not issue `media' after `mediaopt' commands㿘#  Œ`0@Z %Œ`X@Y  `4`@,`$only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'㿘W#  Œa@Yϐ Œa0@Yɐ c@ "aPonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'㿘%#  Œa@Y Œa@Y c@^ "`؁only one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s㿘#  Œb@Ye 'Œb@Y_ ?# @ ` `@ӽ`Œb@YN *` $㴁  @@`IEEE802.11FDDItokenTokenRingetherEthernet##x#p#h$`$P$H$@%8%(% %&&''(())**++,x,p,h-X-P-H.8.0/ /0011CCDDEEFFcxcpd`dXepePH@80( DS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect`X H @80(@@@@@@``pibss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexŒ` @2```2@ǐ"pƒ$`"ǔ  @2` 2```2@ǐ"Ёunknown %s media subtype: %s㿘Ɛ $@F? !Ǡ#X@WC strdupunknown %s media option: %s㿘@  ǒc@, #’ @2 ?!Ǡ#@W # @ @ c @R㿘  "?` 2   @ 2   2?%s %s%smedia %smediaopt instance %d㿘`  !Ƞ!D@}Cȶ!! Ƞ!(N@}3Ǡ`  16 %? #-+)`2  @ @ 2 ` 0a8a(@}`#a(@}  @@    26 `@|!H6 physical address inet%s %s --> %s xȠ!(// "@UFcД @eaT0@UaK , @ !#\! @: `Ȩ" @ʐ!#\ @:ܚ Ȑ"@| $$`$$p@$$p$`$no networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d mtu %d%s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: p ɲc@|) ɐ @T#`@|!0#`@|!@z ``?"` * $@. @ c '  ????? @}T#0 a6@Tה  ɐ!H@ђ퀦`@Q1*  Tɒa`@h a6@T' 6ɒah@] @{͐!x } @;`?"`` * $@ݐ `?"`` (* $@ː ( Q `?"`` )* $@ȵ )`?"` * $@ȧ 耊 U-@{v!Ȓ @ 7   'Ȗ )*# @2 @2 aᘘ(  ` ` @{F  *@`2і @{4!`?"` * $@P  )   @  /-+ɠ  2@{ᨦ @{   @{a`@ $ݢ @Pp`#̀  @ 0#4`#4#  ,  € $ 2   inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿀 aT   j"x`+cx@> ##cЮ @/!#( ''''@e'@z @!T0a%@Sr j"x`1@<#8$$ $$c" '`Ѐ . #$cc$ 0!T$ $ a"@SK? 6j"x`12$c$ $ $ @#HcД @ؐ`!ʠ#X'@@zF @zA#`Ѐ`0#$cc$ 0!T$ $ a#@S? 6j"x`1$c$ $ $ @ܐ#pcА@    z'!ʠ#@@zz`?"`ฒ * "@* 㿘#`€ I "c`??` *` "`*`  inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime p aT   j"x`+Icx@    ! #\ ! @7 " !(/˒@ys#`Т؀ H) ! @Qΐ#Д @ 0H a"' ' ' ' $' (T''@R: j"x`1" @#  ?  ?//?'L !#\! @7^ " !(/ː#0@y' ! @Q#Д @ 0H a%' ' ' ' $' (T''@Q  !j"x`1 @#8  #P @4@x ! @QZ#Д @z 0H aI' ' ' ' $' (T''@QƔ  j"x`1#@#` ` @x͐#x耊 @xǐ#耊 @x#耊 @x#耊 @x#`ː#@xI#`b ! @Q #Д @, (0H ' aQ' ' ' ' $T'@Qw' 6 j"x`1"@@@#;ɀ 耢 "4@Ր @xu#`@ @Ő"@̒ @xf@xa @x^ `@ @"@̒ @xO@xJ @xG!ȁ㿘#SIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%d㿈I aT   j"x`+cx@ #"# cД $ $ $ $ $ $ $ @T0a!@P 6#j"x 1 /2 ̀ ] $ " " " @!# @q  ?? ` ` ! @w `Ѐ # T0a"@P 6#j"x`1& $ $ $ @}#H#@E  " !@w `Ѐ  #  !@w z`?"`ฒ * "@Ð  ns %s 㿈 aT   j"x`+cx@ #"# cД $ $ $ $ $ $ $ @T0a!@PV cj"x 1 /2 ̀ c $ " " " @!c #@ސ` 7 !7  87 7 7 @^7@w@`Ѐ .T0a"@P cj"x`12$`& & & @#Hc#Д @  !7 #X7 7 7 7 @]7@wz`?"`ฒ * "@* 㿘I#"# !T` j"x`+cx@y #"# """ """"c@Ȕ  2  ipx %s SNAPframe %s X aT   j"x`+cx@M #"# cД $ $ $ $ $ $ $ @7T0a!@O cj"x 1 /2 ̀  $ " " " @Q!c #@` / !/ #0/ / / / / / / / / @]/@vo`Ѐ :T0a"@ON cj"x`12$`& & & @#Hc#Д @ې  !/ #X/ / / / / / / / / / @]/@v2 'aȐ '' a''̐ ''a !7'ܔ@''''` #z " ``` "`@2```@u#H``?"`` * $`@ SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOh aT   j"x`+cx@S   Ȫ c?????? @?!T0 a!@N j"x 1 /2 π g????@Y" c@"!Ϡ"@'Y@u!T0 a%@Nt 6!j"x`1 ϐ  ??? ?@7# #@';@us Ѐ`"!T0 a"@NR cj"x`12 ϐ  ????@#(cД @ސ!ʠ#X@'@uNz`?"`ฒ * "@i %s: bad value㿐I#.`  `, ,  @ɓ @xϐ @M 0@#   #@ @$$ Вa@N 㿘I#.`  @%   Вa@N `, ,     @ML 0$  * "@  * *%s=%o%s=%x㿘  N  Е.`А#@@t2Е, #H@t2rz ``?"``` <* &`@ΐ * &`@q >%s: %spI#.`  ?ؐ ??? ''`@֖Ԁ  !@8Š!@M ` "`Вa@M  @L ? @?@       $ 4 @@ԁ㿘I#.`  @  Вa@M| `, ,    @LE 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  AppleTalk does not use netmasks%u.%u%s: illegal address㿐  * `,`Ғ`P@M Ғ`p@b ` ?#@  (`Ғ`x@L  4`,`%hu-%hu%s: illegal net range: %u-%u㿐 {77ҒaH@aԖ  @ aP@L #2 2 12%s: illegal phase㿘Ғa@Ր  *cb@ː  *cb@L  atalk %d.%d range %d-%d phase %d AppleTalk address is not in range㿘# c c ,c  2  4 4   "  @r c   8  Ғb@LX c6  6  6 Attempt to set XNS netmask will be ineffectual 㿈I#.`   ,, #@@_ 耦`4 4 4 4 4 4 @r#Attempt to set IPX netmask will be ineffectual 㿈I#̓.`   , ,#@@ I, 逦`, , , , , , , , , , , 4 @rY @㿘I.`# @#Đ @JF `  ,,  , ,㿘@0"bhnegative NSEL length is absurdsetting NSEL length valid only for iso㿘@I "cӒa@K #̀ R  a@K  I* 㿘!I##  usage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ mtu n ] [ nwid netword_id ] [ tunnel srcaddress dstaddress ] [ deletetunnel ] [ vlan n vlandev interface ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] 㿘zӒb@S!@HH  vlan: %d parent interface: %s 㿀 @oaT0a: @JD"?` Ԁ Ԕ @qI SIOCGETVLANSIOCSETVLAN㿀@0,2 II ""@: ##aT0& a:@J?aTԒax@  7a9@J?Ԓa@ must specify both vlan tag and device㿀I#`ԒbH@J @ #%T0a:$`@Iڔ?Ԓax@y  @qIcT7 a9@IȔ?Ԓa@h 㿀@ݒ #%T0a:$`@I? Ԓax@Q @ːT a9@I7?Ԓa@C %dd%dh%dm%ds%lu㿘!"Ԗ@$!㿘@㿘 D@O`D㿘 D@I`D㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ ` 4   ? `  ?㿘`@ @ ` 4?    ` ? 㿘`@ @ (`( 4   ? ,`,  ?|㿘`@ @ (`( 4?    ,`, ? i㿘`@ @00@4 2  @44@( @ `@00@4? 44@?>㿘`@ @00@4?2  @44@( @?`@00@4  44@ COLUMNS1ACFLRSTWacdfgiklmnopqrstux㿀'H@H`  !'@Gk#耢 @ÅJ"`ؒ`h @Hr `J"  " ("9 "`` -@   "`0'#)71/3;+J'~% Gyב* ,@€ ' `% D$` %(% D' `$Hj$` $`&@% D' `$Hb%( % D$H%(\' ` $H% D' `$`U%( &@$`' `O%( & <K%t %tG& < C"`4 ?@  =&`T  8"0 ",3&`T /"`l +"X$ '`d&' ""`h "P " "`L %`ܐ "8  " %`ܐ "`p@H@?~?i!HH*`'H`& `X `8 `4  ``P ``܀ " `  ,  `p4 " `p 2 ` 8 `d@}ƒ`d`d &!: '`d`L $`܀    `>   `: 4P2Tt ,a < &\#̀    `   ` `8t  0 < aՐh$ ` H ` ڐ`" D ݐd"`ې"H@fJ @_ @D`xY0ZZZZZZZZZZZZZZZZZYDZZYZZZZZYZZZZZZZZZZZZZZZZZZZZZZYZ(ZZ<[ZZLZZ\Y`YYZpZZZZZYZZY %s: %s: %s: directory causes a cycle%s: %sfts_read㿘 l` ٔ"@A=   @< @Cu@r  ,`d T` `  @L5j ":  "N`D0B6 "5`0= . !V`6  0`3  `@mx#P  `@mp#X $ @C4@0T  @C 0#`@F`D0 `!@#`D@= "`x@A͐ 2`8x גc@А %u-%lu%qu'H'D`H  X` 'h `  8`H 'hH''' ''|'x't'p  'l8 D@̠Dא@ $ " x 2 LD2( ,`2($ .2 ( 0`2( $  8'h  @`8`< (``<` 8'`  8'`08 `0`4`0 ` v' @`ؘ!`   @ ؘ!` @   ` @ `@@ @EDp4'p@E=t 4't`h  @`DM خ!@E)x@ 4'x    @A    @  @ش$   @خ$ `<  h '|h `  $ @ؘM`-"$@A$l 'l2-8l`L'h'H 0'|#''̢a @ .@Dϐ't x''@ "@DÐ' @ @D'ؒ @ @Dp? @   "`H@Ah㿘`8"2 @ 8`+ `  ` #   ? < R`6  ,`2 `  ?  €㿘@ 㿘  "  @ z` ?"`* "@   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd xR 6`" ` 8` `d!  p@EԐ@kT+ڦ)<7935-/ " X`@ @k;` 8`d ; `8 @ 8@C @k&``@*  ` #\ $ , @k#``h ` @k `  "`2  `? 2 `@j    (`0"@ @j (`@j`0 t`@<`0  <`@5`(0@2` @vD`4   P` `  2`@``(  z@*z` ?"`* "@ې 2h 㿘 X`    8`   4`2 P`JJ ؔ`*  @5K&@@5G֐ 㿐͒ #J a,@! @?*` @" 0| & $a,   .`"@`2 @5@( 2R 6` ` 8` `d! p@D@j, B7)z   z  `?`$``@  * % @7  ,  @ِ ` ?"` * % @ Ĥ㿘 X `@` @iْ 8`d!ښ?`8  ;` ; @@  @i’@]D`4  P` <`  @`㿘'D@ʐD#z`  L?`&  @  `* $` @  $  ` z  L?`&  @  `* $` @  $ U`D;!@鿐 z   L?`&  @  `* $` @t  $ 0```?"``` * $`@\ z   L?`&  @  `* $` @E  $ ``?"``` * $`@/ total %llu 㿐R mR 6` ` 8``d! "@C_  @hܔ  >'z 6􀥀` ? "`* $@   ٬􀥀  z  `?`$``@ * $@͒ 2 `?"`ฒ * $@ 㿘 X`    8`   4`2 `M%z` E >` ,?"``* $@ , `(J`ؐ ` ?"`* $@n  ` ?"``* $@[   H ``2` `?"` * $@C 㿘<(@-z @@ I0L0@-8@8 I0D`?"``M /F /`?"``@ |9 |`?"``3 @, @z`?"``% = =z`?"`` % %z`?"`` *ฒ ** "@  %s%s/%s ls: %s: %s -> 㷘V 6 2  ޖ D@$  ޘ D@$@@#jbx!z#ޠ!@5`@ H0, @gh (@㿘N *%y#J `*`  ?*: z `?"``  * # @f  N  usage: %s [-1ACFLRSTWacdfiklmnopqrstux] [file ...] 㿘0 <za@ !@= 㿘@tsetJy0 J@, @rb  * PJ ( P"J@"2  J` J@ @ b r(P* 8 @b@ *`r㠄P"(8"tset: 㿘!z!ޢH'H'L'P'T'Xc@ @5ސ@ |c@=q 㿘za@B#@ᝐ@=g write to stderr㻘 @U   @5?2ߐ @@5$ Ԑ@4Ԑ㿘z!`? "`` *:  ! * #!@} Terminal type? [%s] Terminal type? 㿘z ` @ސ@ c@=  %z'+)-ހ`aP@ @ !h@4!@Ɣ?P 2 `2@ @< @  2*L `"aP2Kn,Xx `ph%`KX`KX`KXPH@23040011520057600384001920096004800240018001200600300200150134.513411075500unknown baud rate %s㿘N B  ߠ"t` ` 2  `2 ߐ#ڒ malloc><@=!:illegal -m option format: %s㿘@Ɛ@:Ȑ  Ґ ha $"a"!a""a$ `p@\$  $ K$ @2$  @?ߑ* : `"*` € : $  4 $     $ `*:  : " `@ : .@u`$ ` $ , 8 $    "$  xN$ 㿘! G  " @폒 2; `1 L*` €+ gRa @$`?gR! @  gR! @  gR! @    gR! @    `"  2 x TERMunknownTERMCAPTERMCAP=tset: unknown terminal type %s tset: can't initialize terminal type %s (error %d) 㿐 2@<9 h @r  " @۴@p "  pt@"#!aH* ! !  㿘@IJ al$!g! a耢 ߔ@[  ! a쀢 ߔ@Q  ! a `̀ " f  z a`?"``! * $!@ @1t!@֐# 㿘g!`b I ` Ez a`?"``! * $!@ݐ   `@ a  #!@Kc8  @ 쀦 !!`?"``! * $!@  %s %s isset todelete. backspace. control-%c (^%c). %c. 㿘a` @!  @:z  a   @( `g@!`0"!`܀`` @@ `J` `@`0 `@`@ 0`@-q-e^H-i^C-k^U㿘 >'%#!J@ -  J 2J@( -2)   "J`J -2! J` e i k2 J` 2 J i" b  k e  "( @(&  2usage: %s [-IQVrs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘zc@!@@8 jH^ bH?  bHstandard errorreseta:d:e:Ii:k:m:np:qQSrsVarpanetdialupplugboard%s Terminal type is %s. EraseKillInterrupt%s No termcap entry for %s, only terminfo.SHELLcshset noglob histchars=; setenv TERM %s; setenv TERMCAP set noglob histchars=; setenv TERM %s; unset noglob histchars; TERM=%s; TERMCAP=export TERMCAP TERM; TERM=%s; export TERMCAP; '; 㻐!@n @: a a !"! "` "` "`  "` "` "` "` $"`  ("`("`$@g2a@g@@ǒ` J  *al      L!䀢`4G#*` €B j"o 0<j"h 85)* : J-"ap+  * : J$"at* : J"axj"K j"D @      @ @"L@@ ??i!H*`& @ @5@@ &/ <%g1 !R@&!R` $!`h@9m!쀢`! !耢  !쀢   `77`g@9V "`J!a@0 ,  @  @<@  P@`Oz!`X@! p Ք  x Д   ˔ O   @`*@f oA@7 "@8?@В`Ȁ  O  !!0!Pah@_O`!z `?"``  '* $ @ '@%!@ @  $,Hd|()%'&*+#   $ "!$"#%&!     tsr2  u0kbok p r3iv4jzj`% w.-/f l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPcQRU>8Z[\]^_`abcd1vwxPJOIQKRMHdLg*)hstuiN!\~]ye"}qAB&()C*Xe|~+,z{|DEFG@lmnoZ-S[6hg/x.'7y8TUVpWXqY9Yf{}#$:;<=>^?_5 !"#$%&'(a%#&(*  )$ '+!"$ "% !  #&tsr0123b ku  v4jzw56789:;{!"} <#=>$?%&'()@*ABC|~D+EF,G-./f0123+,456789:;<=>?@ABCDEFGH    IJKLMNOPcQRSTUVWXYZ[\]^_`abcdefHIJKLMdgN*)hijkOlmnoPpQqrRstiuvwxyez{|}~Slmnohg/TUx-.VpyWqXYZ[\]^_` !"#$%&'(a() !"#$%    '&*+  $"#%&  !hgn ijk    fl+,copqdpez{|}~mq/.rrytuvwx0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abs&5 k  j%)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}ylmno+#-( !"#$%&'(,$- i㿘     @۞& & @ @& * 㿘``X& 0@1/ג㿘@E @ ",  "R  0! 0R J! `y!HJ! `y #\R J! `z!4*  SVr1SVR1UltrixHPAIXBSD, , :\ :%s: sorting by term structure order %s: sorting by terminfo name order %s: sorting by C variable order %s: sorting by termcap name order %s: width = %d, tversion = %d, outform = %d 㿘K*b" 5" 0ax@ૐ a@ॐ a@  a@  a@   @a  "a "!`I"!"<.` €`0t"D#"8#b< @bDP$"D#"8#b< @!!! "bHyyz!Hc\4!!#b8 < @#D$"H"" 0E- 0@>J!hz!@5a7 J!hz!@*a#` < J!hz!@b #`dJ!hz!@ bH#x`(",#"0#b4  J!hz`0!abp@!̀    0  0LH ? L*` P? ? L*` ? PP(" ` 0A 0>`< : `"` 1 ````(& "瀢`݀ `  J 0  0 J   J  $p㿘!"H""" $"㿘@/'bD@/" "` K 0@ @ !!"אDԐ$%?%pe%? %%%%c without %%?%%; without %%?㿘a(@®    @. 2a0@¢@ N +b  7*`:  e"$  p ;"j  ? % 9 \  9 t   b a    9b a8 *?@7   -  #" a@D ?" H= 9 n  -%`" @- ?" H& " N ?~`P`2NNN@PINA9` b   *? -3" a@ ?" H  0+@!h 9`b -  *?#`" a@ڔ ?" H" Ӕ  9"  ˔ N F@%s@%s#%dim=ei=%s=!!! %s WILL NOT CONVERT !!!..%s=%s=%s=meml=%smemu=%slqkxjmwuvtnbox1=x?#?'Tc*@  "@` ""LbP!" "D  ""? ܶ"P5?#7 + "`",-  +  " " $ * @"8,    ( g #`  L O L T"  @@. @z04X    + " =  V?#+% & "`"0-  &  $  "" $  * @"<,    * g #`  L O L T"  @?,  R@@`0@ 4    &b -@- 2  2  &,`"  Ȁ "  @  2  "  a쀢 "  @f, 2  "!  ?#" ! "`"4-  !  & "" $$@   * "@,   2   g #` L OL T"  )   Ѐ`ᰀ   ,  |@     ਀@    ! ^' @?/  ,    ?  ?c@"@ `@<7   ^"V4 , @'Q ( L /.@'H 0 @$)$@@'= @ "L "@(  !# `HP@ݐ$@`P@֔$*@Δ$$@`O  J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @F! +?'t@Fkt t t@Ό$@]7 : ?L 2,? t ? ?@$c? ?termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐 :@˹'D 'b@pF *@ 'c D)!z- c0@ 2 #(#8@N#(@pȒ 2N `?"``  :*y" @ `   N  `2 oWN倢`E?"*` €@Nc#H@N`#PFN@N[#XAN@NV#`!8!@1p"@03!g.2!+ g( & g# ! g g  g  g g   g   g g 2a!Ԑ ے ~ݐ ?' ! #"",''//bXbX (' ' ' ' ' ' ' ' ' $''`@c ?2$WARNING: terminal cannot %s㿐 "` K `'"@/oLINESliCOLUMNSco㿐K`?  "H@  $  $   @#Ғ`h  !""@""x "@!@~"!"bb܀   "b `h@#  򀢠 ""`@"" "@ @}" "b`b`  P"b`krklkukdkPkNkh@7kDhЮ#'@}  1 @Ԑ@#0  ,@  ,@ @ǒ@##  ,@ #'@}ْ  @@#  ,@  ,@ @@#  ,@  '@} 3 @@"  ,@b@@"  ,   '@}  @y@"Ր  ,@b@@o@"ː` , ` '@}  b@@\@"` ,@` '@}n  b@@J@"` ,@` '@}\   @8@"  ,@  ('@}J   @&@"  ,@  0@}8'̦   //Ҧђ@@"l  ,  , @@"_  ,! c  //ђ/@@"P !c, ,c,   //@@"> , b@@@UTERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐@   @{D 4  /?@| @.B@|  !"b@| !"b@| !"c @{  "b @|  "b<"b<b< !!!   #"\"c#b" "@   "" '@|- В`"! @g*!@|!  "a "a@|  "a "a!"!`#K `2 !@| $! @{$a! a $!a 2 $a@{! "!`J@ 2 V! $!@{ѐ! "`"!Ā J 2 <!( $!@{!@ "!`J@ 2 %!H!X$!@{!` "!`J@    %!"b "b@{!h"!Ȁ`2 $a@{w!p"!̀`2 $!@{g!x"aЀ 2a"a@{Z!"aԀ !"a!@{M"؀ a!" "ܒ@{=! "a "a!@{2" 2a!" "@{"! "a "a@{!"a耢 2 "a@z! !@{! "aJ !"a!@z`! !J@    @y @@  @'@r"a!@zƒ`! !J@ ! " @yk @@ @'@E"a"@z` " @z c c  "!(@"a !J`!"" 㿘!"!@B$""㿘N  N@ 2Nϐ "N@  ݐ6㿘!"`a#!!)"@b@a@bK "`㿘!"`%K a#!!)"@b@a@b$㿘a)@@ 㿘a!)@@㿘a)@@ג 㿘a@x )@@˒ 㿘!"`@@*] 㿘!J`!") @@㿘a!)@@㿘a)@@ 㿘 "`)aĔ@@ 0a@@ 㿘a)@@ 㿘a)@@w 㿘a)@@n 㿘a)@@e 㿘a)@@\ 㿘a)@@S 㿘a)@@J 㿘a)@@A 㿘#!)"@a @7@)Ӑ a@1 㿘a)@@( Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘 ?@*?@  "!#8#P!@v ?#0񀦠@  !#h@) 0"   @A ?@H$?쀢#@)ǒ seek errorread errorWaiting for data㿘" `$  2 `( @+b 2 b   ?bbp    !#( b@ 2$"pb $ & & b  $ *` @ @Ҧ ? 4b2?@(?b`2``K` 2` y ?@[ ? b2 : !@)I g?: K ?   $b # @'   `  ?*#  ?怤  K!(@)% j K   `@D b <  B;  & !"̀` ; 0 !8@)C @  !#`2?bb "` "& &" "b  ( jb  ch_ungetchar overrun㿘? !K ? @(͒ $ Finishing logfile㿘K` $ K #K"`0?`4? "!@( !!@?# @?$$`Warning: log file is incomplete㿘"`cB  gB 3` +    )'Kbb@2 ` !@(q    2@` @`b"  2  2 㿘@ U? 4Y @ 8T  cF "3` + @ 1 @*bÐ %bb`42 `8,  `@?!#`b`2 `@ b  $+   cF + 3` @* @ ( 㿘1"` @` ":0@;? 1!  2 @B?# 㿘 w  "2  b@&  2b "`("`$!̀?0?$(( 8㿘"$@ (  ?" ?`(#4`$ "`("`( "`$㿘"`( ?"`(`$$#?`  " "?# $" (" $"$@ ( @ Cannot allocate %d buffers㿐!#" @6 @I ""cH` & @''" `2  " seek error to 0㿘b  ??#:0  ?"  2" "@` " :0  :"$"(  @ ?#@& 㿘 @k$ "?   " """"@" 㿘"@ " # @""@ "b" 㿘  @ ?  㿘#K@(`|  "b 8@! ?  ??" : " : 0$"" "" " " $" (Ր "` "``|@""` ?""` d㿘"`  b b` 2   2b@W` b?"`  @`bK`|$b@ڒ 8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘N"` : +*:  9   06,  . c0 b cc0     * N?? @% R #%@*,@@%ߒ G ,@? ` N #@,@`@*,@invalid charset name㿘 "  N K  0 `  @ "   2!@%  㿘a@A y"  b  J ` * "* *  *s<%X> J*8J*"KJ kKsd K  uK     K  K   K LESSBINFMTLESSCHARSETLESSCHARDEF㿘@#@#v @#  J@  0    %cESC^%c㿘   !c !c@""K @ܐ  K!c@"" !@"""#("c"㿘@#㿘 c#@J !$J#@#㔒"@$#. N 2 @j@N *: @$<@ N@`@KL@K!(`  㔐#@M#   㿘1#J " f#`@$ &#@ @"㿘# c (#J? # #J? 0 J?   o#J?  㿘cJ  #J@ 0 #J@   㿘%#@!c$cJ@P#"@$#N  c 㿘J#`  c4*K!( `?㿘1#J " #`@#x&#@ @"㿘#@"J!@ #"@$#yN   K (㿘K!(`̰ 08 !( ` @" !( ` !`#"cN %c *cuJ@@Ǡ@$@#c $cN`㔰 *㿘Ka( * @# #a(a(  @ǰ 2a(a(  a($ $`$ `""`a("`㿘K!(K @?`쀢  `@ Đ`"*` €K@" KR" K#"`J``  #,#J@  #J` { #J@  0r cK" 耣  K? # #cJ? #c U J? %  #(K J? E K" @K" J@  #J@  0/K" , K" 'K" "KG" K*" Kl"  "cK"   @ K"  Pd4@x㿘#@ uK!#_@ #`  $#@㐰 "@|$0G@  , ? : * $J?`%?0L@b`@@ @z㐢$@@ 㐀@VG 0@! L 㐀@ Ӣ㐀@ 㿘 *`:   (L   㿘cJ   ! ##J@  #@ #c  J " ##@  N?   ? N? 2?㿘% @$ '`"#@ !# " #"@'$# @@ *@#$*@?㿘   1 !@#@#㿘K 耢` !#`2  "##@N$` Ґ"c #ː$#%㔠 c  ##@ c$`9 $`d 㿘c "c@<      㿘@#㿘@ @[@"#㿘@ u㿘O" G @ @*!/?㿘`    ("` !  p   x @      K K`!done|done㿘``*e #(*` € $@:0YL@!KL@ +"` "` x "L@@L@ D$ x@$ x ,!L (@q8, ( $ L`WL@00 $ L@PL`0)@0&L@ ! !K!4 @n@ =$!4!4  @t!P @p !X@ K 0 J`0@ݒ !`@ B %' ' ' &%' ' ' ' %' ' ' ' ' ' ' ' ' ' ' &' ' ' ' ' ' ' &H&d'' ' ' ' ' ' ' ' ' &(㿐 `/ "H*` €?Ѐ v@  dr "`$$ !# d " `J (  + -X + -!  , "`, "`, ,`(@  L`( , @aPP L`( + -1,`(@  -/// / 8   *  @ !0 0 @! `   "` 0  M   ?݀    ̰ (@)))))h()))))))))h))))))(@))))))))))))))))))))))))(H[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘K!0`#@Z@ _  "( "(? "(  @ !"("(@ ! " `!!"Đ @/$"$"!"Ѐ`  "T` K@ )`| a E! "P  T @#X$"P@#' @i :0C@{ "H` @t#(Aless version %s㿐Ma ' @Ò㿘K0`#@"0J"0 @     g   0 @(ungetcc overflow㿘!K!0 !0#$!0!0 @  !@  !0* $!0㿘@? Lݠ?:LPattern not found㿘 ` K |a `@ @ 0`   >$` %@Ɛ  @ؐ  `  @%   ` 逊 ` "@*  @ 튐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈!b 2   :    " "+%3)!1 Z%`#$$  .`(@&!"؀`#?# # ` "/  ` "/[  '/'@D쀢 ` ``c/#*` € c l #$` ""$ @Q$$U$ @ ] 0$` ""$ @>$$B$ @  0}$  $$6=$$  $$-?$$  $$$$+ $  $$$, @ #!   "̀ "bT  @  #  A$"$ 4% @  05$ 4% @ K 0* @@ p$  $$$@ ՞H$ &$$$ d d$$@ $0$ @ $ &$$$  :@ 10@ ' Ő# $  $ $$$ `$  $$$  $ $ ` $$$& 0  ?  ? $"   ?  ? "@ $ $ ` $$[$ $ @!:L!"`x0 @#F@  0K! cD 0!K@  | @c؀ 2K [#"܀` T ' bt@  @J@ | ]댐 0Y$  $$@$ P!"Ѐ` "T`$w $ $   0!P ' 8$  $$@$ 0$   0 !P ' H@0"$  $$@$   `@ݒ 0 cؐ /֔  $"`, `p ͐  !c  "  aP@ 0 `x  0K!$ ` 0 `  !c  " ؀ ր @0 `  !c  "   @0 ` z %!c  "    .@m K!$ *0`] %0 `W 0`   `N m0"H   |"bP3824452`8;6944`3245449674:8$5x49h9L5H3\35h72|2:::(86;;;5566D8;;35;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;1㿘K!8@)!LK"@= C@O㿘  @V  @&""" ?Warning: some commands disabled㿘K"̒ߔ !@@ Warning: some edit commands disabled㿘K"Вǔ !@ @ 4J@K)`J@ g`"#!" ?J`g2J@ fJ@`J@`J@2``@ И  d㿘 d     d"㿘Kb̔㿘KbДH"H("@㿘@J J ?l 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0ĐC S'@ ?  㿘@= H @~  @Y    @˖ ?  @ ̐@)?@ؐ@< "N@ ? N  M N  +N  Glz .lessCannot use lesskey file "%s"㿐@:!   !'@t@ x!#  I " C `` ܲ` `$--,   ` 6 d` "  d   d  d ܀  M`0 㿘z@ _&@@  & N@ ".@ `@*N@㿘`@ G@ @   N@ "`@  `2 @ J"?8J?   ?J?8?㿈K`| " @耢?|쀢?|@;@L#Kb܀ " $|@)|`8@@ b$b$|㿘 K |@ 0 @-%s"%s" may be a binary file. See it anyway? 㿈K | `|  " @'@   S a@ K"ب H'@Ӑ '!@U@ d쀤`@@ \@cr @禒  '@'!@8@ G䀤`!"`@ @w !'@w쀢 y Y@Ȁ`K" K"""`8@%`|`| @b(  "xfK `#!bԀ K@ K x !Ky @\`?bԐ `$ @@ @  !"Ȁ`'!@֒ 㿈#K`|  @Ő    @+ | @  | @  |     㿘K" |@  㿘K" |@ 㿘K |`  @? ` 㿘K |`  @?Ґ ` 㿘 @~ "  @Missing filename ("less -\?" for help)㿘K@ b؀ " #@/ 旐 !㿘0@?@Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 H@R @ K ` O#'@5!? 0$* !@€!@VbK"` @0 !K$   @͖ ?  @ ? $ " #@  א? ' 8@LMHMHMMHMHMHMHMHMHMHMHMHMHLMHMHMHMHMHMHMHMHMHMHMHMHMHMHMHMHMHLMHMHMMHMHMHMHMHMHMHMHMHMHLMHM@%s/%s㿘 % L@ !@ @  @   bP@{@庒 @b @MHOME㿘@ #В  LESSHELP/home/dest-sparc/usr/share/misc/more.help㿘@ #8 #H`㿘L@ # @'K%K*`:  # %2 | 0  C4@x`@ F`L@  @ E L@  @1K'K*`:  # %2, |@W`@Ɛ@ " `L@  @,%s*㿘@   @`@@ @ɐ @ƐX !  @ ?2    @ @  u @   㿘  @ ??? 㿘 dŒ  d@ ,,乐@O@u@ , ? $@  $` ݒ$,SHELL%s -c "%s"r㿘@ `@ " @ z  @L@# N c @ e@ b g c@3@ c @.@echo %s㿘  |@.N`@0@LESSOPEN-㿐?@H "  @( ". L |    `T @ߔ  @.I O&&@ 2@.:N@` LESSCLOSE㿘"@.*@! P@. 8@ !@)'"`# < @   @ 㿐 @UKb@ @ 㱐 @GKb@8@ Đ 㿘!"`cm㿘!"̀`!#`@??   @  bT "bT㿘 bX @<"bX...skipping... 㿘    !bܐ?4 !"쀢  !bܐ?   F)K!"Ā`!bܐ?AbĀ@   # Ͷ 0)K@G? @ @ '!@ @\bĀ  '!7?# '!@J#'!-?@C &# 3!?bĀ bĀ  K#P` bK#X`b   "bXbĀ @x? ` ͢ @?Ǣ Ő¤ @ߐ ?̀  ""T !#` bT "bT %#"%#@i%#@ ?㿘@   !bܐ?   ""T@`"@? @1? `@)@ܐ?㿘!"Ѐ` "T` s  EW 0A@d??5 3` !"ܐ @ )!"̀`@   @E     @=??  r bT  "bT 㿘@! ?  `@?@PU!  !Ā! #ܐ?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘+ "0@O 0@#!@b ᔐ b@`bH@M@[ "@4 @CK   " 2 㿘`2@K#@ && @" `&@& Kc8 "c8㿘 ?" "Kc8?"c8㿘 (E 0& ??> & ʐ㿘 !K |@#$ |Ӑ@ @ K  K  㿘 2  K8㿘K## "   @ 22  㿘  "   @: `:  :@ :` "   " 㿘? %"`K#@*` : @ F @>  @@? @?Z? +#! (#!B? @  "L`!  ?  B? c ̀ ?u!   @`"D 0c l  ?W 㿘  `"`K#@*` :  @ @ f   @xF? q "D`'-!0.QO  -!%! ZB  ?-!0N `B   D, ? 9 2 @Ǩ@Ғ-/ B? @  L 2" @Ð D@? @? ?D  @Cannot seek to end of file㿘S #@4 0I?   !"ܒ  @”0!"ܒ  @Cannot seek to beginning of fileCannot seek to line number %d㿐@x?  箒   "@0(  T @#@ 0'#@ݒ㿈@,@@rDetermining length of fileDon't know length of file㿘?   @ ?  !@ 0> @' @Ȍ d   2@ 8 D? " @ 㿘9  ?  @Cannot seek to that file position㿘@А@l & @ΐ?   ?@Ɛ   g  "x@< 0}@  @??   @ @8;'+!b܀@8 "?   0N#? ހ@   b"bT"X" %?  0/+!4 @  0bܐ? h? 瀤@ "" @bܒ?   @ D" L"`P"H*T%6d㿘!#`B@q1 @! "ap@ @@`D!   "`D @`@ * ?`#`@"   #" ""`@1 ! @ D& @ , , @$ D  @ D" H  !    0   0  !   <  !    0   0    @ \㿘 &? !  @`   @J ` ` @` @J 㿘 @ @J  # @J ! D"@$ D㿘`B @7 2  "`D @`@@ 4J  @# B % #`?J ` @`@N `Y  @ D?."D @`5`@J   @`2 `@T D ?&D@`@* * D &D㿘J T`  X  @ ",T   !# `,T: X @㿘#`L /!  @"J . :`@$`L  _ _   ) U  G   @ $ @ $ !#     0|8 y  * r l @`k   f$`L!b   $b!1    N @`$ @ D@;b  J ֐ 7 "`ɖ֐K`{@D @@`@@4' N "!*: і  @  $ @N`   `@ "`@ 㿘J T` `  2  X  2  `D`!"䀢` !"`  " ` @ b +@ *"@@@b*@*~ P"@ px H @H  "@   P㿘??  ? ? ?", ` !  " B?,b&㿘 42 ?`㿐F? !??  "?<,, ?8?]`B 2&    & Ȇ``   #``  8"& 8`  @ b ; 㿘 ` `O``  4   8   @5# "ȴ"""`:`"@"`$  &@Ȁ #````  `   4 2  8` 2 #b " "@Calculating line numbers㿘"@  K "cH㿘!"̀   d$"@ $"В` ?$"́㿘!#`?   2 ` `  ` ` ` 4 @8 x@ u@  ` "b   b@ f 46 4 2Y ""̒ !8 ?"E @K"#H421@.0+m 2( ""̒ ! ? T@K"#Hې㿘` a  ` `  & R @  `"     "@$@ !   25? 6 %! & ? "!?"  2?  %!(  ??? ?q㿘@  ? ? ?!b܀  @ ?   "܀& ?Ò@"?! /dev/ttySHELL%s -c "%s"sh㿘N -  ( @ t h@ r @ o pK |C ެ@ 8S @ @ @   x@ 6 @ @"  L@  N @@   `@  N 2  @ې@@ @@@n  D  "b  ِ @M 㿘@͐ 7?@ א ?   @ ̐? .   4 ??   @Cannot seek to start positionwCannot create pipe㿘ƒ   # c@"  #@  {?M @ h@ @ pհ?@a| @ސ  @  `E 4' @# L?  ?` $  @ . :    * $@qӀ #?!'? ?` $  @ . :    * $@q^߀ @"' @1 @  V   "" @f А?? 38#Є??: Invalid mark letter㿘? . 1* !ؐ? !"X@^  . 1* #HCannot seek to end of fileMark not set㿘 '"3 . $0.! ^+K |ؐ  > & 3"G !)"!K|bؖ> & #bK|> & "#  ?  ?!"@  㿘`?㿈  @ BK> |&> 㿈@ 6耢?K쀢? K |###;`;`㿈 &cЀK ?2  ?2  `| ""cА  ; #  ? ?`|@"" EMark not in current file㿘T  K |@ "!@ ??Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 %K  K0-0*)"  ""K `"" ֲQKY"޻< `K""@@C 0 "'"P@<㿘K "`ÒLine number is required after -l㿐  l'@d 2"` "#h@ 0K"cX藐Cannot use lesskey file "%s"㿐  # "'#@㿘  0)K'"#PH@`!#$`K |: @?    H  6 0 " e Tags file "%s"㿐 M  ""!x0M"ax!x#'!@/㿘  K "#X$#!!%s㿐 )!  "N@0,+N@ M"  m =  "d   "h `"l`M!T`"d@ժ &c "d* #'!@`㿘   !!%#($#(㿘   @ 㿘   t բ Use "h" for help㿘!"`   ##P@" 0լ ؤ@f K"`}  4!ܐThere is no %s flag ("less -\?" for help)㿐 'D# " J@ € $$  DJ ?`0+'D$"*` €DJ@ +`?`f`d'DK D"XJ + 'DK"`xI D@O'DD z?'D@ 2  @'$ @    "`   `, # D&     `?"N   @[`? J@  @'DD@  "@  €DJ`2JpLLLLLLLLLLLLLLLLLLLLLLpLLLpLLLLLLLLL<<<<<<<<< 5[`"Q` "` R`" `N` `?H"` `?C"@":` "N@;`" N@7`` @`@b`?` )"@4(`$$#"`  `$`H@ 2 ``  "`"@#@c 05`  €H`  @ `  "`   ``  *@> '@7``   "b ` @  ` -%s㿘!#%#c @6㿘@n    S@ 㿘@b  ` 2`@ String is required after %s㿐͐'& X@㿘#J@㿘N = $2``*@J@  @ Number is required after %s㿐 L -2    ?А  &%?'&!@  А  * .  @*`: В@ Ѐ$&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screenKH` ` "    J2 KH``shJ   ( P  J򀠀  㿘'D'H'L@H#  @!  $"8D?H@L $"8""8@ ?㿘#@1 㿐@V%s: %s㿘jbx@@@ Л (b@g#?㿘!L##`@ # @" d<## . `@   d@ . 6` .`@B2`* @ *`B2*@ *@ 㿐!#`  m"b   M>    0  h v քJ       @ N \"  `r@9D 2   0  0 *:㿘%L @K `  @ꮔ  "b $ȁ㿘!L#  @  b| #չ"b|#* $#ȁ㿘N  * : N`㿈6 2 @ڏ 0,@椒   -, $?L?㿘N) *`:  % `N d  s2N@L`  *`:  L`  N@ `@N 㿘!"#K``""Ȁ FY "<``q 0'L#Q "\ @ 6@  q B   ?< "`   "b 2㿘  LT#!!  "b|㿘!K q@    0 ԣ "` @   "b  6??!?? MM! !܆08M* 㿘7!ܴ  M`.8ܴ` (8!ܘ  M`* 8 8!"ܒ @ M??`*`:"ܒ`@`㿈! ܢ ` $ M`  @c@ bܐ???bU b$ $ 耢?쀢? *  :?M4 ?! !ܔ  6?M42 ( ?㿘!"ܐ @  M*    !ܒ @ M 2`"``"@??: !ܐ $ ܀6?㿘M; ! $"dM"d͸ H$ Mʹ $ MͰ!M"aT !$H a$"a$H a$%qd㿘 a$+b@w%d㿘 a$+@jb㿘 a$ ""q $ ?( $㿘? ? ?!b܀  ?   b܀& ?g -㿘?. > `6U,!*` € !$ `(@ J@ 7  C"TK]`|,@:`8!8#!#`3 6!?&  $* 0( &"x? ! 4 `  ?2    K`|@  DLhxDl㿘?`6- *` €4? V0t!c0pKh`|K`|& Aբ B 8 4`2  -?0LߞՆ ? 4ڐȞr   0$О $  (@ J  a$? "a$J? a$0 K`| `hxd  J:" ?." \ J2 02 0?㿘N l"   p b" 0"! ?* : `2-"*` €&@?&@? &@? &@ b&@&@?th`㿐   ("$N` 1-T#N :( ? %' .2a$* \a$* ($a$ a$*@`!$a$ N n 2 E N ?Zs N Ā :$( @ ""x  `*@$@ "(㿘MaT 㿘!# "` b< \ "@d*"@  J@ @&   yr "c* *` @2* (**`J@ @*J y   J  Mp@ 㿘 !( `4 %!( "`!*%!(bܰ ?# Ȑ    @  ˒N/bܰ?%!(No previous regular expression㿘  .#x 0(  `?"(Invalid pattern㿘 X @  1M@.#  ?!p "&!p@!&!p 㿘!M!p "$!p@$!p㿈Map @Ԙ `? &@ & 㿘M!X "?@ ?? :0 $aX:8 - M (2' MX"" 42 2" 4 2 ( 2 㿘`@@ 2 ` @` ` 42` " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@H0&@#㿐    6    >    2 J@ 2J@> J@ `'@`J`C '`JC `Ҁ J ̀ 㿀'PD'T A'PT  , PT "@@ 8 F :`@ F :`:`HT(N  !P۔T P!# `` 1M@'&!X`2@㿘 !D` " "a@㿈耢?쀢? ? @g 㿘 " "a(㿘   ( ?"  wѻ "`  ?  b   㿈\`/! ? 4 2(<y  Δ   ? ! #??<S#` @, $8 !@`!   @ "0쒏 @ 2 `  "  ` "` 쀥2= Nothing to search㿈`N@ , 2 .R#x"`% " 3 a( "5&a(&a(1&a( b  Ȕ h  O? "!D  "!@ "!@ "`  "!(" ߐ???2 #\`%1!@  ?#\#`??   "  Đ 0 ""    㿈  !0a8 !0? 0`?#??" !8@ !8`@!8!8? @?K?O@*  ; B?D !8?!8?? !820` (0K@*  ; B  ??00 !8`K@*` :  c@@*   * @ :`@ f !8?DKc@:  2 !8@c@  !8: @ c @? @ 2#=0(=0#\#`  @? @4 2=0(=0=0=!8㿘2c@ߐ ! b8 "㿘2c\@ΐ ! b8 "㿘2c@齐 ! b8 "㿘  2c@驐 2c\@饐 2c@顐 0 @鞐  @雐  @阒 Line numbers turned off㿘!# Q ""# @酐 3 Oj  @z  @w @e@k 2c\@o Z ˖  "b # %!b`Hb`܀   2  :   "" KcH ! "cH  "b 3" P tagsrNo tags fileNo such tag in tags file㿐Max3@jaЦ 3!} !{"#$@꿐)!f- @J 2aHL  2[H   "b @%#$ž"'J@ K %#$'J   *` ť''J`3 `)$$J@`'J@ ^`'%bJ \`'  *'J@  2J@J $"*@0H @hK @3! %#$Tag not found㿐 " "  e5  0 ?/?곒   /!-!+  鍔   "4 b@ @ /dev/tty㿘4 @!@ "b "b㿐#  b ? ?O O "/ b㿘@ ԐԀxph`XPH@ 80(  @ Ӹ@Ӱnoacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsport=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernel%s0@R!! #$#Mb8''@ X+M)M!j'M7M5M;5y95 Ft7* (@€b  5`@ g%"" "`5`@u   =%bZ$`"@j J@ 56`5"`@^ @$`8C$`␐ ?$` ;$`"@i J@ 54`5"a@? @$`@$$``( $`"@i˔ J@ 54`5"a @$ @$`( $`` @$`"@i J@ 54`5"a8@  @$`<$``@ $`4"@n`␐ $␀`` $` `($` ` @$`  b  5aP@Ԑ %"@ " "`5aP@ǐ   =%b$` @@` $` 2&☀(` $`@  $` &@ "@{ap@c M2b @ ` $`$`H$`L$`P$`T{'"@i& J@ 5!5"ax@ g"#"@i J@ 54`5"a@k $`$ Q$`` M$`  $` H&"@h J@ 54`5"a@L $`, 2$`"@hݔ J@ 54`5"a@6 $`  $`"@hǔ J@ 54`5"a@  $`0 $`&@s@ ??iaH* & @ @c@@` 25@D a@ j"x`-55a@ b @/ @- ֬````````````````ׄ``````\```h`ڄ`<X```````````dt````L``ظ````,P``ۨno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2/can't access %s: %sh?'! [@f#@Ԓ @ @Β : 7@/"H !#4*@b/ M@k 27"x@/ @ M"` ' ` Ԑ =$&`'   'ش !#;!' `'c@7!0-a+M c@95M"  o-` 5`   ؐ@,`  Mb 2v7@"q"02`''` 2  ܘ @A  0''@2ܠ  b 2L7@"G@:$ $''$'' 8#\c@8c  " b؀ 7M"`w7b@}ϐza@" b 27b@}@."   @ @$? #$!M"  ?@}$"  ?7b@.{ @㾐 @}@M @K @I 7@R""`$"@] < LMc@c@M"`j@㟐 ""x!7"@ @. !#02  &`&`&` !&`D&` 㿘'HH@>$㿐@a J @ "`E    >  &` `@{ 6@1` "1 `  ?+@m` &@" ! @@ `@"` `2  ` P`  P&@ usage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘z99999a8Xᐘ!Кb@!@ܐ ,-o %s: option not supported㿘@G  @- ;'9 n L  o  @ = 2*`"@a 2  M  @2   "*@ ""Ѐ`2 9bx@J  @Вp 2L@*㿘@ DEFRHLPXabce:f:hilnqsvwxz㿘@ؤ 0 < usage: basename string [suffix] 㿘z>`@7!@, 㿘@aFfh:t:vonly one -t option may be specified.nfs㿘@x @%"#>,'i`0'>#0*` €" " "`x""`j" $N |`j>a`@৐ @b " "`|@@aP?ђ?H* @   @  N |` >@! "@@F   @@ 2 `@ LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL</㿐@y  2 @() " ,`* * * %> T@ʔ Z @g D @, T 2 >X%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCx@Q @* h< @   @ٔh  h? )@? #h @ǒ  2! @   @ 2 @  ? @' 2@ > a@;  !"@ @  ,@  @,@ :  @ , :, @! " |`?!@Ҕ" x`2f !" @ ?!@'~Y !@  2S O @L ,  ? ?/7  @ ?`'\'`'ab''d @*\ ?@wʐ! ( @$ '`'x'|'d A#\ǔp   ?@va0   @ @ getmntinfo㿐@7   @@' 7 @64  ``@ ` `D@:  T2`@ T 2` `D@$  @Ҡ! 㿘N |  `p`?  #"@K    2`p@ empty type list㿘 @N  n@b@~  "N  o"" "`p " p %N  @֒ , ` @&*  $| @&^ $@ , `$@  @ , 2*@, $@㿘 " "- @Z "( @ . " * @Z 2  @Z " @ . "  * @Z     㿘'HH@$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘zAAA`@6!@+ 㿘@Grsh8KLdel:nwrlogin/usr/bin/rloginrsh: can't exec %s. rsh: must be setuid root. rsh: unknown user id. shelltcprsh: shell/tcp: unknown service. RSHrsh: can't establish stderr. rsh: setsockopt: %s. rsh: fork: %s. 㿀@E @ ''@< /       @AaP@ " ' ,` A`J@ -",`' `?B#$*`   j" @},`A@ X@ڐ&??!i!H  $!H*@$!H`'@d!H* @ A!h&@@%!A@F!p@%@J@JzA!a@{@p @%@ zA!@pa@e @%@  zA!@ba@W "@@ݐAA!@Zaؠ 2 AzA!@Na@C @" )"@#\@  @3   zA!@4b@) *'? @{k   j"x!z#A!@vb0@  @{W   !zj"x#A!@ub0@@Đ@ʐ '@d  @#  Cc@  @  Cc@  @  Cc@  `2@ 6j"x!z#A!@ubH@Β@Ð !  "~@Ӕ"~@ϐ@O`@ے  @888888888888888888@@88888888888888888888888@888888$8088888888@rsh: select: %s. 8 PN "@ j""x @$ <  @6* @ *@$@  @{% 6@j"x "!z#C!@u$`(@8@- : ؐ@ &jĤ΢"x #ɐ@ @  @ل ؒ  @ڠ"  2 * +@6$ * +  $ ؒ@ '"     @zИ j"x "K6@tzC!@`(@ِ 2*  :  5j&x@Ђ$ x # 2`*@ `* *&@ @w 6* : %j$x@a$  x #  @**@&@@Z 6* : 2 *` :@`؁㿐!j""x/ @= $"xrsh: %s. 㿘@   @@H `@`@ !z#C!c@tO @c@X @ @@m͐@@mʐL 2 `  , `@ 2@usage: rsh [-nd%s]%s[-l login] host [command] 㿘zDDD` (@+!@  㿘@mkfifom:invalid file mode.㿘@p Da@ 0`<D@a`? 'j%D+i m@ O␢ 2Da@ڦ @ !@֊@@?倢 ?aH* @ @&@ڐ `  `J`p   &``@ǐ`"!@ % - @2@ׯ@%2@שnode must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐`J c b Dc8@2 `@\ `@"DJ@ DcX@  ` @\ ` @"DJ@ Dcx@ ? *# 2* @ ? 2`  ", Dc@ @@^2` D@c@!  㿘@  .!D@@6 6`@@" # `@ usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p 㿘  #00 <Ez!@a0 !z!`<Ea@E`<@a@ 㿘@o_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘zEb@!@֪ a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@!*+*7*)*#E%i5*-*'*/E%耢` F#ܓ*` €j"$!0 %a4 & % j@ShbN "bj@SbbN"b@qc8?ؒ?H& H~H* @& %$ !0`%$<*    '''  @ ?EcH@ ǐ   EcP@q  "`E#X$!0 E@%#h$E@!#x<E@#E!0@#!0@Ӓ` E%a4!0@˒cX !0E@Œc E %a4c@؍ $@ƒ <@ʐ  @ E<c@ z @ڒ @ո @I`2"@<Ec@d  @ E<c@ Y  "@5 2FbF`@ L @~@J耢 F`@ ? @ nlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8N!Ф@ G 8     "   G X@  0@ߒ E#@ʒ @ƒ G p@0HȚaB + cB + 3`  *`  @  G @ْ01@s: ȀG̀G@ 0@?*a4      a,c?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?%" @!  ?" "  ?c@ ! @  @!  #? "? ?c@ ! @  " @! @" "  *    @ **#!,"!("`G `G  Ѐ G  @z@3@ 3 **`"!8G @! !4G`!8G!PG!X@ G@!hG!8!@&@!4@a &&  `  %s: devread: lseek%s: devread: read㿘. >@ޖ 2I@I`@ @I`@ statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block㽐@ג Ecؔ@ @Ӓ NIa0@ b F * ""N*"" a( * "a(*8 Ia@@l * `I!X@Ԕ a( @'*%I", * ,"@   @pa( @" I@!x04Ia@   Ia@  Ia@- @ Ia@# @O G`p@ @"`I!Ȓ  @0 Ia@ ฐ@@֛༠@* @֓ @֐@x`I* d0!, ߒ@x*`* 0@"0 ;  @ C@e8 *!8 @ *Ia@@Ő !(*"@  I"@, ( (  `3*/Id,a,*"@   @p   `2d `I@!x`> I"@ XI0"8}t+*)Id,a,*"@   @ߐ!pt `2d `I@̐!x`Ia@@S  㿘@eroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘 !zJc@i!!Jc@dK@``@U route: %s: %s 㿘jza"xK`@P K`@I!K @m-@A@6 nqdtv/dev/nullsocket㿐@ ' /K+,),'+#,%,!K7i9,5,;K-+ * @€ %a  %!  $ $` $ @5!??H* @ @&@7'#``&a@ %  @rҔ %䀢 6@Ka @ @B?`)K*` €&@;'&@U0 @ >@0U@@й..........................................-------------------must be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done x,# ` j K"bxސ#+c @ B .`@J@ -)@`?`#M *` €, ,"`l, ("`l, $"`l,  "`l, "`l, "`l, "`l@jbx#z!La@kޠ @L @0   ?''''   @њ 6L ܀ +@D 2Ls 0  @ȸ 6Lf 8ܪ+c  L@א `,`l L@ @Β`` [-L# " @  ,J, l` L ` 2C ` >,#`2; , @7$ ,!`*# @ ]#L  `@m@T@ @ `? @`@[@v`@t #@11111222222222122222222222211* @ Q(@ N*/:* b0  .*  ?** *a@defaultinvalidiso %s(%d) %s`Nb̀  *"b̤#0@La! 2 ,0@u . @dW` ,0  2 M!*:b0?`N!T*` €  ' `M!`*,!`*̒ @ה  *@tϒ . *c0@` ",@*"0`̐@F'@wF!l"0,!`  !  ???ؒ'@Ϥ  /Ѐ/؀``ِ  `!*ِ    耢 !*/'/!* Ф"0#\! @ -Ma@Md!("0@d$@ڐ @!M"@, #*b0@k!!M" #*b0@]!!*"069998899999999998999987af %d: %sh ?` O *` € ,M!(!+!`$!+ 0?    ??   !+:@ 2:@` 2``2 @Y  2 ` 0'@E@vx!l 0,!`  !  ???ؒ'@֐  /Ѐ/؀``ِ  `!+ِ    耢 !+/'/!+ Ф 0#\! @ߚ -Ma@L!( 0@$@  @ѐ!M"@^ #+`0@! !N!@#+`0@! 09  @sq ,,@j "&@o /   @@Fa,@?   @NS`N ,@@FQ? 2$, ` $'@  7 @? +#܀`@Ő   !   @j '& `  ,`` @ɫ0 zR!a@@{ NPNPNPNPKMNPNPNNPNPNPNPNPNPN4MNPNPNPNPLpJIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIȝ㿘@E_,! ` "!zR!`@9@. , * `*`"`>  $`$` $`  @ɭ?#:,, ,   "  (*( ,( *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7  7 7 * 77777+  2+` 2 2,2 21+1TD!!0Ta@]p0=N"֒@  NT""В@  2 T" T#` b    #\ `@]J,2 Tb0@]@/К1+!0T8@!2*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx ? / / // 7  / / / / / / // ////2 2 2씓21+1TZ!"hTc@\0SN"@&  NT, ""ܒ@  2  T,"1+#+'%U#+ c T#` c  #\ `@\Lc,`01+#+%U    K 0 *  2U`@\c"h,c"h c@!2actual retrieval of interface tablex   ?''''   @ 6Lj ܀ &@/ 2L^ 0  @ 6UQ"xܢ @*@4got message of size %d on %s㷐,#+ "c@y )+'U#@((@o '@X@㨒@X#uwriting to routing socketroute: read from routing socket: %s 㿘j,!\"bx  @Ք"L a c  g  , @    5,  & *+ @5,,p+,,̮!p `$ ``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  " @ %+,  ?   `@+c  V@r`X , Ȁ ?   `Ȑ@`V@X`X , ?   `@ڔ`V@>`X , #\ ?   c\@`V@$`X , @ ?   `@@Ʀ`V@ `X + #耢 ?   c@ƌ`V@`X% 5@H,#`25 +c @  V@iw `'?2% %,@"L  `@`@䀤 "x!z#V!@a`@* @ ,?(@J@@"@ + ,8,W(`  4,  (,? *,   @  ? @@ *@`"(^^^^^^^]^^^^^^^^^^^^^^^^^RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘+#`D `" X@.!0;N* X@%!H  "  2  X@!X zN @ @ T0 X@ !h zN @p @ 0 X !@ zN  @֔p@r route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘!X,"y @씐     zX!@da0zX!b@Z   !z#X!@_:c  @M0  L 3X9z-N/X5X7Y+;Y  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀ `` `,` !X#8@+ #,a $a!X#P@$a`   !X#h@ X #@  @c p@ @ $ 4   L@ $  8 L@ $  < L@ @#@`! $ @  L@ې D#@T! $   L@ϐ $  , L@ǐ $  ( L@뿐 0`" $@l  0"@& 0 $` 0   L@뭐 +#`" @%0?HY@렐   O@{P ?`$   * ' @8  locks: inits: 㿘Z@ h!z#N $ c(@XZ@t x @Q @  L sockaddrs: %s㿘`@Z@_ z` O@8P ?`$ ` * $`@8s  %Z"$@? ?  @ ``?"`` * $`@8O @`㿘`Y ?>@ 6  , < ?`&  @  * & @8+ !  ?`&  @  * & @8 4  8  ?`&  @ >* &@7 >㿘O  " @sx 2  %s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; 㾀 ?`Z*`[! €!Z#@*!Z#@L $ !Z'#@9N!Z#  @9V! ![   7 7 7 777@6@`#z ![   / / / / / / / / / ///@ΐ@>z@Ր l|mmmlldmmmmmmmmmmlLmmmmml㿘@@ @    `А *`: ?А *`: ? *`: ?ɀ`2    [#(,  €* ,`  *  **".@nnnnooo$OpenBSD: show.c,v 1.21 2002/02/16 21:27:37 millert Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x  %  `@J@ -̐`?`\!*` €         @   ?''''   @5 6[@de#@/  "\@ 2[@Q#@"   @ 6[@dJ#@ @\@= `@  L 2@K @p|pppppppppppppppppppppppppppp%-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐\\b\\#\#`"p−   @ %-6.6s 㿘 L+ Ѐ  @P" 2  @ $ @  L ?  M@ P @  \ @Gbz`?"`ฒ * "@5א InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: 㿘?`]!*` €\#\#] ]  ]  ] ] ( `]@i 80] @@dtttttttttttttttttttttttlink#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s  x x  "9 u "C o     2  ] ah@T   `  ] @ wap)]']@@T!x `@ `h@&d `]^!ʐXT `  `  `   `ﱐ]!@d : 4@l/@g*&]  @T5a z:)]']@T(!  @T ᠠ *,]!@牒0!`]!@瀔0]!@y p[R#Ѐ` #R@"` `*`R@  *@Y xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd㿘 @D *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @:6`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J ЄД ** 8?А ?Ї+ 8* Ѐ4*@*@ 㿘@5C/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !!7@_#\@bOD_"`D_#\ @b _`#7#\_@3S#$6  O7#\_7c@y65"""D`"@nP` 2  2  7#\_`@bc86?"b _J __ @!#P  @!#`  7@Q# 6="""binternal error: unknown type %d.㿘!6 " %64B P O`"$"O"D"D` "2  `!@ 0_B J  __@!i#P @!d#` "$$"type㿘O_"Ȓb"`H 㿘O_"ؒb"`> 㿘O_"b"`4 We only support %s mode, sorry. 㿘7#\`Ab@Ŕ6?"bWe only support %s format, sorry. 㿘7#\`7c@p6?"bWe only support %s structure, sorry. 㿘7#\`<cX@6?"blocal-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘 'D'H  'D` &`D  `D@=ڒH D  D`ȐD@=ϒH D $ HH7#\`@Nc 6``@?r` H6?D"b`"H`""`H@J a 7#d a a a   B d  @`H"`  8!P H@k H"`H  @  @"H @local-filesusage: %s local-files Continue withmput%s: not found`'H 'DaD@=RH HH7#\a@Ԓb 6?u"bH=A "d##`x@ '<@<!8  H =""" H@> y=", 8J  y"  2J J  @  "J  *` /y"   r#+  * *` *B d 8@$ 8!P 7@ 7#d a a   <!    @!!=" H8! 1<! aa&!"8@>bH " $"&!H @= 2uLD Ĥ B p M=" H@= B d H@ 8!P 7@\ 7#d a a H  <!  @! !=" D8!  1<!aa&!"8@=bH " $"p&!  ,@ZH, @ʝ HȀ 2 Ha@@ϐ"P@JWD QL" DH@= >B d "@ `8!P 7@  7#d a a @  <!  @! #=b 2 8! !<! aa$!"8@=RbH b $b$!  =@D?@ =""r+w㿘c@( w㿘S#H#H`c c @ usage: %s remote-file [ local-file ] local: %sRETR㻘 'D'H   'D` &`D  `ȐD@;H D  D`D@;H D $ HH7#\c@a 6``@=#` H6?"b ;=", 6 J  y"J  @  "J !   *` /y"   r#* +  *` +H"   B d H@ g H"`  8!P H@  H"`#H@   (Hc`@p!8(@S:HHH @=?  H Hc`!H` @ @$S  :H@@㿘@A !7#\?`" * " @. #\@ )=" 8! A!<#B# !a``$!"8@<$`` $!<$``!@’ $``<%"!@ remote-filesusage: %s remote-files mget㻐'H 'DdXD@:H HH7#\d@ ah6?"bH=A "d##`x@% '<@r!n8 =h""" dH@; _8=", N` y" `  r#+    +@J`*B d 8@ x 8!P c@  c!Hc  <!     @#R 3=b 88! 1<! ad&!"8@;ma "&!b &b&!8  @:oH 2N@ =""onoff ee Connected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s 㿘!7#`7#\e He ``" 6"@ 87#\e@-u p8  +7@+_ #`  67e#\`@07#\e@-^ @+M +7=ec\`" ="(J 2Ae A#@y6c\!e" @oeA77<c\a#p@ca6c\!e"!8B h<!B p@J7c\!e#dϠ!p8 @;<c\!e"!@1=c\!e",!<!@"B d  e6Bc\a@@<8ec\@,ސ"8!P  e><c\b@)7ec\@,̐"()7B#\!e X"8A#<|b @B#\!e 8p"x@=e#\bf"$6" e"`" @Β%8\ e#\@,"\ 6 8e#\@ @b\ `6""usage: %s [ on | off ] %s %s. 㿘  `? & e`@4ϒ`   & 7e`@4Ò` 7 &#\f@@c@? 7#\!f#X@tBell mode㿘Bgh@6"bEPSV/EPRT on IPv4㿘=g$66"b"Packet tracing㿘8g6"busage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿐  B X `?:" X7#\g@)ae`@4>` eB ("`X`@44` 2`B" X@8@ #@J  A7#\g`a8@6?!"bB "#"X3B17#\!g`X_!X@В`X gA##\@ǒap#\g@+!`X6""Verbose mode㿘6g 6"bUse of PORT/LPRT cmds㿘Bg8H6"bProgress bar㿘<g 6"bInteractive mode㿘<gٖ6"busage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. 㿘  7#\h@@W`6?`"b  =" `?,""  e`@3z`  = "b  e`@3m`  ="" !,@]`A"c!,#`!@\Ґ== "b(" !=" 7="( "7J 7#\h@`H$" #\e " ="(J 2Ae A#@=" 6""Globbing㿘BhpA86"bPreserve modification times㿘<h-x6"busage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐 7#\h@'b+Be`@2ܒ` eB $"`P`@2Ғ` 2`B" P@6ޔ J B7#\h`b@6?#"b P `?" P1B P 6b b ?"b7#\!h P# P@g P   6""remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'H  'DiD@5H HD  H7#\i@)`6?%"bHi`@ ``6"!`6" H7#\i@)ې Hi`@n `B "`\usage: %s local-directory Local directory now %s getcwd: %s㻘  O"@ &`  7#\i@@ߒb6`@7` 6?("b@h`  `c@!86?"b@$  i7#\b @6i`@"86""`@Iusage: %s remote-file DELE %s㿘'H  'D`ȐD@5H HD  H7#\i@cP6?"bHi`@#hmdelete㿐'H 'DdXD@4H HH7#\d@lah6?I"bH=A "d##`x@ '<@Ԑ!-H !==&""" "H@6& i#h@" H8! 1<! ai&!"8@6c " $"&!H @5 2N@M =""from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'H  'DjD@4vH HD  jD@4jH D  HH7#\j@~a6? "bj`@G! Hj`@@!ȁ-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:㿘   &`  j"&`   7#\j@@~b6j@@cbЀ jj"ؤ"`!j@cz" " `@5` 2`6?1"b"@ck c`J |"`@5` j`@5V"耢 c6? "b`` @ 7@'#\`@@usage: %s remote-files local-file 㿈'H  'DdXD@3H HD j`D@3H  DH7#\k@~3`!6jH*  ?b''"?@c HJ |H@5F j@4"耢 H6?P"b=A "d##`x@/ '<@|!="+  a w/H,`@j" @ 3=b =8! 1<! H&!@a@4"8 b &b&!="` D?@Ҁ`@ =""耢@@\ SHELL/bin/shsh-c%sTry again later㻐 @֐  @Ґ @R S @*   @Đ  @ k@# k#@ / " -/ @Y.#k@b^c  +/B P  !7#\@'>#\@ @)#\  kB t @׵ k@ׯ k#(@7?6"b@I @@s @p ?6k@ #06""""usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'H 'D lD@2HD?  H7#\l@}a(6?U"bHl`@_!X 7 D  Hl@E!`H"`D 'DHl`@K!p # D H!7#\l@&!x@#\z` O@/@?,H" D 'DHl` @)!  7#\l@&!0  7D 2 ?Hl` @!7?"c`PWDPWD command not recognized, trying XPWD. XPWD㿘!6" l$"@#` 2$"6"!2 $"7#\l@&Q#hl@#$"Local directory %s getcwd㻘@<$  m7#\`@|g6m@B (6""directory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'H  'DmD@1H HD  H7#\m@|+`6?"bHm`@ 6"!6" H7#\m@% Hm`@s RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'H  'DmD@1dH HD  H7#\m@{`6?"bHm`@@!؀ 6"!6" H7#\m@%!Hm`@+"command line to sendusage: %s line-to-send 㿘'H 'DmD@1 H `H7#\m@{c6?"b`D" @.Harguments to SITE commandSITE㿘'H 'DmD@0H mH7#\m@{xc6?"bmD#@H㻘@W$`k@3  $" @W @(    *@ . k#(/@ @- modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'H  'Dn D@0H HD  n(D@0H D  HH7#\n@{a86?"bn`!X@_`SITE UMASKSITE UMASK %s㿘!6"  $"n"(n"8@F`$"SITE IDLESITE IDLE %s㿘!6"  $"n"n"@,`$"HELPHELP %s㿘!6"  $"n"n#@`$"㿘!7#`  @ @"b #`  @ @ QUIT㿘#7c` n@#!B l "8@r8 S?"c<$ l$c`8"!\usage: %s [password] Account:㿘  7#\o@@zj`6? "b2o`@ (l@!㿘@6 8  7@" 7#` 6 "b6""@" <!@ђ commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'H 'DoD@/H  HH7#\o@zaP6H@(f ? '!7#\o@#А! @#\6h"" !7#\o@#!8@#\26J`  @*ΐ# L " <"@*Ĕ#nmap: unbalanced brackets. >#   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   <> $t#k<k <k <k /tmp/disktab.shadow} <<</tmp/fstab.shadow $<"<"<"/tmp/resolv.conf.shadow9Ht <&%<&%<&%/tmp/hostsA饅*=G40q7b_]~y.(L(.`b?a-[z{>X\jf9yrE|8ڀ>/-tpTVPF=fYs߂#v5{E@.>C)z vIF,z,k B,F E=X ׿;WuAuto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s?'?#"@wH@M̐?c@"@  w`P@ ?w`x@#  ??#* w`@#   ??#  w`@#y  ?#   #w`@ʐ `@J0 /  L@ 2,@ 2xw. ` L@  2xw! ؀?#"@ %?!?#@x"@%?   J  ` xw!@0=`@MA$ wwa0@z `x@#  w  `@#    w wL  /w!X@0c,@IÒ / ?L@ 2,@?c@@`$@ 'Ԁ??w!p@l0E#H@@e?2 06??6:?#w@UVa  z&@\!'Ѐ ?wR '?c6" @xِ"X 2?}a@ Ac ?c:# @  ;c@)3?O?@B :& BВ@?怢 2B X 7<" 24?@# +#27 @&7#\ #`?"``@* "@@] #A# :@@ F 7@(77@#\?#ؒ@Ԓ@ 2@B X H<" C@#`#<  8A#@# :` #27 77#\?`"@  #* "@ #7#\?`" * " @ 7@d#\w@큐!0Z@( 6" #?7#\w@b!#?c@ @zR Ѐ c@ c ? @?L [@ʒ ] " J ``:2* @ټ : B,  P  ?#@7\wa@oMؐ @є  ''7#!?#@`7#Ԁ`#(w  P@T@  !w"@ݐ @'0Q?#?'ԀJ!??cؠ  #\  @P7#\wb @n@C 'Ԁ?w'"0@C4 ?j"x @i?w'b8㸔   #\ @  !??!?#@#Ԁ w"@@왒0r# 6" w7#\bH@n#ww`"x@~f?" 7w#\b@n@G : 5@J wb@7 @G % 2*wb@S[ wbx#w#\@~0 ?#ww@bx@~@$?wb@S7 wbx#w#\@~v??#ww@8bx@~h?#ؒ@@B`P`7w#\c`@n)Ԓ@۔w@#x0ِ @??#ؒ@&0:./Ԓ@  xL   ./@G  wc@U[  w#@0 @v Ԓ@  xL  2 `    ?#ؐ/ ?cؐ */L  r#* R  c2 wc@   2 L (  @F͐?c _' * @# : 6":"" ?Px  K?#J Fx?6??:?#w@Rba z&@}h!'Ѐ  ?w@Q!0*R '?c6" @u"X  }?#@ @ @ 0a`@ Ac ?c:# @  ;c@&2?O?@B :& BВ@?倢 2B X 7<" 24?@# +#27 @&7#\ #`?"``@* "@@\ #A# :@@ F 7@(77@#\?#ؒ@Ԓ@ 2@B X H<" C@#`#<  8A#@# :` #27 77#\?`"@  #* "@ #7#\?`" * " @ 7@c#\w@ꀐ#0Y@% 6""?6@## 6@ 6" @7#\w@O#0:" #?7#\w@E!#?c@ @zR Ѐ c@c "? @?c@@@ 0'@d 0 ?#@w@,!0x @@WԀ??@?#@ "?@ @?@? http fetch aborted. 㿘@(W !7#\}@!H@#\6"X@t  file fetch aborted. 㿘@(C !7#\}@ڐ!@#\6"X@t ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetp6'D'H'L"'@t8  7#`    c @א c<@Ӑ }@!}@! ܦ H* @@H   }b@A w`x@۔   w`@Ԕ   wL?h0d`@Ŕ  g L?W0S /@D :@D}@Dy @ < :8`5`*  @,@Dg @Db @ 2SS@J"0  M L  }H*` @5"00@<@9`@D7 : `. @D' :`L@ `B.@``N@  @O /  * B P  7}#\b@#\#`@jޚ/ @O 8@3G7#`  7 0 <'''耦  N !8'' !8 !T$!T @7#`  $!T  @* 2 }"p@賒0ᮒ }}"b? 'YB \  B p  ` `N@ }b@ @ ` `M@ }b@  2 ``N@ ``}"' ''%B \ K`"J?M@ 6D?"  7#\}`"}"Ȑ @jF` }Ж@zj$}"''䀤` '耤 L!<}!"'$!   $! " ''  ϒ6"@ d ܰ @ܐ '܀ 7D 6 7ܒ :H* @C `7#` ? _ Can't allocate memory for URL decoding㿘 < @@R   b8@牐  + L +  ,@ %2,@y"   D ",@   D @,@ ,@ L ۢ`$@,@y ` `(8 (8` (`8Б(: :/㿘w`@ʔ  w`x@Ô  w`@  @1`   unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socketconnect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt@6 "b)8  @!`ؒ  @  ''''@ϖ.``/@Mڐ `@MԐ   @y O`@MƐ  O @y  PO @졒` ! @ٔ 6 @@В6?"b `/!@Da!/!@D[!/!%6$ G?     #\! @ 7#\`@h  @=r 6 % @<  j"x " ``     #\! @  @J@a?  `6  @:!6?@"w !` @m @'7c'@ PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘B P!S'H'L'P'T'X 7$#@37c\@Y# H#(@N  c\@L#0c\#@@N۔  c\c\@?#Hc\@x!c\?`" * " @ @c\3B`l  @c#X6?"b& b@u `l@wH`l@#@`lA "@Lc@%`?#@ ƀ @T %c%c%c421 Service not available, remote server has closed connection. %s:㻘?# @$9 @1"    6"" ֦ '@} T`΀` `@u T!B la`  4!B@h T!B la`  @f@ l!B` @6" !7#\@!h@#\6!"b ` >6"`465 541># ,6"  7` #\76#\a@f7#\`? "`` ,`:  @* "@@͐ y" `   6*` * ?А"  6"?    6" " d  y" `  2   d` `)"---  d`("  `- 6"" "!B,!B@ժ T` '`6" 4 !7? 5># !7#\`?"``@* "@@N@#\ $8$6"@A 6"`"# 1,A"# @ 6"!aS@'S#@  "@`"?П@  ?ƴ@ 6 "b 㿐''   @: send aborted waiting for remote to finish abort. 㿘@!Ԑ !7#\=S""@@g#8@U#\7#@n$ sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetoutA# :6?x< #'l<@  6?? 8;b'D'H'L'  LJ -7#\c@eBL`7#\c@e9L8  DH@ L06=b"   '''aP'7't@m# /A A# 1S#< @?&#< @+  @$  l@ l<6?"" A"cl@ '`@ 'H@Ic  H<z  `'`"c" 0aJ@ |( @ H'aH@b' <!@✒@ @ @ݐ 6b ""b C"l'07H@.aH' H@}#@Đ @ 6 @'@oR  <  "7H#\@dc@ @ @\ 66:@~ 7@ @  ?@ ?6"<l"b @lѐ# d1S#H#H`@QD@I+`  6D@I$` EL6" ?` @A    #HR  @  1SH@# S :H<l G" #H u    >#H<l 7"b 0  >#H'tLD 8\ ,@ @ <l`"" J! @ @ <l`"" @  "@pt@ 4' @? @ 6b'`7``j""xS # >`B;#` BR @S 4&@B X ;<" 6" 3@##x *7x  7| !7|7#\ #`?"``@* "@@  #A# :x B@?x#@#\pR @$ @B X M`<" @6" C`@#`#<`  8`A#@# :` #27 77#\?`"@  #* "@ e #7#\?`" * " @ U 7@#\`H@ݐ#耦j"x]B X3 ##x 8x  7| /|7#\ #`?"``@* "@@  #7@#\A#B :x X B?x  <" @6" @ @;B `?"``@* "@@  @`B :`? "`` .`:  @* "@@ Ԑ@`B :@` B X B<" 6" :@##x 7x 7| 7|7#\?`"@  #* "@  #7#\?`" * " @  7@#\ @H@ # @ j"x @@ @@??:@ <l`"" @@Y @3 @0  "@@) @#`#M  I@ 0E@ @ <l`"" @  A# 1S6?."b#< @]?&#< @Y\ 6? "b "@@@#`#  @}  receive aborted waiting for remote to finish abort. 㿘@ː !7#\=S""@@ ^#X@L#\7"@j receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sA#'H :< ''X<''?'T6??'D<@  :" ;'L'P'Xc'@F`?'܀ #6"  8H X 7HJ -7#\cH@aL`7#\c@aL8   <܀ <HD@ L0T'!'䀢 ' ܀@ 7'@ie" +AҐ A# !S#< @b?$#<䀢 @ 耢 X@ X<"b T<6?""ℒc@ '`@ X'耢 H@Ec lHJ |gH@(  U8H@ /j"x   H@q#0m 2,H H0##@(}   /,8H@S#0O 8j"x  8H@H! 8H@?#0; j"x H@ w'HH 0*  H@ j'HH ܀  6"   0=b"   L@ 6:@4  7@K @H 6?w"b@h" #܀  S#H`#H o cL  D 8d  0\! 0@]!H' X 2XH@DĒc Xz <'5"b`#HJ | @ 'H @gaP' <H!@ݠ`0b ""b C"l<"bH@;P' H@݊#0 @'h@R   !/$'!/"@#/b @*@ $b@g $"$"p<  <b ""b <""@^?6" "S  SH H  j HR  @ j""x^  /bR @@2 j"x   $ P@cB <` XB <;c<" 6" 3@##Ȁ *7Ȁ  7̀ !77#\ #`?"``@* "@@T #A# :Ȗ B@?#@#\//R b@ B X M`<" @6" C`@#`#<`  8`A#@# :` #27 77#\?`"@  #* "@ #7#\?`" * " @ 7@^#\`j"x @v @??:@H@i#08H@ܕ 04#H#H @ @  ` @? "   @n  H@<#<X<T"" "b@q` Ԑ 'l`  X3 ##Ȁ 49@Ȁ  7̀ 0@7#\ #`?"``@* "@@p #7@#\A#B : X B?Ȁ  <" @6" @@cB@͈:c` ؀ `  @< `?"``@* "@@1 `` B`? "`` ,`:  @* "@@@`B :@En` Ԁ  !7#\` @]#\@{ XB X B<" 6" :@##Ȁ 7Ȁ 7̀ 77#\?`"@  #* "@ɐ #7#\?`" * " @ 7@&#\ @ j"x @= @??: @H@1#@9 <X<T"b "@@i @f  @_ @T @#`#܀ ` < <@ <" u @@oL@ʒ ?j'\@9 '`\`H@7'd?_7#\!H @!\@%G@\0P<X<T"b "@  @ A#  6?"@ @ 03@e#Sc<6?`""@V $c<쀢   @ "@@TJ@#`#  @{ @Ґ @ϐ use of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)bindlistenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d㾸7  't` '` ? ?@?@6@#x6b &7@7 @  @0 S"#<@٥ - S@Jc<?S6"< $"6"  ?c t@/  7@و#7c@   7 S="$ ,#6b '#6b@s    7#\ @L#ȀB P `$b7#\@>#! #͐6b@J    7#\ @##Ȁ !6"  S@<?S <6""d$"7#\@ (!S``@@ D7c@  276" @    7#\@ pv!S#\#`?#`@ŚĀ 77@  @7*`* @*ÖǕ*@  (@ @ 4 , )$ ` @?ʐ 6" @ʐ 2 7 7#\@ 4!S7#@  ?S !7Ęh#\#`#d#h?#l#apl@r P7p ^7l Z7h V7  @. * *` *Ö Ǖ* 7*c@ 6.&ĘȚ̄ІԞؠܢh#\#`#d#h?#l#p#t;x;;;;#a0pl@$ 7#\@1 !Sp  7l 7h 7#\@ @!S  @Ԑ˦ϗ*ۅ(ߕ*+ *  Ó*`ӡ, @+`@(+(@+ @ǐ 7(@, @$ @6.&$Q$c@> m!S6"'@   7#\@̐#[!S#\?#ap@ 7OO@ 7O@7O@7#\@!;!S7#@8a`@ 4 j"x  !6" @ק!$!SS!7c< #@@. #@ #@  " S< 't'7@7c@ʔ )B 8 24 #Sc&!a#"aP$@3b!@ %a!<"$@3Y%e@  @В@ $@ 㿘@̐ !7#\?`" * " @ؐ @F#\7l=`S7"l#""@#@`  STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s aborth#'D''H'L'@<2 8' =   '="  166"  6"耢 2 16""   7#\@ 0 ݐ 7#`  "7#\@ Pѐ 6?"bԒ ? hjc 7@_z# < c@" `8'DWL @  0@t  `'CH  !S#D `$#D ￐ @  7#\$#DH`p@VL0@ S"#DD@;c耢  8  p !AD@;c耢  !A8  #` !A# 2!A 2 !A 8H &0# "8@ 8 C`?# 2#!A 2!A 8H "!A1 # @ ) 7#l 6?"b@ 0J# "8@ 8 `?# )Ȓ  @ՐB T R 2* + @ $  67@ 7#l 6?"b@~  8   ߐ 7#l 6?"b@@ resetxؐ @ B T R 2*@ + @ $@  B  a@6?@D"b   Brunique: can't find unique file name. 㿘@5 / ` 1,@@`##@ƒ ` /,@+4@Ӝ#; 7#\ @"`03a@"@~ .*&`  d,,@: ` 9,@ 0a@ ,:  02 L .  1,`,"ߨ 14!Lost control connection for abort.%cABOR x!B l @x 7#l 6?"b@a`   @ lR  @0  " l@,  l`0@UG @ lؒ  @ɐB T R  2`* `*   $ V 2 * *@$ l 4 67@ 7#l 6?"b@h V 2 *` :@` V @$ 4V  6""(  ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssuAadegimno:pP:r:tvV--r requires numeric argumentRetrying... 㻀'D'H@M b0877"##@"@A  "c"P"c B<8<6<A$36#6%="c#`p T""#" &b$b@$ 7"ch=6"b$"@_"X ")0@9Ab` 2&b$bbh@98 2&b$bbp@9/ 2$ bx@9' $b&b"@M0 <@9b 2= "b @("= "b(J !=""b(!="  ="(J 2@&"$" @ #  @8c c(@8 @8c0 2z z `@T 8 "a6 "b XR7@"c\ j`h@ $ c< `"b `5["H*` 66""S"b= O"b06BP `"F"PBC" p<@"!<?<"b 89"!Tj"cP@8 0z!7,"c\6 6""&"j"7!"#j"y"    @!>$#cX@@ 8  "`6 "b6""@\HD@V8i!HAD*`" 'DH8@ <B " 8'H##"@q" @J @ї@ʝ O@"@@h bX@v D $J6H  6H="0Dx &;6@.@[" @' c @W c<@S 0 <H'@H'`H'`''D@t 1># !7#`  7#\8"\@א#x@p##` >"#6@[y"`?  c @  c<@ @ VWWWWWWWWWWWWWWWlWWWWWWWWWWWWWWWWVWWVWWVWVWWWWWW WTWWWWWW؝㿘@ 6"@[B 㿘'jx@ސ #7c` !B l " !SR @f @J0 l$ l!S#< & $c`@\ @}#<?$#<$c`N c`  !B l " $c`R @J @J l$ l$c`6""; $xftp>  sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 87#\?`" * " @ {8L dƀ`", 7#\@ 8 ``? "`@Mu  `  & `` v `s@#@c P17#h@r? 7#\@ې XB82 L 7#\@Ґ p98  7#`  #h7#\@Đ +8#hB"`` €cB h " L  7#\ `?"``@* "@@   #\@8! " @Q!7@#\@|#\@# 1z$@ `    @ nc @֐ c<@Ґ  R- <   `"] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘0 <z   `@P!@ macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8@!آ   @e # !!@u ?@͙ a@-b@5  "aj"x "@Q @ݒ! &/@( . \Z" 0T F@{ L'5Ḑ@ :#6b@~ 4b@(a . "@t b@$ b$L @(J . #@] $Ḑ@p L@ 0"'@   5D `5@, @  5!5!@̐@m @h&@0@3Ӓa؀ @3̒b  5!@R   ?@  !5!@@C @>&05!@R   ?@  !5!@@% @ &08  5)5@*! ")5 ")5  '87#\@_"5\`%8*` *  *    ``@! y"   ",  ,5@! 5s\8` !"@ *` * ?`"-$\*` * @ * * `"\%8* @ *` #<@!E7*:  ,L? \, a5<! 7#\@#H75#h@#a@7    5@,   5@"(@ "55!@E 07#\@"57#\@#5@"(@"X5!@Ep?㿘!5! T @X!  ` `,3#5`"a02.@C!. @>!`"`\.,a2.@0!. @+! ` ` ` `,퀢`\.La T  @`  @@2la "    stringlist: %m㿘@~ 2 `@$ & & @~ P &`@ 㿘  @2 *@&  &`@  * "  & 㿘  `  @ .` @~Ѳ` @*@~@~ɐ㿘  : , @2 2  * Already connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿘#7c`'H  'D76#\a DD@HD  7H#\a@L6?"b!=" A#7#؀H " H="("J b@ E  A  " H`丐"8 6" =7#\bH@LE( 7bp $c`@[#p6"Ab @S#@"<b @K!" `B "*+ < <")7b  @8#8!T=6"""bH  @ B P'6 ⤐?$h" #!6`!%6@%  @%  7L? ."? ,7#\b@K 2,!6bȐ"@3<  8  6 "b6 "b` 7#\b@KĔ#$  6""6""`"c@3 2$7#\@y#$⤁anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init'L`'H  '|HLؖ| H6?"b԰ H L - ="0 ' !!@ !@@i   'H@ɍ@“ 2#`'H!@Hp@[n! #`'L'H 2#x/'H@h  @k@q 2 7#\c@K! 7#\c@Kz`/ O@ܐ@?.@O 2'H'HH Hh#`L 2@RN#'LLY#``| `@R>#'||I#в``8|`<#Ѐ @#؀ 25 ="0 \  8   0'@c @~ِ# G 7#h@#@058\7? @ "c` 8`#@/ \`@  sorry, arguments too long. (%s) 㿘@# @Y$ 7#\@N#7#\@Jxc ,@ $z"@`@8 @8 ?L@ ",@  @#@$ $7#h&@TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘=" B p !T6?""   @A$ B p +T6 ""  `" ` "" 0` 25@}  @~J? /  $d ! @ ?@ݐ @;?L /" /, ` @}ؐ;@W !@Ǒj @t716"?&"&"'BX`$X8 [`?`@`!0@!8 > `@`!@6"@pn d 6"&`8 5`?aH&"$X@%`@` 25 7#\@.!P !x&!T"  @$  @@ $ @"i 2.%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘%< B#B`` 2? !7#\`@I@s#\z`@ؒ$ , rc*  R  n"$  p a#\ y#\#\$@   $``#\a@H @Ha8!7 %s: not foundhB p ! Ȓ  ,@}T@, @ 2@Ȁ  @@ː"@F  @%#$@@>SIZE %s㿐#B%6`P ???$#H  6"@! $  @] J  y"@  2$??"$`P 2 $!7#\6@A"#\@} $MDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H#B'6-6`P⤀ ?$ P a`16y""   "    2 `X@/  27#\@H``  2 0, ,, #\#`"Ė`@Ȓ  ,@|?'''Ę?x''''@n?쀦`7`P  7#\`@Gܔ$"$`P 2 $!7#\6@"#\@}O $⤀?"%㿐!T ?@$ `w @|?   `?㿘#jbx <" ?2$bx@ $bx %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAh!6"8 @V`S"86#H$"$6# :0@V <" +6b b1@5S#H@ B `5- -@B2`* @ *`B2*@ *@@Wb  d & d4 d"@V8!X?․`@~@m d@{@{a8""@#\#@Vޚ$@  4`  <    4  a"@ , @{i@{fT`J@""@` !@#\ B#\@V6$ $"@'" 'А"@''6"0"06`6$"$" ;"0688  "8@ # '6"8"8" `'" `'А"@@''T Ѐ` 腠DA?؅B.'@m @z@z""@P@VP.@z@z""@@VCX.@`@zߐ@zܐ"$@!!` <@l <@`ϐ@V(%7# #` T ؁  bb`(@z@z""@@Vp^%7 b@z@z""@@UN%7H @@b #!@@?ؒ. ЅąB'@l @zx@zu""@P@U˖.@zj@zg""@@UX.@`\@zZ@zW"$@!! <@lh <@`J@U%7\R @z@@p! `cT@x @ 0@ \?`" * " @ @p \%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d 6"  @U  6"8"8" `'" `'А"@@''T !@# 腠D@??xTx聩 B3? ?  @?c  ( # #` #  !8!<!x#\@?;``T T B`;h!!#p@T d V# #Q ` M Tx聩 E6`AS#H#@ D 4: 3@ @?~b !@?x?px. pąB'@kn.@_P@yO@yK d$@!!  <@k\ <@_>@T  7#\R @y0@o㿘  @ ,`@y @4 `@* ?8aX@k) "  @zِ? @I 6C`@,` 7#\@  7#\ `?"`@* ("@@b %`@x-`7#\   ?`"@ * "@E 逤Ħ`@ 㿐7#\#jbxR `h@x?   P8"!X8 P"aX$bx㿈'''' @9 㿘@xphXPH@80(  @softdepforcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %s @<'j ih"""aH' %#- /j o␒@e@O@FD`? ?aH* & @ @@@?'`' ''@x x "  - j0 j0     @bxa @x @u͐ usage: mount_ffs [-o options] special node 㿘zb@BŐ!@u ,-o %s: option not supported㿘@%  @b 1' n L  o  @ = 2*`"@ΐ 2   @2    &*@&c@x2  @A 2L@t㿘@k/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.pid-pbinding to user-specified port %d-d-D-cf-pf-lf-q-u-1specified_interfaceInsufficient memory to %s %srecord interface%s %s2.0pl5-OpenBSDdhcpcudpcan't open and lock %s: %mNBINo broadcast interfaces found - exiting.PREINITalias_㿐@;a @@[ / @ @ @  ` @@&Β` `@K@@!* 4#@8ٓ2`@@&`Ȁ  }"c0@@&`Ѐ  s"cl@@&`؀  `@@Tc"!@@&`  `@@TS"!@@&`耢  `@@TC"!@@&r`  9"#T@@&h` T0""0@@&_a 2@T &"b,J -@ؐa@ ` 2  @! @7Ғa@  `@u@ @ 4 $$ LT"!"4``` TT!Xb@8`!""!#  #!p@vax 2  D4##'!?4#`@#`p?"  *p * 2 ##D@\ @|#Ta" @Q a@7!@ %@ @k4 a @  @  @7Ґ!@s #Ta  L  2 @ sa P a@ ѐ@  2#Ta` @ 4   @`@t  @@@4 "  P "`@N 2 Pא# @"a %sUsage: %s [-c1u] [-p ] [-lf lease-file] [-pf pidfile] [interface]㿘!#0Tb@7hTb8@7dTb@7`#c8@7\Tb@7XTc@7T@7R#@@7$@6#p㿘 P@  02  @!0@"` P"`, P@{@ PT b@tu # P" 4 P @ "8 P@a"`<㿘 P@@ PTD ", Pb@tW  P "`# P" 4 P @ @"8ARPCHECKcheck_㿘!x@#@ P  ! ` ,a`@ ap@ @  $@@@@ ې値` P`"  P "`0@a܀ ! P" c  P""` P c@   " P   @ @ "  P@"`0T b@s  P "`# P" 4 P&  @# 8 PD@ ",@ŐDHCPACK from %spacket_to_lease failed.㿀 (P ,@ @M P     !  #X@s@7@6J@ 2P@6B#h0r"`"X@?P aЀ "T@:pP`!"`P ` 6P#"`P  "@:ZP`"`2  : "P  "@:JP` "` 2`@ : @:@" P ` "`P ` 6P#"`P ` "`P ` 6P#"`P `  "` P ` #"` @REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.㿀 P`< `"`, P@ {` P   2 "" "("0 ,@ I P   b8@  P b@@  P a@ @  P " P@ P` " P"  P@  P!` "H@r@6 P@`" @5T P @X"`@ j㿘 P@@ P`D"`, Pa䀤 2 Ta @r  P"  b@r} # Pb" 4 P   "8 P@h"`  BOOTREPLY from %s rejected.h * (`P",f @   @rMȦ @rG@6}   @r>@6@4 0@DHCPOFFERDHCPNACKDHCPACK%s from %s rejected due to bogus yiaddr of 0.0.0.0.%s from %s rejected.` 0Q0N  a"@a#a"'Ē`@KƔ  2 (#  a@q@62  " @qې@6(@40  (`P",f @  @qǐȦ @q@5 2!BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSEND㿀!܀  (!#P` `,@ @KW !  #@qw@5Đ@4'P&  &  4 * @ w 2& P    2  `@K&  g 2 @ 2!@3#h0e 2P 0 $ 0P <` $ ,@ap@@ P b@?  4@  @J  P $P" P  #4 $P` 2"`@ 2@"@#$@ &@`0#@30 #@3Ē0 ax@F#@dhcpoffer: no memory to record lease. dhcpoffer: no memory for option %d Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.㿘@m(4 @3##{  @p(4 , 4@ "@mߐ  8W$ 8 @p@@ 4"*@ @  L, & ` @pj !Ԁ "! 2!J , "!@m A & $.# @@pP`, $* @@  $ 2! $@2ѐ#0 "! "J l @m & ( #@2#@0#h@2@  @p`l (* DHCPNAK from %sDHCPNAK with no active lease. 㿀 (P ,@9 4@IՐ /P     $!  "@o@46@2P @2" 0@P"@"X@P "`kNo valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %ld㿈 P'4ㄔb "@  @ߐ0 6 b 1   P`< " P "`< P < 2 P`" P#H@1Ӓ  P "@ "< P`<`@2*#h P <c@֐@L 2 P * P8  b  "8@x P: `8@V, $`8 P"f `8@$ P@f P: f @2`@@U<  $`88 2 P b "8 P "@84@ "@  "8?#  P2 H2 H P#`Hcp2`0`'!#@ P`8`@1  P #D'@#\@" Pㄒc 8@^No DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. FAIL㿀 P@@1t" P` 2Z P`sT P' I! "@n@2@1U Pb ,@ Pb@@` P a@X@h 2% P P   " P@"`@1+"@  P`  @Ք0"@1#Ӑ@#@58 P` "%@ P @ 2@ "@" P` "@ P` "`  P" 2 PT", @m "`  P"@0#( @c` P a@@ P "` Pf " @` @~@EXPIREDHCPREQUEST on %s to %s port %dx P!#4"@2 b $  P "`"X@0J 2 P< 2 P ,c@F@ 2 P P`," < P 1# @,b0@/  Pb8@ P a@@ @a P a@w@ P "`?08  b  "8@ P: `8@TB, $`8 P"f `8@$ P@ P: f @4  `8@T,< $`8 P`  #@ `8 "  "`8 P  # @$?' P #` 7//    2?0#42H2H2H'!"8@ @/쀢?" P#   P' @#\@!  P'@#\ @!  P#bX8@uDHCPDECLINE on %s to %s port %d㿈#cp`'! "H@ΐ`@/ P#D'@#\@ ޒ DHCPRELEASE on %s to %s port %d㿈#cp`'! "@㨐`@/ P#D'@#\@  ??c  /  @m $@m P %@m @ Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  `@ "  P&  @ " @ " @ "  P` @l|% Ȑ$@ `$@ `"`@ `" @ " @ "  P"%   @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @"  P"e Pe!+ !,"e P *`@ P *`A P *`B P@G* C P"`D P@ 2`H " P P2 J 2`J P " L P" P P" T P" X P @l \?c  /  $@la P %@l\ @? Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  @ "  P&  @ " @ " @ "  P  2 Pa ؐ$@ $!`4@  "`@  " @ " @ "  P ``2"%` @k% Ȑ$@ `$@ `"``@ "`@ " @ "    @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @!ך  P"e Pe!+ !,"e P *`@ P *`A P *`B P* C P`,"`D P2 H P`? `L`@kA`  P"`L@ϐ " P P2 J 2`J P " P P" T P" X P @k) \  / $@k P %@k @ Ԑ$ '  "  ?"   "  " a!$ '`4@   # @ ` "  "  " $ ' `"`` "  "  "  Pf -耢  $ f -'f - "  P& - "  "  "  P`@#\#`#d   @!<  P"e Pe!+4 P!,"e P * @ P *A P *B P* C P,"D P2 H P2 J P" L P" P P" T P" X P @j \P /ǒ $@k P %@j @ Ԑ$ '  "  ?"   "  !" a$'Ȳ`4@  # @   "` "` "` P#\`@#`@ #d P"e Pe!+4 P!,"e P* @ P *`A P *`B P@p* C P "D P2 H P2 J P" L P" P P" T P" X P @j@ \㿘 $ " (@g (  @g,  4  8@g   , @gwcan't create %s: %m㿘% !T@-!@wa $!@,W"#4``P " @{  `P`@p @`2`P#,``P " @^  `P`@S @`2`P@`jlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } p2 `0!B x `$ x[$ x`0 5 2!T!@Βa &!@+"@5;cX`02  "@52ch @5-cx!` #@iC@-@5`(@5c`$@5c`,   @5cؤ ,`4 U X, `8  @!! c@4,@5`! `l #\#`#@4#d@!`  `(l #\#`#@4#d@``Pl  #\#`#@4#d#@4`x@_k#script_init: no memory for environment initializationPATH=/usr/bin:/usr/sbin:/bin:/sbinscript_init:n no memory for environment initializationinterfacemediumreason㿘 : d P"f P&@e*  P"f P& 2@*א#X@Ԑ# Pf"@ P& 2 P@*Ȑ# P&c8"  P@  P@ P@ip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpiry P! !@h*@,w@c< M @@h<8' @h  @hh#@@+h 3! P !@g@,K@7 2#( @g @gP#@@+P # P a(@gڐ@,'@( P@@ $ PP@   P&  V 4M-  "  P O  $0M& `H@  - U X !`@*%ax P @g P8& @  U X-  !`@* a P8@gv P& @@gm,  4 8 UX-   @!   P @X @  ` @CL P@vREASON=NBIfork: %mwait: %mexecve (%s, ...): %mha@g  P& b   & b  TH''''@' !@P(̀   !@)A '̔@!@)8@e "@z Pρscript_set_env: no memory for variablescript_set_env: no memory for variable assignment%s%s=%s㿘@gq f,  @ 2fJ =2f@ "f@d!D 2  @d4$f $f@(#f" @gD@gA@g>@cސ f,"@f 2f@(ΐ#0f@g,@@g)@g&`h@Bz㿘& "&& &@c&"&  2&&& "* 2 H-2* _* H* Can't fork daemon: %m㿘#0 T@.pl  T"l@"b @(l!0@d @@\~ @\| @\z @Can't create %s: %mCan't fdopen %s: %m%ld 㿘!T!&@AƔ! !@({"P0@1a 2!!@(q"h0 @dޠ"@1@)PInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%x㿘 4.` 8@ @ @@`" h.` @P  #@() @  #8@(   #`@(T"0@@ @@ @@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@@@@@@@HHHHHHHHHHHHHHH@HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH@J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿐   N .А ( N   N " @઒ "N option_as_string: bad code %d \%03odhcp option too large㿘1B % `@&h!7L  y" @J  `" @@" @@ Ȣ` `'`$```\2 ,@ \,@ `,@`` @*L4,@@&e!1! rno memory for client state.no memory for client config.㿐5T@ y7@3!"0 @d"@ " <$@" $@" "!"!,""$T$@#p" $@$@ $@ $@ $@@ * $@  * $@  * $@ *$@ *$@  * $@  * $@ @c0 @!? @@ ܒ@&ܐ#4 .  P 2& @`& $ P@%#8 P @c&  P& 2`2 P%@`0 @%#X`0@c= P"&  2 P#؀`?Corrupt lease file - possible data loss!㿐!T@!!@㇒c0 @ ? !@’ @%!@3hardware address parameter %snot allowed here.nested interface declaration.expecting a statement.semicolon expected.㿐@ T>`I*`!p @,0@(  * "@@  *  ~"@ x *  s"@ m *  h"b @ 0``@3̒`0Z"X@%Ӓbx@20R!!@  "K&! @b!@0@b b  bbbb @30+@2ːb && `@%"@G0@ 0@  0@0@%"@2^@ ;@%"@2T,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,$Dlx,,,,,,,,$, ,,,,Lx,,expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal data㿐@i~   @:> .@ @4~ ) @R`:@%`: 'a@@bX  "@a0 """@$̰ @1expected option name.%s: expected option name.%s: too many options.expecting semicolon.㿐 @ݒ !!? & H  U X,  @o 2 !.@ ! @ ,"ۤ ; 0 `@$x 0 @$t@1G expecting interface name (in quotes).expecting left brace.unterminated interface declaration.㿐@!!!@F P 2& @w P& 2 L@ LT ?$ L "a@i { !@$+@00@$%!0@? } Pf @KInsufficient memory to record interface %s㿘#4  @ 2  #,  @z 2 @^ `  # @"  `@a @/ c,$"c,no memory for state on %s 㿘@]& & P @"ڒ  P @`& no memory for config for %s 㿘!@]̐"0 P"f  P& 2 P p@"  P"0&  @`Д P& @``no memory for lease. unterminated lease declaration.㿐@ {@#!@0T0@](4 2 @"! @`(4 0 * .`@$ 0'@ƒ?a }@u@`2`Pސ0^ ` ` PT"   P `  2 @9ג  2`  P"` ``P $`P/"  P&# 6  @9    P@#!0  P " P@"`  P"expecting lease declaration.㿐@>`:@*`! `0 ;&`0@!@"Ґ!@/0+&`@0 /0$`,@ 0(@/%&`(@/ܐ!&`$@36&`@32&` @3.&`@’`40@"#@/v@Ւ ;@" @/ll<|Xexpecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.pԐ@   !!? @!Ӑ" ;"J @.F @_B@[  @ ؐ"0@_7 @@ .'@@ !!?2 @!"X ;" @.r #@ 2  "x#X'  @Ԥ  Ԁ@2"ؒ"@!}0@[* : `2!L*` $@"Y@!@^Ԕ  $Ԑ;@^ @/؀ ؒܠ $@^ ;{@v!" @!8# ;" @. Ԕ @0  @]!Ԕ @0 є @M!Ԕ @0  @= !!? @ #( ;"p @-ɐl @̒c@ @ƒcH  /@۽cP @۷cX /@ Ӑ#`ۀ ; L@@ #x0"`L@` @`AK?@L@`A ," ;@ "0 @ "0c"@ @-{ @Z *`@ "` * @  2 @# * @ @]Q * &@,,,,,, ,,\,,,,,,,,,,,,,,,,,,,,,,@,,,,,\,,,,,,Expecting media options.parse tmpno memory for string list entry.㿐@   2 @ ,"@,04 ,* ;@W!2@]b8@  @'"H@] @]$$&@@7ؤ ;@ @,ːexpecting IP address.no memory for reject list!x@- @ܐ#@,0@Y  2@# @\ b,@ &@ $@ , ;@ @,No memory for %s.㿘@-p   @dfree %s: free on null pointer.㿘 @ 0@Y㿘ݐ(8㿘א%㿘ѐ 㿘 ˒  & unable to allocate tree cache for %s.㿘c  "c   !@p㿘.  "㿘 㿘. * * 㿘 㿘 P㿘~ 㿘x 㿘r$`㿘l 㿘 "^$ܰ㿘W 㿘Q 㿘`㿘Z㿘$ Qc&"c㿘G㿘A㿘;㿘5㿘/㿘)㿘#㿘 " 㿘㿘 㿘㿘Can't create addrlist socketgetifaddrs faileddiscover_interfacesInsufficient memory to %s %srecord interfaceno space to remember ifp.Multiple %s %s: %s %sinterfaces match thesame subnetInterface %s matches %smultiple shared networkssame shared network%s: not foundNo subnet declaration for %s (%s).Please write a subnet declaration in your %sdhcpd.conf file for thenetwork segment to which interface %s %sis attached.P  @  @) @ݰ @"!#4          2 ! 2!#4` @ m` 2@`2 ’a0) ` 2 !H@ah` @" #4$`L$@$`X$`\$`T$#4     ,` ,` ` @ @Z}`m2k @^  @"a`H 2  @W  2@! @  @ZY @$`H$` 'В@ZP В @ZJ@ϐ "7  $  @Z<  ` !aЖ @` `    !@`  $`  $  !a @` 2T w'4`^ `L @ 2`H ?$`L`H``L 2``L "0@?` 2@4$4$c,$@6"c,@Yޔ `   @Ш' ` b@@Y’b@T"h"@`      2  $ $   2 @ *@  2`L#4` `0Ő` @@`2`0@P@@*Insufficient memory to record fallback interface.fallbackparse_statementNo memory for shared subnetfallback-net㿘’a0 `1 &#@ 0# @Y˔ `#Ē`h @ f x# "`@ #  @Y #  "`㿘#4  @ ܐ@ ؐ # b@ b "`Can't allocate poll structures.No live interfaces to poll on - exiting.poll: %m㿘#d   @V], @R!h # @ 4 1 "h@ b`$"` "@ @4*`" *  * ?)#d   ŀ    \ 2   "@2`2`` 2 @!@?j"x # 2@#@" @##d `  Ŗ ` 4`  `\`2b€b b `b" receive_packet failed on %s: %sInterface %s appears to no longer be valid@!? #А@ $`j"x!@" p @ߐ X`@@& X   T ' X #Œ@̐  & \b" )!  '@X0 # @X*!ioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mP 0   @Xs @0a@X  Œa@Ð 4 A A20  T 2,   (@XS @s0 a6@X͔ j"x Ő b@ܟ & T` ̐  `   h`  '`' @W@8 "& 0  ( & 0 0@ Can't allocate timeout structure!㿘ch   "  2 2"ch b`  "`"@TÐ  2$ @#$ $ h`$ `  $"h"  4$  2"$h "b2  2  "hb" can't allocate protocol struct for %s㿘@Ts  Ɛ!@g#d$ "#d$ $ $㿘#cd  "$cd @T{ new_hash㿘ƒbՐ a   @WU!0 㿘  :  :2 @=add_hashCan't add %s to hash table.㿘 2@WlВ#H 2"Ɛ#X@50" ,  @ """@ delete_hash_entry㿘 6 2@WC*   &    @A  2 @0J 2 $&ǐߒ`0 2 㿘 ! 2@Wl*  @ "  2  @0 "  2  㿘   &%b 7$ɒ    _ "  @ 2@$@ !T &@ !%b 2  $aT`@  `@ 2@ $@ !T`-@㿘b 㿘b h`1 ` ")@@P "$@` '`@ @U@Ȥ @U@h @U  %`  @`2` No shared network for network %s (%s)Address range %s to %s, netmask %s spans %s!multiple subnetsAddress range %s to %s not on net %s/%s!new_address_rangeNo memory for address range %s-%s.No hostname for %sno memory for hostname %s.'L'D 'P$ @UP@ @ِL!ǒ8 #@UC@@!b bC$ b` !b;b" 23$ D @U L8 @U#@@ @Uh @U P @U#@@@4 2,DД @T@@ @| @T@5 @q @Tݐ@* @fȐ @  H @TːL  $@TŐ@ 22DД @T@ @C @T@ @8 @T@ @-!Ȓ  `@T@@ @T @T@D @T @T|@ @Tr @Tn@&'D`ȐU 2,DД @TZ@ @ @TO@ @ؐȐ @,**@T   "'  @6a-b @T. @T*#@@@@T L$ 0P$ ($ ,$ l $ p $ $ L L'H`L !H @    HL@'L@  @T@ @QL $ `@@@ @@z ` $ $'  2" b  D``@ -b V h  @SːL8 @SĐP#@@\ @S @S@А @SL $@S@ޒ " 4`%@%$* @*`@ `*` &"`` d "`d@Q Ȑ hPb "# Ȓ @Sp 8@Sk#@@$ @S`@ "Ȱ P  "" Ȓ @SH  8@SC#@@ $ @S8@n   Ȱ %ssubnet %s/%d conflicts with subnet %s/%dWarning: PȬ $ @S`8 @S#@@`$ @S@9 2 < @R 8 @R#@@ @R@! E <      =  "  : " `<`   < " @ : " @R@ @H !#ʒ !Тb@R@ #@@1#@  㿘%b  |  `"$$@ & &$b" enter_leaseNo memory for lease %s 㿀  @Rm@ 2 `b !˒  @R\@@@RS b`$`$@ "`$`` d$`d@ Lease conflict at %scorrupt lease uid.㿀`    2; 4# , $5 4 4" 4`4`"  4 8`82@+ 2 4 2 4 t?`t @ 2  u v@+ޒ`v " 4!˒  !h@Q@J@ݰ  @c 4 @@ @Og & <& 8& 4 t ? t`t @  v u@+`v " t@  " `(& (`4`"& 4`8 @@QÐ & 4& <`@@& 4`<& <&`4&`<@!`8& <`8 t& 8`h`t& h@Q `  ?@& `4 `@`"  `t " @& `" p"@"``" p "` p`2 p "` p` `2,"` pB" `, $`" , `, 4 , $" p& &("  & "&!"` 6 , `",, & ,`,@6" p&& "  &" & " p" `,  & ,޻ ޴@ Released lease for IP address %s`@Q  # 'Ȕ H!̒ " @P@E@Abandoning IP address %s for %d seconds: %s l` L   &  @Pِ#H'!̒  "@Pΐ@@S//'' 㿘b Z 㿘b R㿘b J㿘 4 8  b  4 80` 2`"`㿘 4 8 !b 8  4  4 8 & ` 2` "`& 㿘 v u  b  u0` 2` "` 㿘 v u #b` u ` `u``v & ` 2`  "` & add_class㿘ͦ3!@Pڐ@M{ %b !b*$ `#$ `    &@P&  @ & @P70 @P.㿘 b b %s: can't allocate new group㿘 ͐#@@OŔ$`Can't rewrite lease databaseCan't commit leases to new database: %m㿘b `"` "@ u   8  " 0 2@#p 2 u@`2` @Ԑ#Subnets: Subnet %s netmask %sShared networks: %s Last Lease:㿀@ xb `"Π `$@OZ@Β@4`8 @OP@@* @`2@ b ``@ ` " `@q ` "@@  @d`@`΁%02x㿘 "` 1b  1@ @+ $1b@O@O :,`"@ ,?  1b Βa@N  Lease %s%Y/%m/%d %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s `!Β  "@N@ @@ (#ΠؖbȔ @,Β@"@Ր , @!Β@"@ʐ 0 @Β@u# u! t vs# @l h΀`#@`Β#X@a packet length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02.2x:%02.2x:%02.2x:%02.2x:%02.2x:%02.2xfilename = %sserver_name = %s %s = %s㿈 @ ` @ `@ ```  @`` '!Ϡ @@`!' @@`!'!@@`!'!@א@ߐ ` `!( ` ` `! `@#\ϒ`l@ѐ!`ϐ!p@͒`, Ϣ ,` 8 U X,`  4   @ ϐ!@``,`@!%03x: %02xH  P */ @mϔP@)$@  *@ X@)$@ڠ@Khash bucket %d:㿘 % !,  А 0@4 " ` @&  2 ,/dev/bpf%dNo bpf devices.%s%s%s Please read the README section for your operating system.Can't find free bpf: %mCan't attach interface %s to bpf device %s: %m` Д 2@)6 @( j"x ` А!a @@a`@^!p` Hbl@M А! @PSending on BPF/%s/%s%s%s/㿘#T 0 & 4Т"   Ǡ  "Ж""@ Can't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %d bytes for bpf input buffer.Can't install packet filter program: %mListening on BPF/%s/%s%s%s㿀 'T& 0bq@Mj 6@ǐ#@  2 0@#` 0 bp@MT䀢 6 0@# 0bf@MI @# @I& < & 8@##TT& @& D#"D 0 ''bg@M)耢 6@ #T Ѣ @     "Ж""@͔ fallbacksend_packet: %mx\b('@ǐ  '#\@@``#\@~#`' 4 '''@L谒 @e"8㿀  @ D@2  D 0 8@B[ < W$ @$ D D @"@  8@ @K  @ D <$ @*`2 $ @37 $ @ 8@ 6 @ @%   8" $ @  '@  @  $ @"  ' 8@K~@  @$ @ $ @ " @   㿘  @#4"(?attempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %m㿐#b`耢  @ !Ҥ!8$`@ 2  @ !b $ @ l!@ ?c' @7  @ ^!h attempt to use ICMP protocol before initialization.icmp_echorequest %s: %m`b 耢 2 @ 8"h    ///'77/77Β  @C@^7b   @є  6  !'Ġ"@Ē@ J `?icmp_echoreply: %mp  'Ԓ%ܖ @Ԁ  /@ .#0?쀢`'  '' @JԐcSc㿘  4@J(Ӑ `X@$R  " &  `@d !؀  `l@T ! `,@K @option %s (%d) %s.larger than bufferMany bogus options seen in offers.Taking this offer in spite of bogusoptions - hope for the best!rejecting bogus offer.parse_option_bufferCan't allocate storage for option %s.Can't expand storage for option %s.㿘@u@`o`@'@`@ ',!TU# X, $#Ӑ! @ {8T## Ӑ & $#@ o!P@ l!x@ i!0M@ f!J&  8  4ӒaX  U X, @ !@I. 4#"@Ӯaؐ ? 2 U X, @ "@I@@@I@$@.:%@@ ` @ ` & ``d "` ! @} * 2 \ !* @8Ȑ 5*@  6*@   3*@   8 *@ !` `! !,8!(@IS `  !,8!(@IG  !YY!T`X@I?!T ?"Т@ y 2`@Ȁ#\#\#`@e X &`@I` T` *@  N`z 4 * * **?"А`@@H  ' @`l@@H . . $. @`l@Hޔ ?bА@' @Hѐ`,?`l *@ * ?`l㻘\'H'P @I$$ i P ,`"_` 2[` %@( S`` U X , J t ` A  `<`    '@ 4% H ޖ-* ,@@Hb@@* ,@@HX@  @@Ȧ`@Ppretty_print_option: bad code %d %s: Excess information in format string: %s %s: garbage in format string: %s %s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array \%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largep;b ? `' Ր!H@ 9  ,U`X .    a@jUX .   @+ @?* : `3=א"*` +;  @N@ @ y@ N@ @ ⴐJ  2`@ x t+?+` : @*?ِ t+`+?` ` `X` @ Ր!@ U`X .  `J @U X.  Ր!@ 1Ւ`X` @ Ք@ !p쀥@@ U X.  &@ !@: @J|U X.  !ՠ"@Jp&@ Ȓ&  @` @ʐ` ?* : `6*`א!(  5 "- 1  y" @J  `"@@Հ"@#8  `'`$```\2 - \-  -  @*L "i- "- c-@ ѐ'@Ԓ@g!ՠ"@@ ̐!ՠ"@@ @"גk$D!ՠ"H@ ː* : !ՠ"H@ * 2 @"U$.LՔH@" ՔH@" ՔP@" "XՒ"`@,$0J@ "h@G1@G.$`@  : -  @<ؐ`- @+ `@"1հ![\h\h\h\h\h\hZ\h\h[8\h\h\h\h\h\h[\h\h\h\h\h\h\h\h\h\h\h\h\h\h[\h\h\h\(\h\h\h\h\h[ \h\h\h\h\h\h[pY\h\h\h\WlX8X@X@X@X@X@X@X(X@X@X(X@X@X@X@X@X@X0X@X@X@X@W|X@X@X@X@X@X@X@X@X@X8X@X@X`X8X@X@X@X@X@X(X@X@X@X@X@X@X0XDiscarding packet with invalid hlen.do_packet`` @"06 (8@F9'''В@Eǔ '?'̀  " 'Ȁ Ӧ S ,    " @c  , consno memory for cons.㿘ؠ`  2&@ڐ && tree_cache㿘M h " " "" " " tree_host_lookupNo memory for host lookup tree node.㿘ؠ 2 @ Ȑ &@& enter_dns_hostCan't allocate space for new host.㿘آ!8 ƒ " @E辐  $@!H@ف$ $ $ $ tree_constNo memory for constant data tree node.㿘ؠ!Ȑ 薐 & @X! & @E& tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.㿘 `?2@; ,@ 2(``bV 2`@"`@D```@D``Y`V$``` F$`b" 2 @" && & tree_limit㿘  4$  E#  && &  tree_evaluate㿈 ' ''0 @3$ 쀢$    h  '  '@' " $$ $ Bad node id in tree: %d.㿘 "  0/ !0*!@A@1̐&@!h1#%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookup㿘)#@t@o} 2*j"| "   # #@@"#@;" #@5"#@0"#J < @ "  `,`@ 2` @FÐ @٢# 2   # <(& "&&&   @F,`@ @Cl` @62@#n&&@㿘" $@@CI &㿘 573P9&@&&c 8"!"cP*P*'#؁㿘 ? & @ N  &a 2)"a` P @ !P"c"P P "#!*ᤀQ cP*?cP*@ᤐ "ᤁ 㿘4:  y"    - "#L"cH@0Fy"    "#L"cH@06"#L"cH"*++ !!  #<  #  #y"    # "@\2. "#L"cH@m㿘a!#L #P"#8!##L"#H  #acP"c8 !$㿘)!  %L'H#$a!$!kL%!a #"#8H$L!$a$H$! !&!㿘? eof in string constantstring constant larger than internal buffer㿘  !* %%`@O!%!* `\`" %2@:!%!"a*!numeric token larger than internal buffer㿘#,a   x  y"   D  a@]  "aa* %%2@"%!"a*!token larger than internal buffer㿘!,!! z-_y"    y@]  "ay"   D "! !* %%2@#%!*"a@lways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class㿘N r#*  ?* : `ߐ#,*`  ܒ`@ !O`@ !F`@y !6`@q !=`@i y!?@aa sq!M ܒa@W g!@a @O _!7a(@G W!9@?a0  O!" ܒaH@5 E!aP@- =!aX@% 5!*@ap /-!I ܒa@ #!Ca@  !8a@  N  !: @a !a@ 2N  !ܒa@ ! @ؒaȀ !! ܒa@ΐ ް!a@Ɛ ְ! @a耢 аΰ!4 ܒa@ İ!a@ !@b !K ܒaP@ !b@ !%@b !' ܒb0@ !b8@x !@pb@ !H ܒbH@f v!A@^bX pn!1ܐ @Ubh ge! ܒbp@K [!b@]  2T ܒb@: J!;@2b DB!< ܒb@( 8!Bb@  0!b@ (!#@b " !N ܒb@ !@bЀ !& ܒb@ !G@b ! ܒb@ !c@ڐ !+c@Ґ !,c@ʐ ڰ!.c@ Ұ!2c @ ʰ!3c(@ °!>@c0 !J ܒc8@ !Dc@@ ! aP@ !cH@ !cP@ !c`@x !cp@p !c@h x!/c@` p!)c@X h!0@Pc b`!E ܒc@F V! c@> N!-@6cЀ HF!$ ܒc@F  ݰ ܒc@# 3!c@ +!(@` %#!L`(@  ! @`0 !5ݐ @`@   !ܐ @aP !tuhuvxwwx\xy,  ytyz$zz {<|D}~~   exiting.exiting. 㿘!#'H'L'P'T'X@$#H$@D#$@e !T" "@>E@4& ߒc @4! ߐ @Qc"  !z!c@ ^@4@ @3 ߒc @3  㿘!#'H'L'P'T'X@K$#H$@ߐ#$@ T"  @=@3 ߒc @3  㿘!#'H'L'P'T'X@!$#H$@ѵ#$@֐ T"  @=@3 ߒc @3  %s㿘j"x %`N m`@׳@ &@(. *` 2: .%s line %d: %s%s^^ 㿘#'H'L'P'T'Xƒ$#@#!cL#@$@H$@P!#$@q #$1#8@l cL P TcHU#$Q"  @^cPT" &@=>@3 #ߢc @3 #8@=1@3  @3 #HU`@3 cX @3  "c؁ 㿀@'@@@㿐  # c'@{ #@/ 1#c@( 1#     @ ?8" *@  ? @ (8"?(㿘@x<*@ * @`@'   \7///''777  7@ @;E   &#*`77ܕ277ސ  7ސ@ @;$  &㿘@y%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packets㿘@@5 `* & B]  3c  h&c@- 4h?cĐ" t&c[& @"H %&5и``  &1#Ԁ ?&#@-h 4??#Ԑ"xK&2&#"`m"` ` 6` !#Ȁ $#Ȁ 1#̒ &#@-7 4?#̐"#&#$#?@ 6Can't create dhcp socket: %mCan't set SO_REUSEADDR option on dhcp socket: %mCan't set SO_REUSEPORT option on dhcp socket: %mCan't set SO_BROADCAST option on dhcp socket: %mCan't bind to dhcp address: %mCan't bypass auth IPsec on dhcp socket: %mCan't bypass ESP transport on dhcp socket: %mCan't bypass ESP network on dhcp socket: %m㿀#   ?/7'  @ڵ  :! #?'c @  6'*!0'c"@  c!hc @  6!@Ȕ  6'!'  @Ә ? j"x -!  @Ø ? j"x -"(  @ٳ ?j"x -א"XSending on Socket/%s%s%s/㿘{cT`& 4  h     send_fallback: %msend_fallback: please consult README file %sregarding broadcast address.㿘 4 @ ? !j"x 3! aPfallback_discard: %mx   4&'ܒ @Q܀ !؁㿐@9  㿐@9  g( 3f+gf# g( 3f+gSf#㿐'@8 㿐'@8ܔ 3f g2`* *#3f g2`* *#㿈  @8   @9%   @8  @9 (7@@8  &㿈@@8 @8   .. eoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-nametmerit-dumpSboot-sizeXhost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadunknown-255unknown-254unknown-253unknown-252unknown-251unknown-250unknown-249unknown-248unknown-247unknown-246unknown-245unknown-244unknown-243unknown-242unknown-241unknown-240unknown-239unknown-238unknown-237unknown-236unknown-235unknown-234unknown-233unknown-232unknown-231unknown-230unknown-229unknown-228unknown-227unknown-226unknown-225unknown-224unknown-223unknown-222unknown-221unknown-220unknown-219unknown-218unknown-217unknown-216unknown-215unknown-214unknown-213unknown-212unknown-211unknown-210unknown-209unknown-208unknown-207unknown-206unknown-205unknown-204unknown-203unknown-202unknown-201unknown-200unknown-199unknown-198unknown-197unknown-196unknown-195unknown-194unknown-193unknown-192unknown-191unknown-190unknown-189unknown-188unknown-187unknown-186unknown-185unknown-184unknown-183unknown-182unknown-181unknown-180unknown-179unknown-178unknown-177unknown-176unknown-175unknown-174unknown-173unknown-172unknown-171unknown-170unknown-169unknown-168unknown-167unknown-166unknown-165unknown-164unknown-163unknown-162unknown-161unknown-160unknown-159unknown-158unknown-157unknown-156unknown-155unknown-154unknown-153unknown-152unknown-151unknown-150unknown-149unknown-148unknown-147unknown-146unknown-145unknown-144unknown-143unknown-142unknown-141unknown-140unknown-139unknown-138unknown-137unknown-136unknown-135unknown-134unknown-133unknown-132unknown-131unknown-130unknown-129unknown-128unknown-127unknown-126unknown-125unknown-124unknown-123unknown-122unknown-121unknown-120unknown-119unknown-118unknown-117unknown-116unknown-115unknown-114unknown-113unknown-112unknown-111unknown-110unknown-109unknown-108unknown-107unknown-106unknown-105unknown-104unknown-103unknown-102unknown-101unknown-100unknown-99unknown-98unknown-97unknown-96unknown-95unknown-94unknown-93unknown-92unknown-91unknown-90unknown-89unknown-88unknown-87unknown-86unknown-85unknown-84unknown-83unknown-82unknown-81unknown-80unknown-79unknown-78unknown-77unknown-76unknown-75unknown-74unknown-73unknown-72unknown-71unknown-70unknown-69unknown-68unknown-67unknown-66unknown-65unknown-64unknown-63unknown-62unknown-61unknown-60unknown-59unknown-58unknown-57unknown-56unknown-55unknown-54unknown-53unknown-52unknown-51unknown-50unknown-49unknown-48unknown-47unknown-46unknown-45unknown-44unknown-43unknown-42unknown-41unknown-40unknown-39unknown-38unknown-37unknown-36unknown-35unknown-34unknown-33unknown-32unknown-31unknown-30unknown-29unknown-28unknown-27unknown-26unknown-25unknown-24unknown-23unknown-22unknown-21unknown-20unknown-19unknown-18unknown-17unknown-16unknown-15unknown-14unknown-13unknown-12unknown-11unknown-10unknown-9fddiunknown-7token-ringunknown-5unknown-4unknown-3unknown-2ethernetunknown-0dhcpCan't allocate dhcp option hash table.㿘!%!$XX "`^! U, `XX , `" @  `@  U a"#X#5 㿐 텒 } {`V0 ; ` ` D0@?ޠsemicolon expected.㿐1 ; #XƐ filename must be a stringno memory for string %s.㿐! Ӑ# @0E@,  ڐ# @08 @ 2expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.㿐  ǒ !!? !  TH @/@,   `@/ @ֿ隐@/ݐ@쿒 .쓒 ."Ȧ@,r 2g ,@@/$@@/ @,@,@ .,@ 2㿘 &@` . @ @ expecting a network hardware typehardware address too longexpecting semicolon.㿐A!$" !K!0 0   .@ .@ .@"ǐ01'  : @|  & ( `@,"ݐ"` `.`@.` `" @@. @,  ;Ð#Expecting numeric lease time㿐! h0 @) can't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.㿐  `  "@1V & @+w:   l  Q!(b !릒 R } {"p5! ;"q m c`?Ӏ! ! !@W  @``: @.@+!  !`@.u @M(  )@0ߒ & @+:  @!@``: "@&@T`&`:`@+ $ @+ 2Bogus number: %s.Bogus number: %s: digit %d not in base %d value %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %d 㿘L@ -  `2(L@L@ 02# L` x ` ` y"@   ` `朗" x L@ `` ? @ /??Ѐ@01L@` *  *@ &       c !   W !H  !H %. 0!Ғ 0;0, !H  !H .ē2`00!numeric day of week expected.numeric year expected.expected slash seperating year from month.numeric month expected.expected slash seperating month from day.numeric day of month expected.numeric hour expected.expected colon seperating hour from minute.numeric minute expected.`Đ鲒! u 0 ;" E  @+'韒! b P ;" 2 @Ā'l'ܐ8'ܐ鈒 / K h ;"  x! ; ;"԰  а @Đ?'ؐd / ' ;"  T!  ;"  @'ԐA! ! ;" Ԑ @'А. : ! ;"  ! !H ;"z v @'̐  : ΐ! ;"g c ! !H ;"W S @t'Ȑ'' ;#X}B ܐ* @*`@*`@,ؑ: `  `?Ԁ`ȒZ*`!X   ?* @*`@ *`" * * "@*`@ @ *` *  * "@*`@*`" * 㿘@Qhaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): h'D@'H0   "b@P&@( @Qʔ ?@( ? "x @sb" @e @8@^  @Z,  ?@(Ғ ? "x  0@sb@ @( ?x#@+J usage: %s [-dlnpq] 㿘0 <z`p@W!@(L 㿘@ cannot seek temp fileout of memorycannot read temp file㿘#x{ !` !`  "aT  @"  =!` @* 6 @E S 'Zx  >%Z#ZcĠ  t$cĔ" @& 2c@* @  cĐ? $c!Z#Ѐ  @H #Ѐ 3 @{ / $x?$t $c!Z#Ѐ  @3 #Ѐ @f ! t@Ci  !`@  @ Ұ 0 >  Bt=!`+tline too longcannot write temp file㿘@&  @А 7 N 2 #&@+# +aT 'Ḓ @  6@˳  @Y!: %Z#ZcĐ , $cĔ" @!G 2c@Ʒ @!cĐ? $c!Z#Ѐ  @Ր #Ѐ C?@ ??%#0?$, $c!Z#Ѐ  @ #Ѐ "@ c,@#{c,"aL  @8 & @  &  l@w !  !J`@ T 㿘a4%P   9#1Z#Ġ`&#a0@ ٓ,  2#@I @)!#Đ? &#!Z#Ѐ  @g #Ѐ  ?@ ?$P?$a0 &#!Z#Ѐ  @R #Ѐ 4@ 4 a0* "  $4㿘.4 6%3;aa0. a4 aa4  ! a4 !44 0(!4  ! "!(@!!4ᜀ@ 0*``"ᜁ㿘!Z##`a0$#""#!4@ #aP#$a0? $#!Z#Ѐ  @ʐ #Ѐ @ rcannot open input filecannot close input file%lu 㿘N !`X@G @@ђ`X 2@n `@; 6N(? ! @HQ  Z#@忐  Z@S x@2?0#za   @al&newline inserted newline appended 㿘ސapZ@ !@`?8 c  `  #!@"8"!lRc`4&cĀ cĐ? K&c1Z#Ѐ  @) #Ѐ z?@\ v?`$`al @( cĐ? +&c1Z#Ѐ  @  #Ѐ Z?@< V?Đ? $3ZcЀ  @ cЀ "@( @N 3Z :?   z!@Oa8@  8   z!@<a8 @  "    %@"%@8c`&8  " out of memorycannot read input file㿘 +O-ZiaH  ?/#ZcĠ  $cᴀ" @ 2c@T @4 cĐ? $c!Z#Ѐ  @r #Ѐ ?@ ?%aH?%ᴀ $c!Z#Ѐ  @] #Ѐ @ ᴓ,*` "a8 " ? & @0  &  @ aH  ?#ZcĐ a $cĀ " @} 2c@ @͐ cĐ? 4$c!Z#Ѐ  @  #Ѐ B?@> >?%aH?%ᴀ $c!Z#Ѐ  @ #Ѐ  @)  2 !*@ @ @ö @ ? /ᴐ *@ "@ *8`!@` ?wcannot open output filecannot close output file㿘N !`P@E @$@ג`2@t X@2 6N+? ! @FV  Z#@Đ  Z@X p@7?0#za   @&  㿘Zc  `'@&-+)  p@ `a8 !@ *@ @ 6@?`@㼀   " cannot write file㿘"  !Z##  N@ڲ`  N@@!=` @ݐ @b?# unexpected end-of-file㿘!J "@W Z&?& ct ?+Z#ZcĠ  $ccp" @. 2c@ž @~ cĐ? I$c!Z#Ѐ  @ #Ѐ Ӱ @ ϰ %t?%cp $c!Z#Ѐ  @ #Ѐ @ڐ cp@bcp @`* 5?@ `*?@ &  #X@ J t@2`  ?%ZĠ  $cp"" @ƒ 2@6 @ Đ? $!Z#Ѐ  @T #Ѐ k @ g %t?%cp $!Z#Ѐ  @? #Ѐ "cp@r cpX@`cp@ cpt  = #ZcĐ cp$cĔ" @x 2c@ @Ȑ cĐ? $c!Z#Ѐ  @ #Ѐ  @9  %t?%cp $c!Z#Ѐ  @ #Ѐ cp@$ cp*&cpstdincannot read stdin㿘)z `  3/? %@忐 `  % `X'| >+!Z#İ  cX$#Ĕ" @ 2#@ @a #Đ? G$#1Z#Ѐ  @ #Ѐ K?@Ґ G?$|?%cX $#1Z#Ѐ  @ #Ѐ cX@ cX,`*` "a8` 2a cX&a*@cX ` @ ?@;#@# %᠐ ?6 ?6 +cX*cX%᠁%d \  \abfnrtv\㿘 @F "  !z"@' [ `@ (@    ^*`: \ `?"``  @  ` \?"`` * $ @ \N``"0@¹  "@?M "`   ]* @Ӓ ^ 2  0`"@   * $  @   82  0`"@   * $  @    0`"@   * $  @ ``N?"``  * $ @v J  `?"`  * $ @d  @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] 㿘[!X@ě!'HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-file8'D'H@@"PH"c(@  ZH J r`?Z"#/-'j%Z !Z)z+["$ x p"0 0 %< $#H!`@@ HXD@?• siHH*@'HD" 'DD`HJ@-DZ `"#"HH 'HD'D@E !Z $#ؐ @6   <      @ږ @ z$#@ @ @% `@a b@]  @Z b@V @#0  z"`@a-"hLzDZ +"cHJ@%H@@ H   Z#؀` )zHJ@!#zHZ#@Û zD za@"xH@J2Z"Z#؀`zt z ?%Z#z![75-Z+');   a@缔!X!< @@q. ?'ᤀ Z#̀`a@oxb؀ 2  bА !@瑖!X/  ?&) #X J  " ? ?5 @["!( ?@ & ? al@ ?a??+(a a&@ x^b!  a bА !@A!X0 a"А @6!XԐ a@x؀`h  bА !@"!X Z 㿘l"ah"#p"   ! !&#p$h$!J`,`; #p`;#!$al@" #p 4  &#p! !$h ?number out of rangeinvalid address㿘!l #y$aa"  ` aJ?`U!|*` €a`$ay"a `$a! @  ` 2   @  @$<#@r"h - ^2q o&  `2Ŗ - ^2d b?Yaa@ʔ  $<#RL"hGa . 4$aGl?@W / @ `? 9aJ@ `$a+a`$aJ``@$a  (?a ;p` $a"p l"a!pa ?!p@ "5?\   $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $  $ $ $ 4  $  $ $ $    4 X           $  $ $ $ X $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown command㿘   !y$!!"  ` *: `p $!  ȓ*` € J`n" `p`l   2  $! $! $! !J ` $!"!(`@@ xa΀ al @J Ӕ J`n" `p`l   2  $! $! $! !J ` $!"!(`2@bah@  &?@ 9l ?al @  J`n" `p`l   2  $! $! $! !J ` $!k"!(`2@ ah@  ^lap   2U$l0S!`Z#̀`"K?#p`A"!" @ `7#@ 4 J`n" `p`l   2  $! $! $! !J ` $!"!p@ 5  & ?@ &? 6L@?  !Z#@ L@  @ZJ#`#(Z#ג &ݰ?@?[["#""c#p`ɐ"!" @ `#@ "?L@ ! #@J`n" `p`l   2  $! $! $! !J ` $!"L@ !Z#@ @ #@-0!(`z#X!p@  ug G Y jG V` `& J`n" `p`l   2  $! $! $! !J ` $!;"(`%(( #p`," J`n" `p`l   2  $! $! $! !J ` 8$!"#p`" J`n" `p`l   2  $! $! $! !J ` $!ې"Z " "[JaX ҔaXz!@b0!`" J`n" `p`l   2  $! $! $! !J ` $!"!(`a@Qa@ /? al@   J`n" `p`l   2  $! $! $! !J ` $!e"!(`@!ha Z@ H !J a $!G" J`n" `p`l   2  $! $! $! !J ` $!""Na@ ђ al@  J`n" `p`l   2  $! $! $! !J ` $!"ah@ k   ?al@X )!h! #p`a`!p@6%!hȐ" %a # J`n" `p`l   2  $! $! $! !J ` $!"!(`@N@  al@  J`n" `p`l   2  $! $! $! !J ` $!c"ah@ ݔ  ] [?al@ʒ S J`n" `p`l   2  $! $! $! !J ` $!-"ah@   ' %?#p`" J`n" `p`l   2  $! $! $! !J ` $!"a<  a<j" 2"[  "#p`ߐ" J`n"  `p`l 2 $!!J ` $!"!`?Z#̀`q0!" @ `2##p`!p"a@}  J`n" `p`l   2  $! $! $! !J ` $!{"!(`Z@0ZJ##` L@ ! @e L@  @L# \#(#!N &T?R!p N K"a#')[#[-J` >!J`g" `p` "0+`9*`0&`r 0$! $! $!@  @@`nh% % ?$`! [ `2#[" !J@  ZJ` 2Z##[` "#Ā @   Đ? $!Z#Ѐ  @ s #Ѐ ɰ?@  Ű?@ [@"@ [ "`% Đ? $#ZcЀ  @ R cЀ @   #[[`@ ` &?!(`` ` ?$`` $``  ?$`%[J@ n" p l `2 `` ` ` "$!`l@ג ` J`n" `p`l   2  $! $! $! !J ` $!:"( [@[ `@ " al@ ()#!hWa !#p`a`!p@6%!h"$a J`n" `p`l   2  $! $! $! !J ` $!"!(`@@Ԁ #p`ؐ" J`n" `p`l   2  $! $! $! !J ` $!"@ !J`q`Q! $!?!" @ `#@t #p` %p p"!"ahp@  &? J`n" `p`l   2  $! $! $! !J ` $!^"ZJ##` L@ ! @O L@  @L# F#(#W##!h a* 3p/"!!`+Z#̀`'`q%#?#p`" J`n" `p`l   2  $! $! $! !J ` $!"Z"c!l "h@^` ! ?ϐ ! @x  @<#@ [/"h[" ϰ?"  J`n" `p`l   2  $! $! $! !J ` $!"![ap@  @  ? J`n" `p`l   2  $! $! $! !J ` $!m"#pc!!p@9Ր 0a#p`X"@ U J`n" `p`l   2  $! $! $! !J ` $!/"؀!!x"@9`!x@S Zc̀ "@9 0!l "h@` a @  ? "#x_?0L0000000000000000000000/@000000000000000000000000000.t000000000000000 4!$0000*0000000000X`x||pL$0\!$!#()@*,<0-㿘#p`"!h"a!ha 4  !p  Ӑ"?no match㿘!l3?1?%)`p  ?,p al~e !8 ` ]   @   alڀ` "?filename too longout of memory㿐!J@ 6y$aa"  `   " $aJ@ !`@}$a ' !!x"@8k`c!x  #M[ '[ 9%[1Z#Ġ"`&#@  2#@V  6 #Đ? &#!Z#Ѐ  @t #Ѐ 6 @ 2 $?$ &#!Z#Ѐ  @_ #Ѐ a@ a'J@ [! @a`* '#!J@ !*@@  shell access restrictedno previous command㿐Z#Ȁ`' "x + `"a ?[ a   >-[%ZĠ  $Ĕ" @ d 2@Ԑ   Đ? $!Z#Ѐ  @ #Ѐ ?@% ܰ?%a ?% $!Z#Ѐ  @ݐ #Ѐ @  !*@J@ i /  57J@ !T %a  < !Z#Đ $#Ĕ" @  #@ b#Đ? $#1Z#Ѐ  @ #Ѐ ?@Ӑ ?%a ?% $#1Z#Ѐ  @ #Ѐ !@ ! *@!J \%! *@'!@ Ja  >!Z#İ  $#" @  #@,  #Đ? 7$#1Z#Ѐ  @K #Ѐ 9?@~ 5?%a ?% $#1Z#Ѐ  @6 #Ѐ !@i !  *%!x 3J  2L "a  =%!Z#İ  $#Ĕ" @ i #@ِ #Đ? $#1Z#Ѐ  @ #Ѐ ?@+ ?%a ?% $#1Z#Ѐ  @ #Ѐ x@ xL  @:i![ @`*axL@@ \!ZJc c@= @9a  ='!Z#İ  $#Ĕ" @  #@| ]#Đ? $#1Z#Ѐ  @ #Ѐ ?@ΐ ?%a ?% $#1Z#Ѐ  @ #Ѐ @ ?? '[ @`*@??'!`%!J` )! C3%ZĠ  ax$Ĕ" @  2 @"   Đ? ,$!Z#Ѐ  @@ #Ѐ .?@s *?#(?0$%!?&ax $!Z#Ѐ  @& #Ѐ @Y @ axax"!L*@L@ ! % 㿘z  `"al /-'Z( # ?" ` X J?`  ` ?5` u s?aN   J ` "᠔" N .N  X   $!ZĐ #Đ? $#1Z#Ѐ  @ #Ѐ ??@ ;?!l2!l$ @  #Đ? $#1Z#Ѐ  @ #Ѐ ?@̐ ?? " $!Z#Ѐ  @ #Ѐ {(@ w( 㿘!p    @T%3 ͐ )`! @ =/[%ZĠ  $Ĕ" @  @ `Đ? ~$!Z#Ѐ  @6 #Ѐ ?@i ?%! ?% $!Z#Ѐ  @! #Ѐ "@T `@ ܐ`@@@ % ` >/[#ZcĠ  $cĔ" @ \ 2c@̐  ﬐ cĐ? 2$c!Z#Ѐ  @ #Ѐ c?@ _?$ ?% $c!Z#Ѐ  @Ր #Ѐ @  * * @F !Z<?#Ĕ?`#$al$#Ā al @ ##Đ? $#!Z#Ѐ  @ #Ѐ ?@Ր ?? " $#!Z#Ѐ  @ #Ѐ  @  㿘!ap   !h Z ZcĪ   "c"alS @g  p   @[ cĐ? %c!Z#Ѐ  @< #Ѐ N?@o J?㷐h 㰐㭐㩐㦐@!l$@" "@h $$$ᘐ" "!(`c@c? " %c!Z#Ѐ  @ #Ѐ  @&  㿘!!hj !ha " ` U"l S`& "N  E1Z)#Đ`@ &#Ġ #l$ @˔ #Đ? &#!Z#Ѐ  @ #Ѐ )?@ %?#Ē ?%! &#!Z#Ѐ  @ #Ѐ @ʐ  l   ` 㿘%ZĒ $Đ @ )Đ? $!Z#Ѐ  @h #Ѐ 9?@ 5?!p`@  ݦ?ڐ!(`!p !p&@Đ?$" $` %!p"l#!`$!Z#Ѐ  @4 #Ѐ  @g  㿘 ڐ"$?!p`@  ✐@" #~ `$al Ŗ &?@@ invalid mark character㿘yb` `#h?* a 2"a "a" 㿘yb  ` ?a*3@ ~#h?!   ! "!``$ 㿘@     ":@o  O  㿘"  N \2 `?㿘'[ 9)[!Z#Ģ"`$#!@֒ 2#@F  & #Đ? $#!Z#Ѐ  @d #Ѐ . @ * $?%! $#!Z#Ѐ  @O #Ѐ [@ [N`\  `* !* !㿘Z#jbx  Z?А * @"@$bx㿘Z#jbx  Z?А * @"@B$bxed.hup/ed.hup㾘Z#Ԁ`ZB ZВ? #ap* * &"##H 4  !#( @ V  #( @*cP @ap  @ 㿘Z#Ԁ`Z@ ?В *@* "А#0@?㿐Zа? **@!j""x`h @ \  `[" `[" $"x..㿘Z#Ȁ`" N ! a@ @I /   3"x invalid pattern delimiterno previous patternout of memory㿘J@  2!x `"J`   ![" :"!5"@C [. " [ 耢`@ [@Q   $"@ ! 0["`"@ B " "[X@!'"@\ $"unbalanced brackets ([])trailing backslash (\)㿘!L@! ` "a#* :  [ \  L@q   `cL Z L@ ` * a)[$" >'[#Zcİ  ℀$cĔ" @* 2c@ z!cĐ? 5$c!Z#Ѐ   #Ѐ 2  . %"?$℀ $c#ZcЀ   cЀ a֐ a@_*@!8 %a#(B ℒ  J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] number out of range㿘&@&#aJ a"!X5 @D a0?J` @ (&a $aa @ϐ  @  @<#@$&@ʐ"(&@ ?*:  g2 `$a & no previous substitutionout of memory㿘a "aJ % J*: @a!!t`%aꔐ#P!t%aa*J :` %y)!` 7 !Z#Đ t$#Ĕ" @ 2#@ l#p#Đ? $#1Z#Ѐ |  w#%!?$t $#1Z#Ѐ   #Ѐ ΐ  t* *:`$᠀` `J `\'a t**@: $᠀ `!(`az `! ?6  " #XJ?` 2 &M a=J@ !!` =!Z#İ  t$#Ĕ" @ 2#@ #p#Đ? $#!Z#Ѐ  4 #Ѐ  g  %!?$t $#!Z#Ѐ   #Ѐ R t"!X*@tno match㿘!hla   "l u +Z!l` |&!l@ &{?]!l l gc!`%c#Zې cĐ? W$c!Z#Ѐ  А #Ѐ X? T?!lI!l$ @ϔ cĐ? 7$c!Z#Ѐ   #Ѐ 8? 4?cĐ? %c!Z#Ѐ   #Ѐ !l͐ !l!ah"@ !l %!l``8# ?`!lQ ? infinite substitution loop 㽰Ԑ   / a8  ` Ŗ `'  @v 1-+`  @c   [$D >#ZcĠ  a$cĔ" @y 2c@ ɐ#pcĐ? $c!Z#Ѐ   #Ѐ ?: ?%D?%a $c!Z#Ѐ   #Ѐ 8% 8 $ T a@ @ʒ S$ð?D = #ZcĐ a$cĔ" @" 2c@ r#pcĐ? $c!Z#Ѐ   #Ѐ ? ?%D?%a $c!Z#Ѐ   #Ѐ 8ΐ 8   a@N$ L >"D  = #ZcĐ a$cĔ" @ː 2c@; #pcĐ? 0$c!Z#Ѐ  Y #Ѐ C? ??%D?%a $c!Z#Ѐ  D #Ѐ w   $@2 8`!?8  ݘ a@a !@*@! @*`  㿘!Xat -+/M &A \` `D" , %ZĐ a$Ĕ" @L  @ 睐pĐ?$%D?%a $!Z#Ѐ  ֐ #Ѐ @  @ ᰢ`*@!tND M 0I 94H?Ѐ4D* @  D"@@ , %ZĐ ab$Ē" @  @n OpĐ?w$%D?%a $!Z#Ѐ   #Ѐ @ @= ᰢ`*@4!t *#ZcĠ  $ca" @ c@1 9p%D?%a $c!Z#Ѐ  O #Ѐ a a  *@!t aX% &:MD ? #ZcĐ a$cĔ" @ c@ #pcĐ?$cĀ 2'?!Z#Ѐ   #Ѐ ?I ?%D?%a $c!Z#Ѐ   #Ѐ a4 a*out of memory㿘%[#[c![  #d*@  *`@@$c  $#*` * "\ *#@ *` "S *#@ *` &  $ @ u#@а @#$#$cnothing to undo㿈[ al p? [c? T ?[c   "a ZcĤ #  "cĀH[(#@*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?„# 2  : *[#2(@*`8: @@('`'`*'  #@ #` #`# # # !(`%#?%l%#%ap$ $1Z#Ѐ   #Ѐ  +  㿘[c  ??!"c )[c * @*`#@  @ ``@  @@@ ??$ !l[!p$ ["c"#㿘@2HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s@NJ `@* "c'4  /#!+z';%9'0+8 *&* @€ '4   '4  '4   % $c$#``@R`$# $c $㤐 'c@@?Ґ?iH* & @ @c    `@  `4 `@x    2 @K?"c@6 * 2 #'#@6`. @@{#[a(@T Ȓ@@m$ .[*Ȓ`$,`0%`&@@ݑ? jbx ?a@@K0 <  -  ?@5?% c 2 @  @ @e@@@P@<  2    c " @@=mn@n@n@mn@n@n@mn@mn@n@n@n@n@n@n@n@n@n@n@n@n@n@n@n@n@n@n@nn@n@nn@n@n@n@n@n@n(n@n4㿘@7q / 2N  2  N /"?* N /2? %s: %s%s: directory causes a cycle..%s%s: name too long (not copied)utimes: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read(@b@   @Ja 1-j " ` `0``!`@" @J `@J"( ;)[T`6 2``"`$m``" @abH "``[J`$`/"L? / /, [cȐ$#  ,"P@Jo   @4$,#Ȑ@X?`8 `@X  2&`@#`<  #`@'`@@'`@# '`@@$'@(k "x@J0 @2`"@J#`@<`  @ 0<      `"@J#x  < @@ @[@O0`@K(@[@iZ #`#` `@Iې"@ I #a@۽ a@@Ii <  " ΐ j["xa@@IY #` `@@ 2! #`@@1y0#` @z #` @I @5 2 @! 2`8x c@I$ 8  " @8  `??%soverwrite %s? 8` @6 2`@`@I   ` -[#``@LȀ`2G#`2B#`9z!`@!Ȓ?P`? "`@a ?P  $?P ? y#z```? &`@L``  $``` 2` y Y@|r Ȓ$ Ȕ &@?2 @H'# )@@ @@  @HȰ ` `@H   @C@@ 06#`@ʒ 2#  , # @ @ @# o*@ @"h  @HlȰ @@  @HaȰ readlink: %sunlink: %ssymlink: %s㻘  @'#?`  ,@ 3[c@x   c@"5  (@H0 0 #` @ @mkfifo: %s㿘` 3[c@P   c @  @H   #` @9 mknod: %s㿘` 3[c@(   c @&"  !@G  #` @ utimes: %schown: %schflags: %s㿘 !  /6 $# #@Œ#$  #$  $@#[ "`cȒ@&  "8@G `  @%   j#j  @#j j"x`"H@GȠ  <! @6 `  @!v   $bx@/{Ȁ "H@GsȠ $bx` D@ќ bx0@Ȁ  bx - D "X@GYȠ lchown: %s㿘[# @1  j"x`  (@GB  usage: %s [-R [-H | -L | -P]] [-fip] src target %s [-R [-H | -L | -P]] [-fip] src1 ... srcN directory 㿘#0!z!`< `@5`< @0`@% 㿘@ʔ Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r㿘#!z !!a88@!p file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s 㿘#"z""aP`!h@!]"` "#"@ax  2㿘#"z""aP`!h@!]`  `#"@ax  2Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H DYN_ALLOC 㿘#!z!"""!haP`@Ƽ"""⠒bx@ƴ"b@ư"b@Ƭ"b@ƨ"@Ƥb؁.exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -S suffix too long %s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' insufficient memory㿘'H@'DH!@@!@&$#Ġ  c"?@-cx "cĐ*?"H@!#Dހ "`PH]"  @a  @ ݀`"#0b@V  @S  0b@M  @J  0b@D "cĒc@x   "cĒc@q  c] "`L" @c "c@ޒc #ސ ]]"`L"H#ޤ`X"c @w@!$ |#]/]%]1]+")]5_9];7]`Ez$#8*` € v$`D_@ubX]p"`t] l"`H] h"`L]`P c"`P ]]"`H"LZ%` U$XS$X & TO$X$XL& T] ]" hF"d] B"`\!_@l"X  $|cz"c@Œ!o@ t "X X@w+,  ]]]"p"`H#"L] d]`" d"h@ Z Dcz"c@l!I@ N  D]" |?@ D D Hc@*? yX  T] L$X T `D] L& T`DD \ " ] h` |z#cĐ!@5`|  ] L` $  l_bXzc#!@"`H@   l   ] L`2 E"T]"b @ @ 'c#@ Z h@|ۀ "cx#@ Q h@s@܀ "c#@ H h@j@ۀ "c#@ ? h@a܀ "c#@ 6 h` ] H`] p`\` \D@6`"\* H $"\@@ "\D@"\`@`  ] h``?@-?@ hhhhhhhhhxxxxxxxxxxxxxxxx(<Txxxxxx xxx8xxxxxxxxxxx 0Dxx`xxx%s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK 㿘] P/]`3-]` 0]Lz` ` X@R  $#ĢLz%  Pa% % L " % #8 @c%!@ `@  ]`p  ` ! !%`ؔ!    + `+c c*` ( * *` *` *` *``***** %c] X`2ݠ#zR`n@ %@  %cې?@"cL] "H "c@cp] "`x]@ `` cp]@"x0A#z !]@lcp] 9"`x"#``Rf"R /L  #`c̀] d` p z%!@`0L cx!z!" "@@$"@kb؁-%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s8'D&``@ !] H$ H#D@p < @ 4 ] \` ]X? (08@HP#?D?????????@ ?D@0| h`B]#&zܐ!`h@ޖ7]@] h`0]#&zܐ!`@̖%] '1] H $]] P`]] h`]z#Ća&܀  Ȗcؘ?  s@¨]` 5 3"`] X# 4ۚ#"] ``   H #@] ``] p`!! ! ` `* `*  `*  `*  `* * * @9 ܢ#ؒ @T!ۤ ?"cp#&z`@Z!@] "`@] Lݬ"c@p]  "`x] ``] x@p@p0 H  zR "` !"5]@ L'ހ !5]# d #] h` ##&zې!a#@c# d] T `?$#d zcب!&a @͐   @Ȑ &!(&!0#8@!]#]L #`c̀@p  $ x"#bp€ ?$ x@Rp H`  x@L  x@_ x? d H G@ː#0C < H]`p   !z&a8@!`pL cx!z㴐" "@@J!`pcx!z" "@@=!`p  " H  !&ےa@@z!"!@vb H @#%s: %s: warning, name truncated 8'3]-]+z)/&5(@ p@ 0L۠# &`*@;!#ހ? $`@rp@ΰ :%@ #Ē@9a@bp@뾰 @`@H&%@ ]  L`] h`]#ĐaH@]`     "`@`@%@0㿘] Hj "bx] P`@0@_z-z-gz.tgz.taz.zzp](` X@b` "@  А@E $&@@=@o@@@ $@?M`/" @$ "@  .Z㿘 |] b @p$"@ *j ?"bx#ؒ@ :] L` j"x`  @ ] '"`@Fި"c@O X "`'] @@*\ `@ . X@@$  %s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged 㿘!ܢ##ؒ@J] L`K -]`\   ] ``2h ] p`2c ] d` ]\ 2Z ] h`2U ] h`B]#)z!`@#8]@(bH@א (bP@ѐ 26.)  . .  .  .  ). !] d` ] \`]] h` ]#)z!`@ǘ]`     "`"#@~`X %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored 㿐] P`] H`#ܦ̀  #Ԕ @ $@\ /#̀  0#ܦ̀  #Ԕ @ $@E /#̀ #Ԕ @ $@7/c]?ۘ "x )x #cc( x @ڔ   )c0@Ӕ  *#̀#Ԕ @ $@  $ x  #)zܒc8!@–]<ܐ!#] "b#Ԕ  @ $@  #)zܒcp!@] "`ܰ?#)zܒc!@`P] "` #)zܒc!@ `P] "`#̀#Ԕ @ $@ #̀ #Ԕ @ * $@ * #̀ #Ԕ @ * $@ * #̀ #Ԕ @ * $@z *  ] X`"##̀@`$@f #̀@`$@] `,#܀#Ԕ  @ $@O #̀ #Ԕ @ * $@@ * ] d` #*zܐ!`(@ ? #̀#Ԕ  @ $@  #̀ #Ԕ @ * $@ * ] d` #*zܐ!`@@Ƙ? ? #̀@`$@ ??܀`K] T`2!] H`] ``!耢 !#̀#Ԓ $@А *  *`@I# #]ܐ# *@ѐ p#̀#Ԕ @ $@ *`,  `` `2$```!#̀#Ԓ $@ 耢 2h xܐ c&`x @=  *܀ 2`cԔ @1 *<!]"b$@D 2l? B$`@   *K ] "b4& x`@   *E #H]"b$%& x`@   `PI#]  "$& x ] H`] ``2  xC!] "b$$& x x %耤 ]#*zܒ`!@ܖ]:"` h` ]#*zܐ!`@̖]` ? "`deflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s 㿐] `] d`",@# ] h`23,@#@.,] ] ] d`,#p@  ] h`,#@x `xz` " @"@,@l#0~#ݠ? "#`0"c#`,۔??@Ŗ  "$c$c@ה  "@* *+`(+  @  *@ $@T# * ] d` .`]" ,#@",c@#c ]]"  "`x$$c` ސ "`]]" "x$$c &c "czx" @"@,ې#@c `/ @* `% `   ` 0`0 4`4 `  `  (`(`? 8@b` @?` ?`?` ?`(?`0?`8?`@?`H?`P?`X??@w, 2,@ ,name too shortcan't recover suffix .internal error in shorten_name㿘@ ] L `  .@ ha*?X 2,.@ x,ې "c)`@? ( "H"H,? ,? ,? ,? ?,@%u /  L `%.@Ғ?L 2 L ```  `* ,@``@%I . 2L`.@8 L` "ސ@S`X%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten j""x% ?2 W@ʩ bx]`L    C@ʖ  ݐ#Ò 'ܠ#آ@b #zLa."%  #8  @m[]#.z!b@cQ]] P`<."zܠa#Ħ 7H.b@Oc؀ ?P@0T`  .b@B@H@m Oy"H ` Y.y .c @*]`   @8  #&z`@!@>] "` 㿐` `''@7  <`  1] h 2 ]#&z!@`]`  h "` h @#%s: time stamp restored 㿘] L`%#  ] d` & z/!bx@” @ o #]`h 2 ]#&z!@`]` `h "``h 2 @ʐ @ ]c" @ !] h 2 ]#&z!@`]`  h "` h @%s: %s unreadable ..%s: %s/%s: pathname too long 㻘@ 3]#0z` !@Z] :"`/.-0+z.)0@/ (@*8 #@@ #ܢ@  /,@ @@0 #Ē @a@' &`@- Ѥ @㿘]Ā !@  P `"@ꨐ $ P!] "!@$ !#Ԁ "!@$#!#x "!@$#x!# "!@$#!# "!@$#!#Ȁ @x$#@ѐ㿘] `@\`@# 㿐"#p#x] #c"`"x77 (#x #c *  #x #c*c  x ` #c  *@   x $c+  x$c2` * $c#@ #`x`* #$cx2 *@ $cx`#1* @$c@#c2 x* `@$c@ @ "c@ <  x@]`|@c1 x*@ $c@c x*@ $c@c)݀ +@#ز# x*@ &#@L  c@%`xc# x*x$c2 *@ $c x1*@$c@z c2 x* `@$c@oc#@ `x`* $cx2 *@ $cx`!* @$c@Tc2 x* `@$c@Ic## x*x$c2 *@ $c# x1*@$c@, c2 x* `@$c@!c#@ #`x`* #$cx2 *@ $cx`#!* @$c@#c2 x* `@$c@`x  @%`x㿘cp@1?  @cΔ""cbad pack level㿘? 2@ 8c@"cؐ @ ]b̑. ```!@$# #cЀ "@  @ 6@#"c@"㌒Π`"#Ѐΐ "c $#аa"# #@#Ѐ!#̀ #c$cȔ  *  "ȁ㿘ܺbㄲ &@ a0`ܚcВ!Ȱ] X @S  `M ` &~ @6'@` @/'@` @('@` @!'@` @@'@` @'@` @ '@` @"ɲ`'@"@ ۀ  | ( 2㿘]"ۤ "@"@  ?@)?";)c! @ꄔ#|"@c""##|@#c$ ȑ+  @ 2@2@  #  ȓ+   2 2    @#̀ cА c€ ?А %#̐ $Ё㿘#Ъې "c )5#'΢/;9@c㬖 @Ȓ@ `*  cȐ * $Ȓ@ @*2 cȖ㌑*  2#" b  ڐ cа 8 C#|?#@" cԔ" (%#㌰? @㌰?# cȒ `*  ȓ* #cȒ@ @ *2 cȑ*  2c #㬒@%#  $Ȓ@ `*  $㬐 c@O c %$c``  c @Ò" c&cЀ!c̀   cЀ!#̀ cЀ fc#@  # @" 㿘#ؤ ` 8#Ь)ۀ`57Π3;@+9ۦ##c @ Ȓ@ `*  cȐ * &Ȓ@ @*2 Ȁ ۖ*  2%c#| #c@ #" b c  Т@ 8 ` c##|" 8 cL@ J# "@@c " #1@ۄ$%cc cȒ `*  cȓ* #cȒ@ @ *2 ccȓ*`@2@ㄐ? ##  $# 7 `c  # @" #(%㼀c # @h `c  # @" #%#А $# $# В`?$#$Ѐ!c̀   Ѐ!#̀ Ѐ <###  @, #@  # @" 㿘"J"c"""Ā "]# ւ!      +  #@ "(+@ ?` ]#* ֲ",   Ք * +  $ @ 㸱**@ ?  *"; ]#ւ", *Ն + "?,  `@ ?㸱(!*@?  $Ґ#\ 2? 62Ҙ!ʔc\  .   3 2 !Қ#\`aʘ .  2@  3`!!Қ#\`aʘ .  2@! 3`!Қ#\`aʘ .  2@! 3`ѐ!@&!Ҳ"H  6`@ђ 6@  `@΄#t060фԆt060҄H060 (#2$   (ⴝ㿘Ҵ|p.`.`5Ոx +.(`@./`@/ *  .  ..#|.  c|.`  .`.` 'c|.` 㿐  #\ '   ' 2? 62 tҒc|*@ * @"<;2 Һ#\97ґ- c|@,`@* @ `$22@ 4 . @   @7@ $@* @@@/"@ '" @%@⼒@&⼨ "<ҀH҄#\-. ` \?. `"?.   ?2 *   2  2 &Ҳ#\/ґ. @`?|%ڨ?-  `* @  " @ @&@$4 `2?. x҄ #\  ** 0  ` ` ` *` *4 @2 6 㿘`@` "=   "`t?"p5՚ x| @ "2`*#+@  ` p p *2 -+#|b`x p  * @  p "@ "@ ?* 4@ ,  " p p%b% p2  :   &`? 4զ#|`x/-p* %p$ t, * $*$ @ +`@ %t ,4@ @ @ @` -@+`@, 2 @ 2`$h  p Ӥt|*`"&t>㿘 ?      .`<`;0Ҷ ``@"-@.6 .6@ 6@` 4HD6D6H        Ͱ 㿘 ?      @PҪ"`*`  @@` `Ҧ",`@32$ `@ ,` @%@ `@@"`B@  4 `H`D@`F@  @`J@      @    @*`㿘^ pR#^ M ^ ^   " *`  ڰ?  " * `"?" *@   #"㿘>@Ȓ @Œ @’  ^Ҥ b  *@ @ & ΐ#X?ѐ Tblock vanished㿘b c"* ?#@2^@[^J X^F tڠbڤ ⸐ "Ĕ 2 2@ #"Ĕ`@   @k !",` ? $"@ 0' @Y Ґ!@bHb @M  X`t  {`ѐ#@`b b  "b"@" $""6 㿘#b *   "bΐ#.` ڒ`92 Ր" Βa*` ? 2 ф Ԁ  *`> ! @* `Ԑ > ! *`@b`#0 *2 " #b +" b"* `+b ""* ` "+b+"] |`$"/2""#]`Ԧ" #+   @!`@? "b2 6`4@  "#@ "  㿘" `  N ]b# նa#]ִc",֐"  #Ԁ @ ,`  @r*@* @j`"@c$@#-` * 2 `` 2 ! * @ @P@`"@I$@b §4$@A$-l used on binary fileΖ   *   @  Ζ*     2Δ*   @ۀ `?2 0̀?"b1 㿘bА "= !#. @ # ̀2 `x*@$#x2 *@ $## `cx%*@$#@ [#2 cx* `@$#@ P"А " . 2`:@4 %"̓.  2#bЁ 0`* 2 㿘ڨ"Ѐ 2!##ې cx*@$#cx2 *@ $#. ڐ #cx%* $#@ #2 cx* `@$#@4̀ '#x۔c *  #c@4%"Ё㿘Mc#@ x`* x$#6`* `$# #x`*@ #$#@#6`x*@ $#@## x8*  x$#2`*  $#x8 *@ #$#@#6x* $#@5#!cx *@ &@ %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip 㿘c#"cp**@  ` #̐ #c**  @ * @#P@ " #;z%a]` " x`#;zaސ   "`T^2  ^ "" #;zܒb!@] "` out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged 㿈"#p"` @O ^`Ȯ   5^̀ ]# ` `*  `@ `( `( `+  ` ` +`*  ] x`@  ;@Y#q77o9;@Q#kȀ b`a<cԨ  *` @ ( ( *  T@ +`*@  # #z `; `( `+  ` * !c@Ɣ<@  ?793'!%# c̀#Ԓ &c@ #* `@$#@ ?@<@ 079Ȁ &̰ !%ܲ##̀cԒ $#@ .@  #* +`(*@ (쀢 ,x !%ܲ##̀cԒ $#@ .@  #* +`(*@  + *`  x@W @<@ P#<@ xȀ D#c̐ =#Ґ@ #P * * @@  *` 2-%] H`] h` ]#<zܐ!`@]` 2%Ȑ "`#<zܒ`А!@] "`%& %&̰    'H\'L'P'T'X????????'*`  " H  X "4"@ `   , `" *`@   ,``"8 " *,  @   /`,`@ @  @  '' "@`  ,  *`#`" H`@*  '?'h ɬ / '@H.*`']. ۲?!` '+@` " @" `@*8 +@''?@ܖ*   @h #t X##t" 'X h""  //'&4@, ""4'/  c/L    /7LT" * @ /" P* 74@ *  ?, * ""   *@ @" @4 @2@ *@? @  $*.? @ L 0-^"8'#\.^^ᘘ!Ԕ Қ  zA!@`#!0&    0 㿘#c  %)'#̀@Ԕ` *@@ $@ *@ ܐ `?& 4`%)'#̀@Ԕ` *@@ $@ *@  ܐ `4`?%c %    㿐ۤ "#""c 1ۢ&#t "#t8 "&#t  ܒ? ""c@ 㿘ܪ#j "bx ')݀?c%ܠԐ@#c#  @Э$c $#̀?c̀? x @v%# ^?^@`^D 0(#"@8"# "c 㴁"㿘j #"bx"'#% #cԔ$ p@d@ ` #̐ $##̀ ݀ ?@+##̖  c###c @㿘!# `@$x# "$#㿘!#`#c]`p `#@ c##@ "#$#㿘@@&@?Jy ⴄ@`  *J2 㿘@ / 2 㿘 .@  @"` _J@ ."*@@ out of memoryargc<=0㿘@@  _ @@ @m )D@ϒN .N  !`@5N 2@@֍9  $@@  2@D@5!h@&@ D@,!x@$` %D@ `$ N `" $@$` $ %s: %s: %s 㿘#Dzܒc(ؘ@!%s: %s: warning: %s%s 㿘] h` #Dzܐ!cx@]`  "` %s: %s: unexpected end of file 㿘cz!Dc@rjbx @{#0Dܐc@d㿘#Dzc@X!@{#{%2ld.%1ld%%㿘`1  @4 . "* * @$#@  ?`&@& - -* &@Mq ?`&@&  * &@M_!E  @ @א@㿘@r DI!houtput in compress .Z format not supported 㿘_H   zE"H!@ߒb(]"   %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.㿀cܢ ] t'D 'H#Ԕ @ $cՐ $]`t `_ "bP] h` ]#Ezܐ!b@]` ] "`]t  , '耣 "t#EzܒbȐ!@j ]"`] cܒ '_P* ̐!'`''?' !!cȔ!@ג ے  c*?c̛<"   Ԓ *  "#̀ ? D@ @ ?' "@ "#`@ګ̒"@*`cȔ!@ד !*?@Ғ$!? '''c*  " 쀥 * ?@$]`t?'䀢' *@ ?' * ?'ԓ<   * *` :  Ecx*' !_P #?#"@]`p ]  xH*c"c] H`EE#,  # , , #c ?',c " @ ,?5+۲##ܰ`&4 cx@o]p 2  Hcxc$c c"@ & x@P耥6 cۓ-2 *2`]p   #xHc"c 㿘 *@ 2 %!ۦ %3/ܢ & *ܒ@c̀ 4Ԓ $ & ?"$ $a ! "`2@  5`%!㿘 "@> 㿘2 "`" Bad table В  *2@   @ *`   2  7    # * @3@`  Gؐ#  "   & :2 ( 3@  ,`  *#@ +2 ,`:@  *  * 6 "  *@@?@5`*     :*1* 6#1 3* @  ȑ+`2@ 22`* * @+ 21@*@㿘B  =  ڐ"* &*ڐ"!2? 620>,'-۪ * 2 ` 2   2`@`` -@  ? "*  ڐ"* &*ڐ 㿘   ۠ cx*`acx ܓ,``o2 0R@@'ڪ") 2 * @   c@ ,   @ 2bv @ x        ? cx?*`@?*@`@ a cx*`acx!x 㿘b  t  $"-!  (   "? "*`3 ?$"*` !ܓ3 #Ȗ @@ ,   !2cx @㿘 ڕ*2b* @ #ȕ2 @ .    3 b @ ? *@@㿘!""㿘"!"a㿘?  "#@.@ذ   :"? "r! ې ,"a8?.@ 0#$a&c? !$"؀" @.@ذ    "ؖ? "0΁㿘"#p"`a  1!]# p a#a # invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman tree㿘ۤ"!)1/9'ܢ * ##̀@Ԕ` %# r %@##̀#Ԕ @ %#a $ Jo h  ې" '##̀Ԓ %#F  $@ aJN "*   " $ ۶" 3ۑ,  `&a+#ܠ#̀ cԒ %# `-, "* `" ۚۖ* :` " " @?! 4  cx(  ے  Pۚ*#P@ *????*@#P *cx*@cx@invalid compressed data--length error㿐"#p&"`!Pې" *` ۔' * ۮ ?##X"TX#P@%۪T#)'!T* c#̀@Ԕ` $c  #X%@#P  $#XX#PT" 2@#x @ `#@33۶" 5X, `@ -۪T%)'#T* #̀@Ԕ` $ K cX%@ $cXX.`T"2@ @ Xa@.`ے !  c*  "c^X""XW!cJ"# J J  J(8  J  _\ۂch( (@  @"@"`@ *@clb\#h"* (@  ##h@"@"`@ *@b\#h* (@  #cl@"@"`@ *@POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c 㿘_"\_'D"bX -۠ "#l"ch%`%"\N - +ې "cdL"#d @ 0 "#d"#d` J cd - l#h@   "\#l(_#l"\ 2#ch_\DD "\  *@J`-2\J  \$#l"\D@%*`@ L@`@ "\"\ۘ cl h  %"\ ch Dch#l@D"\#chD$#l%"\"\D *#hcl2%"\e?@J`-cdJ cd V?_"bX%"\Q A   -`?`%`"\* @J`-2`J  -``` L@   L@  =2`  `@$@ 2`q$@Ȁ2   _"`` "\z*`@ !L@@!`H`P `"\@%`%"\d"\%"\L@ ) `_G"bX_"``*?J`- zL@!@`h `L@!J`@` `@%` #D _*@_""X%"\"`` *@zL@!@Β```@%`N :  :`` @%`'`  "@ `"\* @J`-`J %`_"``"\* @J`- zL@!`@` "\L@!Ja@`"\L!0`%`%"\\ ` @`. :%``J `"\ %"\ :2J`_"``zL@!a8@`_""d7 :23. J` :J "\_'""X "\_ "bX%"\"\D*_"``zL@!aX@7_""dN`:   :@_""X%"\%`. > 㿘   㿘 㿘@2HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_read`@6 Na@K 0`<Jސ o`?#`Jސ g`?"Jސ m`?# J? f'Ѐ`??"''''ܢ   )P%i'N;j?'59N 00* !@€ +  (  %  "'ܒ 'ؔ ' H@H*?J`-HJHJ  $H@@?ǐ?H&*  @@܀  Ԁ``Na@ 2   2@' @?А   @R'bxbx`Nb0@ J`"'Nb0@ݐ ^ @Ȁ NbH@А  8O'耢 2@ ?А  'bx@PW bx "'bxbx Nb`@ J`"'Nb`@ϧ ( @E 'Nb`@ϛ   @@r : `@@r . `@*@'@@'@@'̒`@v   @u * ? ;P* h@€܀ @ˑ  +0w N @hbx @ h N x @hz @0Z W TԀ Q   @D "D @D "D @ D@ 83     @@P* 2 4@: ؀`"   Ԁ  @̀  0 @Θ̀  ؀  @" @א 2q 8bx Nb@ڐ @ ?$ ? ? ?X ? ? ? ? ? ? ? ? ? ; <4 <4 <4 ; <4 <4 <4 ; <4 ; <4 <4 <4 <4 <4 ; <4 <4 <4 <4 <4 <4 <4 <4 <4 <4 <4 <4 <4 ; ; ; <4 <4 <4 <4 <4 <4 ; <4 <4 ; ; ; ; <4 ; ;%s: invalid user name㿐L ?@Đ " @QO ?Nb@{ J`Pb`@s %s: invalid group name㿐L ?@ " @Q% ?Nb@Q J`Pc@I usage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... [owner][:group]group㿘 0 `0 <zaP#P#P#@W 00 `<zP!cQ (Q 8 @D @9 㿘@ lost+found㿘@  H   "  (H*  :`HJ "   2 wrong type to dirscan %d 㽘L0`"$Q@!  B 6+ B+ 3` @; 2* @ * <ߢ `4@1@   = b<8 $ @= "(  @$(@  @   @Ґ", - @ 2  4      DIRECTORY CORRUPTED㿘 4@  @a a8  4  4  (/  6+ @}@ 2$  `Qc@. @=" `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<  Qc@- @ܒ`@ 6  ,`  p@"". `*41 2. 2 `)  `` 4  `   `J@/`  &J@J@`?㿘@%s NAME=%s %s=%s DIRFILE㻐R@#H@ ?R@#P@,`#p@ R#X@Ò0@ڐ@' < RchR#pR#x @0R#X@UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUST㿘 @.`T >`  @ MS`h@b 0G S `p<  2RR#p#x_#T@l @ ,`T : S"@@= c  J"̀`c 6 cR@-#PS@D c S@$ c 2  S@'  "@ 4 㾐 (@ʽ , /`  `   ?   " 67 4   $ P`4 " , ,  ,  ,@ޔ 㿘 (   ,@   P `$" , ,  UNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u `  ???????@<  `?S`#xR#pR#x@n @Ȑc  J"̀`#    # 2 SS@&ʐ#  @*#` G @W !_[c#T  ''/'@ S-$@5## 2_S@&# !_#X @   $#T@ɐ   # S@# @m # $R@#P ST#@< @@ 3T@ T@&k 0 _#X @Ր  $T( @_#T@v  T @@#kb(cl /'ġ,'`*`::`cl2@ HJ T p@ 0N@&@b  T @ T@ 0;#l.  `?32 T @0 @A@  @_4 Tcl*  Ȓ`2 @ T@[ cl.`  2 #  R@O#P `  ? S??Ȓc ?/'Đ'''???@k'@ X H#pD`B@@  S????@ ???/'''''@H`  B*2 @2 2* @ * @>`@Ԓ  @)А@'@ @  NO SPACE LEFT IN %s (EXPANDED) EXPAND㽘ߢ `@ P ` 4հ -`(@     @ɰ @( 8 2° `+`$$` 0 ; B<``  0h: @$h`` P*@ :`   @  `0  <D @L@ @ @6  2r.` "@u`@'0  c.` @g"` `0 #_c\@Y  "`0    , .``   `P*@:`     `0  <D @L@ @ @   2.`_ c\@" U"@J#`"UU@# @$#  @,  .` $$   0 :`@ c <0h:` " $h@(8㿘 @ P`"__#t#&` &@@ߢ``4@ ( 3@Δ ``4@ #_c\@ b`4 @  . @4   3#l  @ 2+ `H @? @a  @@X`H" "  *`HJ@  #l.  ,2 #l@  2@ @  @x4 㿘@ @k2 @2㿘#p` @  ?$, @ѐ 0?,@Ւ  #,㿘!# ?"@$$#DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS @ 2&@&`$ <>` ('7ߐ e( :`Ӗ ` ̀`x h ư @3` Wb> @!@"cX x @`0?  ;`; @@Ъ @ Y p 9W5W/W2  <@ :@L@ B 8T @ @ &`  8&`@`&N`0 20``&-``@' !@Œ@#B 2 `@ . ..MAKEDEVconsoleklogB0bpf0B0 ttynullB0zeroB0stdinB0stdout0stderr0 fb@mouseB0 kbd memkmemB0ksymsB0drumB0eeprom0fd0aB0fd0bB0fd0cB0rfd0aB0rfd0bB0rfd0cB0sd0aB0rsd0aB0sd0bB0rsd0bB0sd0cB0rsd0cB0sd0dB0rsd0dB0sd0eB0rsd0eB0sd0fB0rsd0fB0sd0gB0rsd0gB0sd0hB0rsd0hB0sd0iB0rsd0iB0sd0jB0rsd0jB0sd0kB0rsd0kB0sd0lB0rsd0lB0sd0mB0rsd0mB0sd0nB0rsd0nB0sd0oB0rsd0oB0sd0pB0rsd0pB0sd1aB0rsd1aB0sd1bB0rsd1bB0sd1cB0rsd1cB0sd1dB0 . .. installboot . ..miscXr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; ss*) M ss$U c 121 $(($U*16)) 640 operator M nss$U c 121 $(($(($U*16))+1)) 640 operator M enss$U c 121 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 120 $U 640 operator ;; ch*) M ch$U c 19 $U 660 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; local) test -s $T.local && sh $T.local ;; all) R ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R cd0 cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 tun3 bpf0 bpf1 R bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 pty1 pty2 fd1 R fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D fd0E R fd0F fd0G fd0H xfs0 ss0 ss1 ch0 ses0 tcx0 cgfourteen0 R cgeight0 cgsix0 cgfour0 cgthree0 cgtwo0 bwtwo0 audio0 uk0 R random lkm cuaa cuab cuac cuad ttya ttyb ttyc ttyd pf altq R xd0 xd1 xd2 xd3 raid0 raid1 raid2 raid3 std st0 st1 fd ;; xd*|xy*|sd*|raid*|ccd*) case $i in xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" if [ "$os" = "SunOS" ]; then eo=transform transform() { case $mode in 600) mask=077;; 640) mask=027;; 660) mask=007;; 644) mask=022;; 666) mask=0;; 440) mask=227;; esac echo `echo "$@"|sed \ 's/mknod -m \([0-9]*\) /umask '$mask';mknod /;s/-m [0-9]* //g;\ s/operator/5/g;s/root.kmem/root.2/g;s/root\./root:/g'` } fi list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" -o "$eo" = "transform" ]; then $eo "$list" else echo "$list" | sh fi . ..MAKEDEVconsoleklogB0bpf0B0 ttynullB0zeroB0stdinB0stdout0stderr0 fb@mouseB0 kbd memkmemB0ksymsB0drumB0eeprom0fd0aB0fd0bB0fd0cB0rfd0aB0rfd0bB0rfd0cB0sd0aB0rsd0aB0sd0bB0rsd0bB0sd0cB0rsd0cB0sd0dB0rsd0dB0sd0eB0rsd0eB0sd0fB0rsd0fB0sd0gB0rsd0gB0sd0hB0rsd0hB0sd0iB0rsd0iB0sd0jB0rsd0jB0sd0kB0rsd0kB0sd0lB0rsd0lB0sd0mB0rsd0mB0sd0nB0rsd0nB0sd0oB0rsd0oB0sd0pB0rsd0pB0sd1aB0rsd1aB0sd1bB0rsd1bB0sd1cB0rsd1cB0sd1dB0rsd1dB0sd1eB0rsd1eB0sd1fB0 rsd1fB0 sd1gB0 rsd1gB0 sd1hB0 rsd1hB0sd1iB0rsd1iB0sd1jB0rsd1jB0sd1kB0rsd1kB0sd1lB0rsd1lB0sd1mB0rsd1mB0sd1nB0rsd1nB0sd1oB0rsd1oB0sd1pB0rsd1pB0sd2aB0rsd2a sd2bB0!rsd2bB0"sd2cB0#rsd2cB0$sd2dB0%rsd2dB0&sd2eB0'rsd2eB0(sd2f)rsd2fB0*sd2gB0+rsd2gB0,sd2hB0-rsd2hB0.sd2iB0/rsd2iB00sd2jB01rsd2jB02sd2kB03rsd2kB04sd2lB05rsd2lB06sd2mB07rsd2mB08sd2nB09rsd2nB0:sd2oB0;rsd2oB0<sd2pB0=rsd2pB0>rd0aB0?rrd0aB0rd0cB0rrd0cB0cd0aB0rcd0aB0cd0cB0#!/bin/sh - # # THIS FILE AUTOMATICALLY GENERATED. DO NOT EDIT. # generated from: # # OpenBSD: etc.sparc/MAKEDEV.md,v 1.11 2002/04/14 23:20:55 deraadt Exp # OpenBSD: MAKEDEV.mi,v 1.43 2002/04/11 20:28:49 deraadt Exp # OpenBSD: MAKEDEV.sub,v 1.7 2002/02/16 01:19:52 deraadt Exp # # $OpenBSD: MAKEDEV,v 1.94 2002/04/14 23:21:05 deraadt Exp $ # # Copyright (c) 2001,2002 Todd T. Fries # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, # INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY # AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL # THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, # EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, # PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; # OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, # WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR # OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF # ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Device "make" file. Valid arguments: # all makes all known devices, including local devices. # Tries to make the ``standard'' number of each type. # std standard devices # local configuration specific devices # Tapes: # st* SCSI tapes # Disks: # sd* SCSI disks # cd* SCSI cdrom drives # ch* SCSI media changer # uk* SCSI Unknown device # ss* SCSI scanners # xy* Xylogic 450/451 disks # rd* "rd" pseudo-disks # xd* Xylogic 753/7053 disks # fd* Floppy disk drives (3 1/2", 5 1/4") # vnd* "file" pseudo-disks # ccd* concatenated disk devices # Pseudo terminals: # tty* set of 16 slave psuedo terminals # pty* set of 16 master pseudo terminals # Printers: # Terminal ports: # tty[a-z]* Zilog 8530 Serial Port # cua[a-z]* Zilog 8530 Serial Port # Special purpose devices: # audio* audio device # openprom # bwtwo* # cgtwo* # cgthree* # cgfour* # cgsix* # cgeight* # cgfourteen* # tcx* # bpf* Berkeley Packet Filter # pf* Packet Filter # altq/ ALTQ control interface # lkm loadable kernel modules interface # tun* network tunnel driver # *random inkernel random data source # magma* magma card (makes 16 tty and 2 bpp) # bppmag[mno] magma parallel port device # spif* spif card (makes 8 tty and 1 bpp) # bpp[jkl] spif parallel port device # xfs* XFS filesystem devices # raid* RAIDframe disk devices # fd makes fd/* for the fdescfs # ses* SES/SAF-TE SCSI devices PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 # set this to echo for Echo-Only debugging [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc() { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg1="$1" arg2="$2" case $3 in l) echo ${arg2#$arg1} ;; r|*) echo ${arg1#$arg2} ;; esac } unt() { # XXX pdksh can't seem to deal with locally scoped variables # in ${foo#$bar} expansions arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root.operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } # M name b/c major minor [mode] [group] RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7.$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std random bpf0 R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M drum c 7 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 644 M fb c 22 0 M mouse c 13 0 M kbd c 29 0 ;; ses*) M ses$U c 124 $U 640 operator ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; xfs*) M xfs$U c 51 $U 600 ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; tun*) M tun$U c 111 $U 600 ;; lkm) M lkm c 112 0 640 kmem ;; altq) RMlist="mkdir -p altq;$RMlist" for d in altq cbq wfq afm fifoq red rio localq hfsc cdnr blue priq; do M altq/$d c 125 $U 644 U=$(($U+1)) done ;; pf*) M pf c 59 0 600 ;; bpf*) M bpf$U c 105 $U 600 ;; tcx*) M tcx$U c 109 $U ;; cgfourteen*) M cgfourteen$U c 99 $U ;; cgeight*) M cgeight$U c 64 $U 666 ;; cgsix*) M cgsix$U c 67 $U 666 ;; cgfour*) M cgfour$U c 39 $U 666 ;; cgthree*) M cgthree$U c 55 $U 666 ;; cgtwo*) M cgtwo$U c 31 $U 666 ;; bwtwo*) M bwtwo$U c 27 $U 666 ;; openprom) M openprom c 70 0 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=4 ;; d) n=5 ;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A tbl p q r s t u v w x y z P Q R S T name=${tbl[$U]} n=0 while [ $n -lt 16 ] do nam=$name$(hex $n) off=$(($U*16)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 128 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; ch (! ard0aB0?rrd0aB0rd0cB0rrd0cB0cd0aB0rcd0aB0cd0cB0rcd0cB0openprom;random0srandomurandomprandomarandom` 0@ȑ<: > @홐@"cX` &``@ ] &`@   8 &` p 05W*` * :  @ :`c /W@  &`@6 "&N`0 2`@'2 @n@"ᰨ O  `t @3;  d Ѫ` PARTIALLY TRUNCATED INODE I=%u㷐M`0  Q`@ 2`0!`@`  !ߨ   0@#` 0` : t@<`?   `t @; 8 2   `t@"  Wb: @a@"cXqF@B@ `d @**  `t6%* @@ޢ1X  " `!@YD@'= " $- *cT@#:49W `%`@e "M`0 2`@&` Wa@@"!`"`f *  ?%blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d 㿘"܀q@nߨ  `@@h``@c, ` 8@Z@T, @K \`E#Y`@E@@, ` @ #Y``@3 @-,  `! @%@  \`#Y `a@ @,  `@  Y`!(@ܒ  bad inode number %d to ginode 㿘 #p Y#8@  )߀    `x 3%ߦ  @*@ @# * @  @@ @@ x ` `L* @ ?"@!0$L`x@@ƭ%`  x@L * bad inode number %d to nextinode 㿘#  ` "# #p )Z @7#d E#ߢ``' @$⼒@x `@#d* @n@ư#d@ŷx`ߑ* d⼣, @ T "#d"#d %#d`X!#@#9#" ` "`Cannot allocate space for inode buffer 㿘 8e<`H ` ޥ4" "cd#" "В## @$b+ߐ@%`T!ޓ* " $"Đ %`T$""!#   @#b $#Z@"P Z# # `㿘!# "$#@0$#cannot allocate memory for inode cachecannot increase directory list㿘  0 ;  @ C@8 ` 8 `,` $ (@ 2Z@^##x@c* `$"$ $ $ $ $  ,`$  ( $ $ $ @d $# ްԀ@ #ޒ`d"cP@*` $cPZ@0## cP* "  &# cannot find inode %d 㿘#x@ŵc*   [   2 [!X@㿘c  # P*`   @cP?@@cP$cP$L * %s %sDIRFILECLEAR (CLEARED) 㿘. < [bp["x[" @ @g 3c [@w" c [@Ր"?"ޒc @Ð`H  *㿘 (  2   ,@ 㿘 ( "  ,@rf  2  #p 8 &    I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s 㿐\ 0@{ 9#p 5\@n 8@ p "\\@e @ p@` H\@\ Pc "  !\@' `@Q \  @K h @Rk'\` x@A`%d %s I=%u BAD STATE %d TO BLKERR㿘\!@E\@(!`HJ@ "     H4 ߀ 0   *@*@ H\J@!CG %d: BAD MAGIC NUMBER 㿐ެ"    HJ@  #p  HJ`" p pJ@ 2pߪ  `@N`@``@. ` ` @l @"U@  `#Ԁ "`\"p@Β` @"2  @"U@" \ ` @  *@ , < @ ?@ % (@ 0C@  0?H *   % H *@  * @!  $ (H #*4@h$ d`$ $ $ `4 :< `4": $ h`E#" P`"6` `*`  k???Ȗ(???? /''gޔ c@% H *?"dfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... 㿐@+@Λ%jޒ *"';]9)7]5_/]#!K-] +B^* l@€c ?%c]"(,ؐ b@ "]@籐01,ؐ cbX@ ('" \ $% \",p m@ p&X]@n"x@瓐 `,#$  ,` #$,` ,#$0 <]"@Z @??i!H*@  & @x  @r c #@k t@g    ?@@`  @1 ?b耢  '@ xL xt xt xt xt xt xt xt xt xt xt x` xt xt xt xt xt xt xt xt w w w xt x xt xt xt xt xt xt x xL xt w xt xt xt xt xt xt xt xt x`-%c flag requires a %s 㿐@A7"^J ^" @ܔufsffsrwro㿘^ @ob " ^^ @ob 2 ^ @ob "  ^ @ob 2     starting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** 㽀#``,@ c@`\  c ^@1#@@?s  cc m^@#Pj `  "#*(-ߐ ^`@#p@ "^^@#^@#@hc  c ^J"̀`"^^@#^@̐#@ c _@Đ @/c _@弐 0@ c _@崐 X@ #c _@嫐 @ R!_`̠ `#`8)@ɒc"@. * (!_ @T* . ("2`*@ *:@G @+ @z`\`p ""@" `%"_@i `\)ހ 3;P5ޠ #,@"  @4@ &@ 8@q&bܐ"@" `&_@<! _@6!   %_#_ @.aH 2 @(P"Ȁ _@"!X"Ȁ  %_#_ @a 2 @P%"%&``ch  @ee  ,  &L  #  `,6޶%@```@. ``d T, @ `,&cX 2/#(@`` 8 872`h`;2`h -"` ?d#`(``X* @ؒ "a@# \` ` a, `#@⦔ؐ` @`($`h e(`:` `` `7`h `B*2@  7ߠ    `t@?   4`(a, ` \ "b@_#b  , 􀤠   `t@   `Xa, ` \ "b@=#b  , @ ~ސ cl"`. 3T``@t  2a@8#b@  2@z bb @ `("""""H`` @H  *@[ސ *@"5 *"`"`?"<c``$`p$`t4`4`" "`&`` 4`$@:` &`$`h /b 0@  bb@ `0@X p `$" h0b x@ ̒H a*@E#@ H*@ޒc@ BADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.㿘   . 'd ` F`  "` d@  (#`bd@c @ @   @ bb @ .`( `$)'+b-b/b5d7d    r   ":`K *$:@ `2  #  %# * @ +  YPऒ ` $ @ @X#`d@` K @r  @ (@Y  2d@  p@` 9 @`  @ Ғ( ``" `"#"@""@`@ `  `@@ ``2@`@2 $`2 ` $  & $` phase 1b, inode %d/%d㿘 !d`#,@@`  e?? 'Ą/?????d`,`#ޤ  "`" +  `@6+)ߦ %`   H'J@  H ` @  `,&&#DUP㿘  3 3ސ  2 `-ހ )+e   ` a $ " $ ` ` 2  ` @ Ң`phase 2, directory %d/%d㿘 e`@phase 2, parent directory %d/%d㿘 e`@PROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'H `?* : `m g"*` €e@ "e@"   @ސ ee"@ NbВ }!퀢 X He@ E"e@ "e@# e   h!퀢 C He@ 0"@# ; H@ ee"@ $be@ b#0e@ސ# e   G!퀢 " He@ "@͐#P  @ ee"@ b\  o@ 2  H HeJ@ #X H *`P  H *b *#!cPj# @ei #  cP *he#`?`ԡ:? ަ "/' ?????耤q$`+e@5e3e1e  ``%`a x"e$ @c#P >     : 5 28 @ J"̀`  cc@ Ș"# #Ȓc@ ͘"#c e@ޠ# c! >`$ f@/       :   @7@  $  ?H @xh ' M'̤*#Pe"p&㼀K%༬+e)f#1f/f  :%  "7  2?0    $ @cP %    cl*` ?2  { @ԐcP   cl*  3  cl* ?3    $ *c &#P* @  `"   " ɐ $  $ " *鬐  | d (  d.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d㶀" ` ( #p "  @ , $   (!g"@f 2#    g ob e$@ڐ#P "  P`"` $  [g [bȒ eO, gSb P `' // /"7  f`@eА g"@ '2 $ 6,`g@ #(( $ 7 @e7 @ $ޒ`& $ #l*  ?2 @He4@x#P "  $ 4  P`' //f  `  / $7 /   ?  w "74 $ސ & $ #l* ?2 @ 4 @eZ 2`P U$  Qg 鷒cX e,@"#P "F E gb@e:  f 鴔g#p@?  f 馔g@#?$ f$ 陔7 @Oe@#P "  $ & $`#l*` ?2  "  `  $L .2`2L  gcUe$@#P "   .2 gc& $cp  h > P`!  2    2 h5  e$,@#P "   H @ * : ` j!*` € $ h  0h@g  $ `HJ `2h  @#`~ J"̀`yh H  h@J  o < H @ @  * #l *`2 O  & $ $  @d @_hh `p@#`hh@u 4 @   /  $ `P $`P #b J @ h  薔be#P @, " #l*` ?2 *h @:`  $  ( 4 4 ` `@$$"@phase 3, directory %d/%ld㿘 jc @%㿘# P*` j`!  V"- % H? ) HJ `@P HJ@ :?  J@ 2 cx@  ` `   HJ `x@$  m  cl*$ $  ?3 ~ $  $ "  H  *aP&#phase 4, inode %d/%d㿘 jb@ȁUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d`   kj`?(#?   /'#c@????V? H"`' * : `?k"*` €`#l,`R `5`"Ș`02"`"  @#"k`I k`q  @ 2kk`k`(5 `*k 0:`@@$㼁 㿘  `B '+ސ   4   b:  J* $:@`$   2 & @a$ `  :"* $  * *+ c%c`Ġphase 5, cg %d/%d㿘 k`Ԑ@͔HDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPS?bߐ" `` H?*cH ࠒ @?b#0"຀5`X $ !# k@R## 2 %$k@# "X%$ ,`"bX $  k #Ȁ  k#Ѐ $ %$P@(*  ณ, @,: ତ@@|@ , $:`0@ *`@, , :`@! #!k#@H%$# k@\# ?# l @P@*  ณ,@: ଢ@ @ђ|@i , $:`@*@`@Z, , :`@@L %ߒ * "L? ". l?༘#<? Tc8@#""@ ?:`#4a#@"U%c?P#0?("?" #,%P![#%`Tഡ,  %`XP@s഑* %`\ฐ`,`: %``?ଐ#,$@"@a@| , :`@%`d?$("@ " %`h$ * @%`l@F|`@ݓ* , `l:` %`d@`\"U`d?`T%`#4?"@ c8?#" @#<#@ "L@ѐ   @Y@?$""?c@#@  p  *@"@  8?`8  ??$8   6,ޘ   :b*% +@ * ,k" Ԓc\`"# ހ@ N"`ޒ@"Р@͒/@  ࠒ @G @"U@ " #Ԁ l H@༒@$@4 %` %`,?@2@&5`5`&%`$ $%`8@4 %`p%`%`$%`%`  (`@6%`(%`( ,`@6%`,%`,U` 0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#8 ?#4@@ L2@"U%cฒ@[?c?`@c  #@`@/`@"@H @* : `)q!*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ*l h:`@”ศ Ĭ`%@"U    ` :`b@`\@   ? %*@*`  ? %` @ɨ @"U8 3 @"Uޚ @ :`J *`" : 28 `:`c@``@   ? "+@@* 8ז@8e ``%`@|@=`@-T@`T@ `"|@@@%@@@@@~@P@x@* `- Ԑ@ `X@@h*  2$`$>88@ &``l:`@8@ &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " ?% ::@ `4@ 8@@=$ 4 `l `p@`h @@  @  $4*   #  (  `p 瀋@" ?$4*  # ?#`$@ '` @ '` @ '` 'P@@v l`@#@  `$@``$ `  $ `$$ *b쀢 @?<@P l`@"U@`T`T@ @"U@ T T?#8 @7 (l`@ "?c<@@@Q @"U@ T T`@"U@`T`T@?8 @;ޒ" *`J"̀` ?c,@@ F?@"U`"@`\@ " \ $ @"U  "3l- ."   \ : 2  @'@`Ƞ   ?#,&`?c(@@ 6F`@"U# `` #@``@ $ @"U  "3l- ."   \ : 2  @ܐ@Ԑ`   ?( €`@"U@b`\@@"U" \?4 @^ !la@ x @ "U@" \`@"U@b`\@?#4 @ޒb *`?c @,@@&L`?"?0%P??#$c@@@   l@@͒`  = =--+  L @ @ @ L`` D L`D`H㿘z'H'L'P'T'X!@H@ %s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. 㿘  `"L``"Dq@" @ `"L` q@"(0 <`qD@"0@ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH%s (%s)㿘jbx!q@F#Pޒ㿘 'H'L'P'T'XH@ 8@ / @ <  L  r @? /r㿘@͒ / 1ް ؒ,@?ݐ /r` ,@F) @F&0 /Can't stat root Can't stat %s %s is not a character device x`r "bH @D  r@Z 0M8@6  @r @K>'< @@#L@"H %"H@؀  fr@. !  r@$ @ `gâ @u `2 malloc failed㿘 rbh@ @M rbh@ realloc failed㿘`rb@v @x rb@n strdup failed㿘@S" rc@_ RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead J"ޒ?*#\"T @ݒ  jbx!s@C @° <   s s@z ؀ "  @ߺ  "`Xjbx!s@C @͐ c  s!@’J ` @   &cT?`&cTsɐ!s@Ь! #s@Х!(#!ޮ"`"#h`(? $`$ , $ ,`$`@$ @  $```Xs]!0@ "" ("ct"@  Ib D  2A `X@0 ": s@!X 3 \@@LH@~,@ 8 ,$@d "`\@s@ssssss#\!xaؘ"@6b   s"`U  \` sJ@%"  `рs`"s"s"8 ? 2s/"А  $1 ,5"b @(  0ޓ*@ *` t  :` :"p  @oڕ<` @ E   `s"s@s# `2 " ,   <`cs#0s@a#   "`<, ` `$s @sڐ#X ` "`s@ϫ# 2 (s@=# 2(* ,`   @ s*@s#  "s@ψ#   s@# 2 (* ,  `0`H s # `0 "`Hs@e#   s@# 2 (* ,  `4`L s r# `4 "`Ls@B#   s@Ԑ# 2 (* ,  , $H0204"0t  F  `:%0s@#   s@# 2 (* ,  %(`<t( @ < `"(s@#   s@# 2 (* ,   H8%8: @ %< "!%<t p  H8  :;%8s@ΐ#   s@`# 2 (* ,   L8%@: @ %D "! %DtՐ   L8  :;%@s@Σ#   s@5#   (* ,   & P8  ::8 L8  ::@& P 2 e,. 2 tt@ G  ` " ",` <:%0` "(`H8  ; 88`( L8: ;%@*`+` ] eLY( 2 tt@ܐ!0  b!` " "L` "P`#\"eT`%`"X`P@P*  , @,: @@C`@ | , %$:` *@4  ` |@˓*@ , :`@( L%@  $ * ((L` "`  `@`hcT@  @vҦ  "cP cP 2`t`@Ґ!X0 4 3t/s5t7s ``0"4cP`8@ ``d`X@ѕ* 2 Ɛa@C؀  @  {  0  ժ`"ܐ`,`:   ? @vހ "bt!@͈0X#p @vx ߀ "`H#pt !#p @vl ހ "b#pt"@n`0>#p @v^ ހ  "cl#pt`"(@_*`0/ ސ #"b"  @vG$cx!$#Pcx@vB #Pހ`"#cxt"P@?*`0@Z Ӏ`ސ *b*" @  MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE㿘- #t :` @j3 ߦ `X@ 2 !$$ \F!T@xa, 4xb`xb@  `,`@Ԑ?` &`hxb0!xޒbH#t@`d`4 @W-@ $#t@S`$ߤ ( , @ ,  @*@  @ h@ @  2  t@"e "% ` " # # # # ""b *` *` *` *` X"`X <"`< "` @"`@ \"`\"@(b"cL"#LcP"#PcT"#Td"$d"$ @` P$\@d\ l$@d`d" d`" `" eP"%PeH"%H8:8@;%@H"%H0:0@} h $ \`+xx@֐"h h ?%x@ $ @œ:`  `b@ *#\ %s: BAD SUPER BLOCK: %s 㿘 #`" y!yv#@ˠy#%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) 㿘 @Hy?"  ? #y y   z ( @ b ``*: :@ ``z X`"̓*` r#Ȓ_ e %h@  &4 &8 &&$`0&`,&`8&@`(&|``4@8? @ @I8?&`&?<``* &@"* &|?@ʐ8?@Ő@(&@"@&$@?@&,`&d <`` &d`(ް "#tioctl (GCINFO): %s %s: can't read disk label 㿘ޠ e`e@ 6 j  bx!z@=#z#0bad file type 0%o 㿘< @@"%  (@" 4 0@" 0 @ \@   \`" z@ʅ# INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] 㿘#`{{z {`@S{`?@V J `{#T` {@E U*c(J#$`2 {  zJ `z{@2 D  +{)z@)`@`$@iD  $  ``  ` "`  ހ  z``? "`@i' 2 y Y n NΒ@ y€ Y*#( cannot allocate buffer pool 㿘ߢ `0"c@*"L 2`{"ސ"ޔ?" " " * c0$ "c0 0@($  /{ ?`$ $ $" $ $0, $ @6#0@ @`0  0`#0" deadlocked buffer pool 㿘#0#0 % `d.  " 2 c0` c0  2 c0|H (@c0  $" "$ c0$c0"`$c0  $ 㿘 `d .@ cT@!`ߒ`"`X @`& & & WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY 㿘N` B` #t|` @||!Ȓ!`/``.`` @&`ߐ @# `  '`#P@@' 8   0"@ d T* @` 0  CANNOT %s: BLK %dProgram terminated 㿘#`2|{@Ґ |"{c |#UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) 㿘#T` @`X0ߤ  bJ#\`&)#t :`:  @eހ@ !#`!| #  #t: @e $T ,9!ޠ"T4 @5ޮ#0 +߀`)3߀@"0T!`@`@ T0 @"%#|"@#  %`L  `р`\#`||L# # " ` * T*``\ #`ޑ,`c* !|#@ˑ* @@eX@cTSEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,㿘#t >:`@gƒ @? 6}" }@O}W "@& 6}"ؒ @}@Ǫ" : )9}/}"@)" * <` D @ :C  @ t" `@"@Ht@D@{" @<@t "@@Ͳ@{@k WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:㿘 _#t >:`@g< @ 6}"g ~@͔~ސ <"chX @ 6~}"L~@"  ${'+}t@t @ < D @ :C  @v #t@ʐ@b#t@{@ CG %d: BAD MAGIC NUMBER 㿘ޮ"  ߖ `8 4 bܞ "   ``8  ߪ !-@  ": * J& : 2` 6` @ : * H" : @6`e`@i@ʐ``@Œ, ` ` ?U " `Ԁ ~"`@0 .#ނU%ޞ ` `:*"@ +@ * `; c` ` ` ? #@+*@*`c 8@ $c?$$"$$` `8"o ` 8 "@ &^` `?/?..`@ `2c !!c    H  ``   !!. M.   ?? $/'?????#@ .#'̠[̐#''Ȑ '!' "@$@@ے / @ ,@Ȁ[#a'''ע [$ ?,@|@" 㿘"` @ returning to single-user after filesystem check 㿘@š#ސ "b @ 㿘@  @  @ %s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d 㿘 '   !#N 0 Ҕ  X#` @_ ` &  p   & &' x/dev/tty: x`j# *bx€$ "$$x!`@x  &$x`#'@ِ 'ܐ ap'''@А'{` '' @͒@}$x㿘8a/  (-.```Ȓ쀧  ': ) @@2 8&/@/8 /`/ 8܀ ffs_isblock㿘 8>0#  @ `?>@ *  @ *  *@  `?>@ *` @ `?#(ffs_clrblock㿘 8 >  0 .@>@ *` @ *` * * .@ >@+ * .@#ffs_setblock㿘 8 >  0  .@>@ * @ * * @ .@ >@+  .@ ffs_isfreeblock㿘 8 ">  0 @`?>@*` @*` *   `?>@>   Y!p㿘@0init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsX@a@  !z#!bX@6 @g@ @ " z!@gbh@ " @  @R 6@ѐ"@" @Ȑ" s #a "ba "bܐ"@Ȑ@j?逥 fi!H"@"#\ @Q   #\#`#d#    @D    P  @< # @7      #\#l;p#x ';`#h#|    @C  @   ?''' @t  @p @ @ @ a"@ 㿀  ?''L'P'T'X'H'`L?`' '' @I  ?`? #####`j  x ( ("#㿘 'H'L'P'T'X@H@@m 㿘'H'L'P'T'X @H@㿘'H'L'P'T'X @H@㿘a" `""@ fatal signal: %s㿘!@#ڐ@3 @cannot get kernel security level: %s㿈   ?'  @h ? j"x!@5S#ؒ?cannot change kernel security level from %d to %d: %s㿐'DD  ?   D@: ? jD!"x@5% p㿘㿘  @ a8@ݔ can't open %s: %mcan't get %s for controlling terminal: %m㿘@ސ@ @u ?!x/@ @?!%@  /bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restarting㷈"08"08?' 6 @4 )s"@' @ '' bX@"P@8!"''@.@ @t %a"? @Q  ?@1$ (a?@C ?@? j"x %"   j#(@L ?a" 萊   V#P@ @+ #pO1#a 1""ܰ"sh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootp@m 5?  ?ؐ ''' @  @ "@a"1!!'耢'! '' @ !"0@["!@ ?" b0͔? @z  ?@ \1@p ?@?j"x "@b0C1Ԑ  "xb0@o ?Ԑ?Ԑ    a"#X@?'@|0̐": 21a"ܐ"b@ؔ81"#session database close: %ssession database open: %s㿘1 l "  @  j"x!@2!C    @Kl & l  j"x!@2Р!0 insert %d: %s㿈ߖ D l '''' 'D  Dj !bx@2"x delete %d: %s㿐ߒ  l ''   j !"x@2#㿀ߒD l '' 'D  @ 㿘@X 2  @* #a@bb耢 $   b@b . $  㿘@   " @@   @@ @%s%s/dev/㿘 ' -  )@ , @Ɣ , &@ & @ `@+& @%    & (" h& $& $$ (%s %scan't parse getty for port %scan't parse window for port %s㿘` @@`@`@@@j $``@@+af`  $``$!`@ $``  ` @s@?E`K$`  $` ` !`@d $` 㿘%h    " ( (K 2 $h  1#`Y 2@V @1 ȁcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %m㿐@#?  #0' @ѐ @ 6 # @'@ @# @l can't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %m㿈@> ` `? @?w?@? `^ k? g@@  @?0Z@O 1`  R$`  O$` ")`@{` @q۔!?j"x   2 `@ @c@ `@ @[@Y@s ` $ 4 `` @f ` B@^ ' @ `@y@`@! `@ 㿘#`h 4 /j   @[ ڐ $  $` ("`($`h (` $"`$0P?2$ !a"b@= $     a " a`Xa 㿘!a$"   h@= & a ( "1a  2 (?2& !$" 1a @$ ?""" ?a"port %s changed utmp index from %d to %d㿘'h D  ?&  ( 2 0;  ( 2 @Eג` 2 (  &  !"& "     ?& ѐ  !   @& 0y@y h@ h "1 `2 (`&  @Ԓ  ( 2 1 ȁh   (2  ߄  p shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised㿀 h       @$  ( 2 #"8@!@(\ ?"> @?8 *  ? ''' @  @ 2"@ @ !"0 a@#[@B @& 䀊   :  2  #,  @;??#j"x "$`p@kА ? @ ?"`pa`p j"x ?j"x    $.#@1# 㿘 h` `  "` `(`2` "c@쌔8 "T.  @??!j"x ""1$ p@k ? @ ?" p p j"x ?j"x   $#1#㿘@ (   @*`2 ,-o %s: option not supported㿘@;  @* 1' n L  o  @8 = 2*`"@ 2   @2    &*@&c@  @^ؠ 2L@ڐupdateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%dh@V0<@&%a ?'  b"a"8"@j !@ْb !!ؔ` `''''ВP!j;9b%7b/-''''ܐ@`?A? ;9* ,@€ 2"8 ."b<@ ^" )'b,"@$`""L@ O"b "`"@(`@ C"/' "@~P `@ 8"b "`"@rh` $`@ *"b ""@d`@ " "\"@X〤`@ " &"@M؀`@ "b "a"@À`@ "b ""@5`@ " "h"@)(`@ "b ""@H`@ " "T"@``@ "b "耢 c`"@x`@ "b ""@`  bb"u`"@Ak  bb"g"`"@A_ bb"\" @ΐcY`@ "b R""@M` bH"a@ x" B""@(=`@ l" 7%X"@H2`@ a" +"4"@h&`"@A 2 `@ K" %D"@`@ @"b  ""@z`@x`i!H`*`@ & & @fb 4@ @y ,@@ې 'ߤȒ$@l! $&@l@$@l @a@م  %a@@  Ȓ @M! $ " @. ''77''/7?''''7@ / ߠ"(! $@kȐ@k?2 (@k$b8 O?@kr   jx@*d0@Ғ@gq  2 jbx@*V!!8@Ò @Bǔ   &ߨ r  @B  ,  @@/  `@@)  aPT@줄!' L "@ s"L@!hl@k  'jbx@*0@p@耢  jx@)a0@a<    2 @0<!@@@4 ?"J?`` ?Ѐ@yb `@@7!@y @ⴐ `*: :@ 2 ` @!@M@ ` X@"@M@X X@%XX@  b  M@"0@@  H "."4  D0 "4@@"pD  b,, %D@@ܐ"b,  b( 'b,@@А"b`؀?L"`T  J "T "T܀   ` &($*$& b ` @`  ' *  4 ' b   @(@? & b"`h bܑ* "h耢 bb`쀢 b?bzb@Zb@Z  b" b`Ѐ?b@"`bDԒ@""0B"4@NDb8"   ""Pzac 8@Y#h\ 2@ 2 "\@'P`'T`'X` b,'\!!"(@""D'b,@%Db0@"0P@"bPX@%X@@^#$@" `&a:` "D'b,@%D0@"0bP@"PX@%X@@$@@2(a b@w"@@ $@`&a@@#:` $@b8  ̐@gm  @8 @@`/@|@" cb!ܐ?'`' ''"@b,'\@Xb'`a`@؀  j`0@(#x@@, 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 0 0 5 5 5 0 1 5 5 5 5 5 5 5 5 5 5 5 5 1 1L 1x 1 1 2 2< 2l 2 5 2 2 3, 3h 3 48 4h 4x 4 5 5, 5 5 5X 5 4ioctl (GDINFO)㿘ߠ e`e@x 6 x3bL  `@7" bL@4!h0 @ֶ" b!@, xioctl (WDINFO)%s: can't rewrite disk label㿘"`6!6 e`g@ @֎""@㿘'H'L'P'T'XH @f   0`< @ @ @@֭@ -z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s 㿘b   0 = data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %s/'D'H@ ? ''"bl@ @߀ "b @ @ "bd@ @߀ "b@f 8@7 @1b "B@Q'cT@\ @ ?2@,S P@ @ ? @: @ @ x ,bX@_bH ?@@"XX!@O",@ ` $"@@ "<"c""l?"e,"e(l  <"%("%,X X@ @Ԑ ,@ l4l`"D  @ p@ b @ @ b!`  @ܐ @ 4b @Ӓ @  b`ܘ 0  4!@Œ@  "!0@ @ ",   !`@ @  !@@x  !@@p  ; ;`8 8 H L888@  P =   "`Pl 4  " T =   "`Tl0"`T:   "8  =   "``l 8   0 4" @_:@0 b` 0,22 4$%P$ t@{$ xl$ |`| "`d =   "`dbb la4?@z8?@z@]&@z?@z@Q|&@z& ?@zސ@A?&  &?=  * "`l@l* "l  0 *` * ?: ;%0 `t:`@Oܕ<  e0@B?#@kl0 *  "0= X-`*`"X@y@Cl"`l8`*` "``"8l 4 02  8@"H@"h@Ґ * `: |* # |# 8# `# 4l %P@*   ,`@,: @ @ l@y | , :`%$ 0 *@  ` |@y*@ , :`@l",@@h@y"l?`x @yx@ے$`) `8  @ːl"`0=` @y_* l?`x@yYl@x@yS ⨒@"l ` 0 8::$ `$ 0$ 8@y?@l$ P@,`l*  @`,`: @@l@y& | , %$:` 0@ *@~  ` |@y*@ , :`@l @ll`0* ""`0`@ch@x"`x?@x@X$`l `0@x,`x?@x@Jr` 8l 0@xۑ* l?`x@xՐl@7x!"@0l"`0 @xő* l?`x@xl@!x@x @`` h@"#@` l@ݐ#0#@ْ !`b"lb 0` #P@Ȓcp"lb 4`܀ #@c@  l @l`"  `#Ѐ`    @l ?@xc@ƒb``$ lb l`@h@xP"`x?@xK@$`0 @xD* x?@x?@"hl" @$@x-"x?@x(@ $l %P@*   ,`@,: @ @ul@x  | , :`%$ 0 *@e  ` |@w*@ , :`@l@lbP"4 22 : :` P#"4lePhCl`" @3$`@wː"`x?@wƐ@)$` `@#*  `, @,: @`@l@w | , %$:` 0Ф *@  ` |@w*@ , :`8`l  @ |@w$ @ `@kj, @ 0@ b X@@ `䀤0"``@  `` `@m  @  l`"@ l@ l@!b``l@P lP@*  , @,: @@l@w- | , %$:`@ *@  ` |@w*@ , :`@lL@  $Xd|<$$@l@w@d$ఠ@` $ఖ 'l 4@(! @ "T bD ؒehL @ "0 L  h XX@9Pl* #X @3 | `@vʓ* %P  eh`l#\%`$%X$%Tl%``"%X"%T ll|`਑* * l  ah#\!P@ט!l"cXD LX "h *"l %P .#\?"lL?, TP@ܠ* 2l%P lcXܠl@8 ll|@@vX@@j8@vO@@@j-@j+@@j&P@@v;`,L?= .#\ T@* R?leL?2eXe`@@* ,eL?2eXe`@@lL?,.#\ TP@d*  ",lL?2T.#\ P@P* 2l`8ll@uܒ@i$, $,l x ` @u͓:  @ $  ,8 ? 4  @%l``@- `` @$&)`,#b@@-  @@u8$8@u@ːl"8@Ĕp@ ?@`$`"@ e @ߒ``@ڒ, l@Ӡ $Q2`l!8"* @|@Ò @@g %@`'`@, ` @`8$@uD@u@@wl!|#@@nl ,$ , @i  l"@$ `@`l@u"|l$`$`d`$* #"X ll%"XH`d`|@o:@i?`$"@@:l ,# p%D*  0  L2  # #  # l  =   "`pl @ "b@#@ b bb F"\Tl <$%\$ @$ <$ X@t$ \b`, $ Dl$ $"$ $ $ $ * l *`l@]X"l`0"|!$@ #l#H#\@ؐlb`$"X`4``#荠`,` &#`&$" HH?'#\@ba @ @ l , 7 153/z@b 2%ll`@Òl@. l``d , @ P@X @``@xl`,b 2@n X"8`" @6 @f ,l@t$ b @Fl l`T`=``0"`d * b @0l 0  l `,Dl@X```@S. ` b `d@,l`,lD * l4" ;* l" `2@ @@wj @wh @wf @o hPanic: cylinder group too big 㿘"l @ $4@ l.@ ༒@$@ $4?@s @"!ߑ.@ࠒ " @l@" "U$ $ $ ,?2@gR4 4 l& 4 $ $`@s]8$ pl  $T`,  $XeP@`* $\``,`: $`e$``@`l@s>| , `:` '$d@`l@s1 | , `:`  ?$h`h` $`h%$ * @$`l @ l`|@s*@ , :`$`d ldࠐ" $@A"@ %  '" @"U   : ` "`\@@  ? $+@*  ?"  ') 0'  @[vd, l "l0 2  "l@(```@#. ` `d`0,@d"l 8 "l x ` @r: Ԁ l@"Ul@r`8 `"``cؒ@@~l%$`   l;  +  $  * *  `l`$`@ |@ru * `"`T`T@@ `"l |@Ȓ @fF @r]@ @@f;@f9@ @f4@%P@rJ  * "X@@r>*   Ԓ@@@l@r1 @%P* @@@ 2@l`8ll`("`( l (" 8 @e$ ( 1$@*4  "  8@ "@@'l@"U `` : ` "``@@ `` ? %@+@* `$@ "$l`8@"Ul@q`8 `"``cؒ@@l%$`   l;  +  $  * *  `l`$`@ |@q * `"`T`T@@ `"l |@ @e| @q@ @@eq@eo@ @ej@%P@q  * "X@ܐ@qt*   Ԓ@@@ϐl@qg @%P* @@@ 2@"l`86/l &*`4 @ U"    " : ` "``@@   ? %(@*"  $  "$l%$`9   l  p  h  `!     l%$4+    "  ( @ ` `p怊  ll%$4+   " l ` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @5```@0. `  `d`0@,㿘" bp"` "`"`#!4bp"<bp `4 c  pb "`@$bp: < !"lbp@`4"l$(`Le@ :`B *2  $hb`d`4@* @y 㿘ߒ " "  `` `6` @}`?$ @ a, @*` `2` @}"cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 㿘"l !d*" @" @`"U+ P` 2`$ h  b `"lc``@"l@p 8@ "lb  8` &` @4 0"l@b "U `> ` @"l%$`b   l: * $  * +* b ` "l?#` # @ ? "` #` `#  ""l@ |@o b * @"U@"TT ""l |@ @c @o@ @@cx@cv@ @cq@%P@o b * @"U@"X@@oy* b  Ԓ@@@Ԑ"l@ol`@eP* @?2@"l`0E`4@o\ "l`8 "@ " `8`̘#b @ #`$4 "$`8"@*`   `8 '"l@"U ,  : `"``@@   ?" +@@*"l 8 "l d*@Ab fsinit: inode value out of range (%d). 㿘@~@@W)"l!& l d*@" " @"U@" @* P@z 6`\?"  ` * @* bl d" @*bl""?",@4@ "l!X@@zԐ  @~z@$ @~s * @  @@ @_@~g x ` d* @,@  0@"l@Px*  @{Ґ"l0@Ĕ@i㿘@z getrlimitsetrlimit㿈"`%%@{< @,? * "@{4$ @si @#`?@e  6@#p"$HH*@ 8 " $H@{ 㿘    @{u@㿘@~ @{ђ seek error: %lld rdfsread error: %lld 㿘"` ",@~{@@@{E00,>  ; @C1! #  @q 6#  @1 @5!@y !@q >   @ !@$!@y "wtfswrite error: %lld 㿘"` ",@~2b@@z05"8`1,>  ; @B! "  @q[ 6"  @ @"0@y #@qm >   @Ґ"8@֐"0@y $isblock bad fs_frag %d 㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `?z!@Fnch clrblock bad fs_frag %d 㿘 8 >  z z.@>@ *` @ *` * *.@ >@+ * .@ 8!@F7`Xsetblock bad fs_frag %d 㿘 8 >  z z .@>@ * @ * * @.@ >@+  .@ 8!@Fa0COLUMNS㿐`h @{?   @y"  @ " P㿘@ dfiPRrW㿘@?1 b@F "c  +)#!'%5i79 "* c@€ %# $c$# $# $c  %   $@"@HҔ?ߐ?H* & @ c @@@  @zs & @10@@xx# @ ` L ` ` ` ` T ` ` ` ` ` ` ` ` ` ` ` `  ` ` ` 0 ` ` ` ` ` ` ` ` L%s: %s%sfts_read㿘#`  #` # @   #`2 @t 1j @ ?` K#*` € ``z`! @ @+m`!`@ @z  2 ``\`! @ @ O M``@`@ F@vϔ  @$` `   2 `8``@`@ 2`8    #  # @d` @FK` ``@ @}`  "`"x  `@  "c@uO 2u`8"x `@R   d d T d X d d %s: is a directory8 m 975j3% +<;/-8@Tr  # 8!7F " @T @x`E$  #`#@g4$  ' @ "( @EŐ @dk # `@@}I " x "@`$  malloc㽐`  @T `<   @S ?@(?*$@uk a@  @xv`02@    @nu@ <d <`耤@Cڐ g  @nX @_ @xH`02@    @neG@ <d <`耤@C 9  @n* @1 @x`02@    @n7@ <d <`耤@C~  @m @u0  `"c@t @<remove %s? override %s%s%s/%s for %s? 㿀#` !z`@CB!3!# ` < ( @ 1  2Q @RW @’ @ Oz a  " Ȕ #\@C!@mː?P`? "`@>M ?P  $?P ` 1z ` ? $ @>9 `  & `` 2 `y `Y "." and ".." may not be removed㿘 @ %#@% ? (J /"*@ / J .2 J  .2 J 2    @b $ `&   &  usage: %s [-dfiPRrW] file ... 㿘0 <zc@B~!@us 㿘@EweofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:t:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGETP@;@@ /`"#0`@"00@'` d "`̺   @v ;d %j!+i'd9d5c  t@@E) ؀? faH`̑*@`&  @ `  `@ `? `@`@@ : $@ :,@@` `@t `̀  X@Ȑ '@v`%`@wb @) 2    "Ȁ @p@ߔ  6 j"x` d Ȑ`@i@t~  4 @`7 @Ɣ ' J` @a@w  'Ȁ  W@w  '  a@vg a@  @B@IȐa@vQ a @ @;Ȁ @@t, 76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) 㿘dR  T`"V@2 V  @!V  @1! V @,!z`? "`ฒ * "V@!`0@#   !  @ $ 4!  ( ,@ 0%s=%o%s=%x㿘  N  "@Ք#@ϔu`sN oz ``?"``  <* H$ @ݐ <EN * @:` ` ,?"`` * $ @ ,* : % z  :?`&  @   * $  @馒* : 4 NN 4N` `?"``  >* $ @郐 >usage: %s [-f] device usage: %s [-f device] command [ count ] 㿘d ̀` #0z!@@a80#0z!@@aP@s 㿘@tڐ@q{ ! $#,@t$#,bX@s$ @/#(86 Lost connection to remote host.㿘@"8@r 㿘b8@u shelltcpshell/tcp: unknown servicewho are you?/etc/rmt㿐d `'d"@b % b@uj @@ $b@u_ c, @ƒ @  ,,@J 2 @r $,  ,@"@Tz  ?"c(@r ,'<'$ c(?c@  c(?c@ $'c(  @ invalid user name: %s㿘N y*`:  b @ `2  _ - @O   N  O%s %d 㾘!0@OWd "`@HcloseC 㿘!d !@8a$ statusS 㿘d ` a@'!  c8@w`,`7 #8I%d %d ioctl㾘`0!@O"8@?㿘#(@s@i@s@%s: %sProtocol to remote tape server botched (code "%s").xؠ@M O؀ E F Aؐ@C$"@O؀ F?d" @sk@J@ "*@"@@ٰ㿐c( @i/ OOProtocol to remote tape server botched.(rmtgets got "%s").㿘`* :`` ,, `  @d,@` Hl㿘@m:pinvalid file mode: %s%s㿘@7 `@ @ 8 ! %j'-i) p @s 2a@sɐ @!@o@@A:?• mH* @@`2@@@,` -6 @@P @?` @`J /"*` 4`@@%4  4`@@M֒  !( @@?2@@! @ @p/%s: %s8"+-@[@uL `?,@M jbx  `..`2 @M x  /@qa?<    /@ n @? /`, usage: %s [-p] [-m mode] dirname ... 㿘0 <z` @=f!@p[ 㿘@X$OpenBSD: compile.c,v 1.11 2002/02/16 21:27:52 millert Exp $㿘!@","",@: @#"*` @ k*  $b`*`@ d!$"4unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %s read commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command㿘 -p@<(   a8@  0`` @ ~y"@ ` `` @ ~@ `2`` L@ #"Րp Ґp@  &*  *@$L@!X@ b @   @$ `+d @ ~y" @ ~8L@@ `2`L@ ,2B$` @ ~y"@ `  ` @ ~@ `2`@ R  @$   @ ~y"@ ` "L@` @ ~ @ `2`L@$$+dL@ 2 @ah@ p  @,Ma`aL@@" L L  2 L 2 L@a@ U   L@a @ L ` -p"@*` €` @ ~y"@ ` 2` @ ~@ `2`2   * * @$` @ ~y"@ ` "$` @ ~@ `2`$L@ p  $a@ "`"L@ @ ~y"@ ` "L@` @ ~@ `2`L@ ;_ pLa@̐ p`"L@ @ ~y"@ ` "L@` @ ~@ `2`L@ \Lb@ `"L@ @ ~y"@ ` "L@` @ ~@ `2`L@ Lb8@ @<f$ !`' @ ~y" @ ~8L@@ `2`L@ "bp@c "@`$ ?=$& @Jʔ!?6$jbx!@ "@H +p`"L@ @ ~y"@ ` "L@` @ ~@ `2`L@ 2bp$b`"L@ @ ~y"@ ` "L@` @ ~@ `2`L@ $ b@N$ ` @ ~8y" @ ~8⸐@ `2`@2$ @o7 b@ِ @p`L@  \b@ʐ @~ @\$ 2c@ @@. "L@ @ ~y"@ ` "L@` @ ~@ `2`L@ ;~p$`@ "L@ @ ~y"@ ` "L@` @ ~@ `2`L@ ; d`Vpc0@m Pp h l \ \ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])㿘'D @. `:  h'D \ bp@/  DD] Db@$ DJ Q . : !J [ @JD @D @";D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J& `(8]*@ 2J 2Jn*@J` ]*@J]2 "` RE error: %s㷐&  @m &@@  &@@pN  !@@*"0@H @` *" 123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expression㿘   l ,@`$@ @Ӱ c&`"$`&`&`@ N =/ : 75/*`:  \$ N@耢 "N,@N``   @ݒ`&&` & \2 ,@ ` 2 @Ȓ ,@N` $@%h- @m#x@Ғ( 2NcH@ more than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'㷐'D ?&@&` &`&` !%#DD  ~y"@ ` D'D  ~@ `DJ@ g"  p 9 ; 1 j h jJ@dDe  w`^D @@!H [&@ X&` @6!HDD@ &@M 'D ! ` ~y "'D  ~8D@ `DJ*'DJ  2 *ax@ @"`&`& @Gj!? &` j@^bx@  D J@@aD c'Dtransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthN  \`p@ ` 2?1`c? T 2%`ؐ ~?y"@ ` ?  ~?@ `2 ?#@kȐ@@kŐa@g  @  +@  (+@?O#@`  +@J &@㷐 @ @  ~y"@ ` "J  ~@ `2J `\2 J " J "  +J   # +$(, @@!( @ ,@@unterminated regular expressionexpected context address㿐N 9 \ 06  $ /`( l` 2&@`@̐ &@ &@ &@@Ŕ &``(@  whitespace after %s㿘L@  y"  N  ` 2`.a@ & @G@bundefined label '%s'㿘. ?* : `#"*` €b "b & @k &  a@` @g  2   $ ΀ ΀ ΀ ΀ ΀ ΀ ΀ ΀ ΀ ΀ ΀ ΀ ΀ ΀ ΀  ΀ $ ΀ ΀ ΀ ΀ ΀ ΀ tduplicate label '%s'㿘    `,` `*`#|@ @' 2  @} 2  @ 2 @ $$ $ $ $㿘 ` ,`  `,` `#|*` "   2  @H 2 $ 2  unused label '%s'㿘#| *` `'   @ @fې`2 `*`$OpenBSD: main.c,v 1.6 2002/02/16 21:27:52 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %s㿘@.d +)#!j'%/i57z;#9j /8z* c@€ %" "@$b8" @    $0z!@4ےap@gА @8h?ڐ?Hb8* ` @ @`@ɐ `v@  @@`@ 0@Đ @l,@E @,=฀ "x@aД@ @g Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ 8 Ҁ Ҁ Ҁ D \ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ Ҁ tr%s: %s"%s" ..."㿘'd  V!  r0#!%`2` 怢""$!@!`@ϒ`@怢 "aj !bx@$ H@   "$`!P@DV   X X ` ,  `* `* `* `**  ""a$!@Ԓ b$  "b$N #2Q N  nM ""0I a!@+"a$b$  !J`# J  n "b0 *b$!J  ! @!$`h@#!*b$ #b$**!b$` #!#b$`*#!Քstdin㿐!`?)'@+1`$ᰀ ";  !z`cP""$ `@@$"  $"jbx!@f H@ `? "`@. @  "@@ "(  & c %"(`  \%"(@獒 `@j"xb H @/ @ @$z``#P"$#+31'j@*a` $a`!$%b $"@祒`@  $"@x @ H`? "`@.R @  "@@6  㿘@( dx" " ""@"x㿘@ d|" "@" "|$OpenBSD: misc.c,v 1.4 2002/02/19 19:39:39 millert Exp $%s㿘@dD  jbx!@"@> 㿘  @do  jbx!@"@' 㿘#a @d>P@Qؖ ʠ @Q$aased: %lu: %s: 㿘z'L!'P'T'XcL@2| 4 a  "$"@2ocȠa@C@2fc؀ @eX $OpenBSD: process.c,v 1.7 2002/02/16 21:27:52 millert Exp $%s %s: %s %lu 㿀""$' $`/+,@ " ?Ƒ* : `C~#*` €x#a  !**@ ""W*`$"a*`" * $Ԓ " " `I"`UE Ԑ S"`` N `@g Ԓ `?$ " @^k$`;,!!@Y 2!! !`А @L !`@G      @:! @  @ b0  ` z`Ԗ@36 @kԐ  2$ @d @aԐ 2"0`   zԖ @3 @d ` 2`zԖ@3  ` 2` @f `?$$`zԖ`@2  2$`"0` a az@2ܒ @@dC #a  !**@ ""}*`$"a *`" * $ $ @f a$ `}$a@@v"b "ro"b `2j? & @@!? $jbx! @ ؖ{ @[   Jjbx! @ܠ ؖh ?#a a`А @Y `'`'` '`''a $a $ "` "`"`$ "` $ $ $ ` 2`  @, $@Ր vb0  ` z`Ԗ@2, @aԐ  2\$  < < < , < < < < < <  < < ހ < < < < < ߀ <  < < < < < < < < < < < < < < < < h ` < < \ < <  < $ < P l < < L < ` < <\%d not defined in the RE㿀 `!"   "$`   @  !"   @  c-P? -  @x = 44@4   4! @n  `@ޒ4@`` `   @ !@V 4! @P 4 ` $@.!@A )!44`  $ @  @& ?244! Ԕ$@  @% `@4  $ @@ !   ' " $  '' !%! $  $ " $ " %"  ''` z@1   `"4   20 ` ?2Ԑ & @?Z! ?"`  j !bx@I ؖՐ  `  @Z    j  !bx@4 ؖ  rstdout: %s?c!  6)z+?1/, "* @  #@  @0 @`@㡒  @0  @} @&ґ,   `@j"x ` @i ""%COLUMNS\ \ \abfnrtv%03o㿐d#@b̐"X @$㔒`h @cԔ  < 2$㔐 <$N g!z"x)㔀@Ր"` Ny" J` \ `?"``  * $ @ߐ 7 ?bh \"&  * $ @ɐ \N@  "@?M@ " `   * $  @׮ @" N 㔒 `?"``  $* $ @ב $ `?"`  * $ @׃   `@j"x ` @ first RE may not be emptyRE error: %s㿘,  s@: & \ ?y" ` *: ?? $', :  \2  N \ &2    @   &  &  &,  4& 4* ? "*?2 ?""  "  "?@* 4  &  &  &4@ @Z$ @& ,   @   &  &  &,㿘     & && "&  @Y @& * %s: %s㿘?'%j?N  w"!  { s" /"* + ?" @W    @1x P " ?"& @W "&  @x P& 2N 㿘 `""  2 y  `"]  2  "( @  `Ԕ `@n  2 _  "$` "  U "(`"Q  * $  &"@  `Ԕ `@H  2 9  "$` "  / "(`"+  @2  "$` * &" $   Ԕ `@   "$@ `?"( 2  `?㿘  "` ax  "" J?` "?"4"   ; ;" `4 @[  "!   !Ր 㿘@hz 㿘 "&@]  &㿘@]  2@  "`" "@&@ 㿘 ? `@]?  "&&  2$ 㿘 ?`? "` &@ `"@@]LPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s 㿀bJ   !#"   P ?" "@scb? L"J`* l"@"(@"0`@"8@ dc@ 2[S"@  2 bh@Z L@dc@ C <"p 8b@J  0"@ @'" @`#"@@`  @@@`@ `@@_] @@_X@@@@@_R"@Lt #$' '$' '@p"@/' `@@u @@u@{  "@L< jbx!@ؠ"@Lv1 @> @J@ @ J@ /  @u 쀤  d@uÐ@Ӕ `@u#쀦`  "@L can't get current directory - %s㿘J"#%"   P ?b b@rT? Lb* `@L". "@J` @u @x  &  @t3  jbx!@Q# @K "@L Rnprsu,ne-p: %s-u: %s: %s㿀 J`e3    L - L    L  n e  E`2L  k   f L -b L   \  6%뀢`63"D*` €` ) '`%  @M䨒  @K   ` L`  @L䨒 6  @Kq @q?ƒ?  `*   @bh   ?$*  '  |' '' {`h ?" @k`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *`*# ` "`@I7 "h 쀣 "@Ӣ`쀦  `'j@SƔ 6&`x@ېx 2 @` @ ` @Ő   l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l  l pvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*㿘 J@  w`?  # #(!"  v ? V "    "@p?耢 p" *  `2 ?`2Ϯ ΀   ` !#@@/  ` !"@@!  " @:   `#0@J- ?` *` €~@J#8z `#P#hd#@J  #x@J@pp _\@I# @I# @I# 2 @I# `@I#@I#<9 c#d#@Iϐ + @IŐ   ` #hd#@I  @I#0 @I (  8@Idd@I#Ȁ22`-  X  ,  ` D 㿘L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=㿐J`Ȧ      r7 s e " t  "¬  ¬ $ "  `"  5`9' Đ"*` €" %" % %" %@ " " %  $ % " ` +,- -"@n`?Ȓ?`'@k " `'@k " " ``"* `J`-`+ `J  ` $" ?#@@G s "* `, ,P @  - "*"* `C `""* `64`"%@@@Ґ@8 ` ! "*"뀊h"!”!(  @@В  `@ "=`@ Ѐ` `8  @@ "`-+1)-- (a!(   @ @@H"@ `Lװ 0@GZ!8԰  ϰ @r@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@G!P"@G!` @G!h$@G!p @G!x@ @G! @ @G!@@@G!@@G!@@G!@@G}!"@Gy ? 07 €!!’!@Gh   @G_ -0@GZ -d "d@@GM! "@GF0d@md@G?#Ȁ "@  2i@ BL5  D 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0 0 0 0  0  $ 0 0 ,dprtUx  -taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found 㿈`  "` ' ''   #Ā  - +`9Ɛ *` €#  '  # ' @l(c2  * ` "J`-`+2 J    #`?` @Fw#( @kߒ @#ڰ 8@ސ`/`;9 =5d@ 2"쀢 'ch@tD"`@t@+ `2 @s =0$ * $ @l` @F9`ڤ "5)97 =@ $@@e֔`@`<`2:`27@ ) $쀢 '#h@s @s+d`2`@s =0$` =*@`$`@lZ d@E#P Đ#p@E H'@`  `$ `" `2(`$ 2"`` $ w"؀` " @7  `" @eV"$ `$ ?$+ $8 @@`$Q`  2l  8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 ( 8 8 8 8 8 8 8 8 8 8 8 8 8 8  8 8 8 8 8 8 8 8 8 8 8  8  8  8 8 8 4adt㿐"  !%" t ? a" "  ##F "@jp?〢 d"* ` %@~@~ 2  `" $ ʒ ?$  2@Z   $b ?$@P 2no arguments㿐   @D:#0  `? @:ה   lpnz㿘   %'"  p ? l  z   ?% @j3㈀?• n* `2 @L 2 @K 2   bgjob control not enabled%%㿘@)` bJ` `? #@CƐ ( d@ib ?b * ` @Jd `  @JZ  J `" %*d %*s %s%*d %*d %s㿐e h`+  ǐ #\#`@r0  #`#\@rbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %s㿈  ) L -&#  *   y" ` 2%ǐ@  2 ǐ"`$ @nbp ) ' #%"  s ?b" b@  2 b ǐ"`@Bް b@i"x?ဢ lb  ,`   ǒb@q# d@Bِ#    *e l '%@f<  '?  *`" @C^  @CY   J"`ed lc 'd%Ǒ,`@C@``d@C9#u  ' `'@G  e h  ' ? @U@4'@U@4 ? ǘ "Ԗ  @iÚ >   6+'L % @H 2& %`@e쀢 @B:b ?  @  j`@SÒ 6 `jbx@ @B  `,` 2L㿘  J"#뀢`c  @h"$c$ missing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARG㿐!d@h" ?" * ` I  B 0L  @wJ`ɐ H@A #`L`2ɒ`h@A v  2``?@&  '*`2㴀@    *`@@T @ɐ @A 0N$ @g  `? `   +// /` ?///`?㴐" ɠ @& {b& " @  `@Ғ 0@Ɣ @@ Jb`?    @ ` lm㿘   !#"  m ? " + "@gFch?쀢 l"* `2  @  @ = "*@`@ 2   2 )  ) )  ) ) ) H ) $ )  )x ( )p  )h )` D )P )@ )0 t )( D )  )  ) 'lbind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+aliasHf`?%s: bad numbernothing to shift㿐##`d@fb ?") b*  @7   6 ʒ@@e!   +   "   @ " $ $ @@R" Sugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask㿀 !# S" "@fYb? ?"*  2;@ * 2 @,ʞ"c8  =  , *.  .   < " . . .?#@@ ʐ#@@  * А   * - ВБ:  @N "- #@ * 2 @N8`y +ʀ g  o a" I N u"@NN`@5#( 2N" Ic0*`@*<` P  ?* : `  ː#T*` €  < <I"N N`@#8 2 @U-<``- `=`+"  N,N-"-N`,  @c0 "NN 2+N 8ʐ#H@?= - @2   .D .T .T .T .T .T .T .T .T .T .T .T .T .T .T .0 .T .T .T .T .T .T .T .< .T .T . .T .T .$ .T . .P%s: %snot found㿐!d@e9" ?G"* `A " @1z  "ˀ`#+ +#* @ # `#@   `@       @[ܖ  jbx!ˠ#@"@> 㿐!d@d" ?"  * `  @D  @D `2  " prsu,-p: %s-u: %s: %sREPLY%s%s is read onlyp  'д    #2+"0' s ?) p b) u" "b @@SԨ b! L   @?Ԩ 6 bԐ!@>G' b@dqa耢?ʀ rb* `̐"?&@> @i@ ?  ,@Q ̐"@> ! '#  F' ''ܶ  '#  8'' '  9뀤 쀤}?#`"` ``$`  $`@k"` @(`$  @z @ $@ ؐ?$@^/ئ,?$@^$  M" 2 @Q - @T8 c@T & # ,Ѐ \    * @` 쀤2 `   2  ,  2`   2,쀤 " , ?* @  2?,@-$ O"@i&̐"@=X 08    @ @ʔ   @i&  K @i ,# ` "`@<䀤 @> 8`?㿘!d@cH" ? # @R`"* " J` ""` @Z trap -- %s bad signal %s㿘!d@c" ?"C *   e h%1 " @=~@@c  @=y P ) @y_    @< X `"L@ -2L` "    @yD  "?@z 2 㿐!d@b˒" ? = "*  @_   " ʒa@!@`!?倢 ?؀ "!@ %,  @ 켒`؀, ؠ *@` $@*@ , `$@@   @ *@&@㿘"V?,? .`?,@P=  0?,@OA `` `㿘#` "" c. ` R $L@CL 2    c R@" @$p  cc"   E / E ) E G4 E ; E DH E ; E 7 E C Ex 9 Ep ) E` 9 EX < EP * EH ?$ E@ 8h E8 14 E0 2( E( G4 E ) E Z E +T E =*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tx Ր"lc L|'''' 'ؤ,`2@xc ,, @oc @9# h f ,  ''܀Zؤ V "+€  ꀤ#  €   @ ؀`ʀ0ܐ?'܀  M `@ c0 "'  @ `?`?€  "'ܤ'@3㿘`!Ѳ"N  N@ *`: N`2`@ 2 `@  `?怢 `N@ 2N` internal error: unknown opȀ  `#Ԑ *` €-N%NN !`? 2@Y~ '4'4"J '4`?@  @ @ @@&@ T <  D @w H < 8 @k < < , @_ 0 <   @S $ <  @&_  < ( @;   < 0 @/   (@&   $@   "@ @  Ȁ 4߰ ̀ ذ  @[4 '4 $ 4@J'44@  # @ @  @^@ `? @Z @ϒ: @Z 1@’3@2 @  $ 00@.  ,@-    r$`-Ԑ ȓ*` €0, d`?0, ^@ 0,@Y W 0 ,̀@0,@M K 0,@F D @% > @%8 X@44 @%8 , @%} X@  @%o  @%i8 8@<  `? 8   O O8 Ol OP O O J J J K8 KL K` K K LP L L Jd K M L L M J M$ Mh L K K$ N NP N N N N N N N N PP O P㿘@%&8`#`@%  <   I  ?  ` @0@unexpected operator/operand㿘@   €  2      `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@%missing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator㿘 2m  €   2_  €  2X ԐP  €    2  Ր</   2  Ր + €    2  Ր8  2     @ՐP?  Vh V` VX VP VH)(!-a-o㿘   ``? `   "4*` @`?   $ 1 ` "㿘%s: %s%s㿘 .`   ` &@5#p0Ր#x@5  Yht YXf Y@c Y0d Y s Yl Xm Xn Xpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %s㿀J"X"X`    / H-bX S* a*`  * * f"  a ?' H" " @ZbX?퀢 S##` "L2  ֒a@4o  *  @ 4  ֐!@4! 0֐ @sa 2!#?@*  䀢  *` 2 ֒@3! @I : 5c vc#-+' 2 @>:耍  2@4Ѐ2 2@4~a : @  @4s 2G  *@> 2?耍 2? @0G j"x !!@"@3"  2 #2 2@43!  : @ r @4(! 㿘e#?"(#"( """ ""גb̐@q ! <c "c @"bl@0 *bp  lCOLUMNSLINES㿐l 4#bx."lf`@F`h %   d"cא"   @} "@|  א"   @} @{㿘"l`@r bJ` J` @֒ J` @?@Y 㿐 "H`  @N @p7 @J   @Z j"x`쀢?㿘@^# 㿘# `2@a 0"* "㿘N #    ?*:  @` N$  *@`$  N P"h~ v""hcP`#'`(b(`!'`f'`'`'`'` '`$'' b(' ' ' ' ''cP` ۖ w$b( "p'ݚ & & & ܔ & & '///@wZ/L"pb( 2 ?$b(L"p  L"p?& L"p L"p?& L"p  L"p?& L"p  L"p?& L"p  ?& @   @S0f` @w cPJ   J 2JJ- + 8`(8  J            `?J `2"@ 㿘@z / 2 +٦",`آ ,`,  @Ɛ  @S 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @  a  @@A  @ ,`@  @8$`@M,`` %@  J?`/2 `m*`'' @' $< , k, @''',`@@"`@' $< , P, @'''" '4 2 @&#N`fileglob: substitute error( @?1 @   5N@ \@ 2.@  .@   N@  \.@  #@E`"" &#@>ڐ !&#ڒ`x@0 U  ` '''cД$ @  $< , ݔ, @'''"@`'"@ ͔    . `2  @˒ @ J`2@5 ⿒` "&&㿘 @@`@  `"@FPATH㿈`ذ @#@J c┒`c f` '''@:@5@0c    @& L  "@M@vΐ#@wd#@?":   &cN` Ac. * `    $@@ $`2 @ "$`$`` ?ږĐ@   c,  &@  c `*1d@UK?  @  .&@c` ,`@.. &@ @' c$< , , @'''"@`'c"@ ᰔ&;|&()`㿘&'  @ \ *`*:  ' " ` = :24J &" : \2   6 J ` "   *` *:  ' " ` = 5$ y" @ `    `2  N @憐" ` `N / N /2`?'&㿐\`i '    #ژ @  `$  $@$'@*+?@!㿘` A #`@N.N '%L \2LL  "L `*`[`?`$"LL  (2L@  L /"  L  \L  N ~ *`.@*`㿘 $ @A@ @*` @`@K@J    K@ K @" @*`㿘 #, @ " c` , c|`㿘`@A[" (NN / ?N /"?N /2?N /2& *&㿐@h @Qf @` c`$< , , @&`&`&@c@N`@"@`&@@hʐ #㿀@@  c  ' '' '耦r@7 : @@@@ `-" @M @ 2 @,  @`,@   /,  " @M@@ $@ < ": 6%,",'@ @䀢 6@䀢 c@,  $@@ @8;@ߠ`?`,&M@`ߓIFS\$(){}*&;#|<>"'\㿘ݒ @t#h@u  ) 'ݒ ƀ【 ƀ &@? @`N@䠐#p N@䚐 ƀ 〦`?`ƀ $ ~ ~  ~p t ~` D ~P $ ~8 l ~  ~ } } P } } } \ } } d } , } ` }  }p }` }P , }@ }0 \ }( p } } P | L | 4 | |  | | | ` |  |x @ |` |X |H |8 | { { { { x { ` { H {  { { {p {`  {P {@ {0 8 {( { commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD㿐""b"#b#""".1#d#ܔ%  ! "b #(Ȳ#"#b $b$#b " "@"##b#" @A !"`##c#" :  *@s#?$"ު X) '@ j @ "̓*`@  @  `* @*`@` bȀ 6""%"* * 㐤`X* @$㐀 "  0 0 `".b0"@gz  @I1 㿐 2/@ > 0/1"?? &"@C"&" 㿘㔀 @ % 0bБ>  *  *` "J ""㔁 㿘#b"@ !" "@5>"@5:"b@$"$b@ ?㿘"'@=w֐ ?@ ""1b" `?"@⠀  "@tLb8? %" 㿘  㿘"b!@   " 4$"" @$""@ 㿘⌒@@ 0 4"@  㿘 aĀ % @ """Ā `@{b?" "b  )L@-@ ␒"@4@0%""`" `4@J  @@  "b@ %" ?@L?㿘@  㿘@ 㿘@T b@㿘@K  㿘"  @ 09Ⱀ??2#y"   b  ` *:  _ $2b"    `2*:  _" $"Ⱀ??#@G 㿘"  @ 07Ⱀ??2#y"   b  ` *:  _ $2b"    `2*:  _" $"Ⱀ??#Ⰱ㿘" b @9""0b  "$"@J" "0  "J@`@X$"""㿘@??@T ??㿘N  * @ : N`  yⴄ    㿘"@N`b   @: N  b* 㿘 y@;"0b  `  @ ^  ? @@@㿘"b@   b 4"bb Z"㿘b @Ґ    4" D@㿘"b @*#b??$b%怤 ␀ @߇   b@} b@ 0??$b 㿘@s""??#" b2J@{ 0 " ??#" 㿘@j @h ܰ " *@`"" 㿘c@6 㿘c@/ 㿘b* @%"@ 㿘b* @@ 㿘"`@c0 #b#*@ * @"@ 㿘#܀ # !@ 0 ""b%"@:#"""@:"@$b$@"@v 0@ 㿘#c"`" :"@ `z 㿘"b "`y01 I-search: 㾐?/B )3  J??..?# %*.@ #` `.!"@f  "&O`^ B?` @"@f ``@#@@\  "̒  `@? 㿘"`?c܀  %@# @T 1@9ڠL@`^ ĐD?0 cܠ?:@@ #?$⼁㿘J@ ^`@9@K   ?@r ?"㿘%#*b' ɠ$ b@$b ""$#"+@""@ 㿘bv 㿘bo 㿘@? 㿘?""@ 0@ U%"b  #!# @=  # $  "@"@")b@2 b""  b 8/""@  ┐"& /@  b?@"@  b@  > *b@8 <@?" "@} ??"L⌀8? &b㿘1"" @c 03" J"`" J"J"CJ"@J" ? ?*?"*J"4J@"1J" ?*?"*"J@"  ? 㐁   㐁   㐁 㿘"b" " #@ "@ @ """@ < ~ r  㿘"b@E1#c8* @ "#׎# * $@ @m &# nothing to yank㿘# "c"##?c8* @  ##""bΐ 0@#ϐ? yank something first㿘 "Ȁ 0  '@ې 8?& '%*`8@8'@ b"  ㌀ ?$$㌑* @`㌔8*`   """b""#"( 㿘@i  㿘Y" ""#"#b *@j?  㿘#@Dݒ`N *:  ^2*@ N>  ?`  +*@`?` N *@ yⴄ ` x ^*"x@ ?*@*"x("x%s%s = %s '%s' 㿘  dc!Ԡ"@$ 2 !dc!ɠ"@$ِ!"@$Ґb̑.  ` *`ޔ  X * @$#0 bБ.  .` @$#cannot bind, not a tty%s: no such function㿘"̦` @# ð #ޠ X  *` *   `2 @$c :   ,  ̐@     2{̠    ,  @     ` 2N@Xl . %ޤ \  : . *  "@ܒ 2 ; . ޒ`X*    @#rB ې@Cb ̳, @ 1怢` ."А@ չb̔@*"Ѐ@ "@@"؀ :*"  * *+ @"؀ :*"  * +  㿘#bO?"bY#  "b̔ !"* "̘   + b̐@* b̘   ߚ"  ` ̑*  ` @ G* `b+,$"И +   bГ*" + *  ؀ 8("8̄( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $ ā 㿘"Ā`@V 0"@"@"  Ɛ $bā 㿘Ā"  "0@6  㿘#%')+b"@bb!f " %b$b$@5$%"/@$$$b%"%b@5?! @  㿘 @`  㿘 @Z  㿘 @T  㿘 @N  㿘 @H  㿘 @B  㿘 @<  㿀"#"b#\#`" "  7 b@ 0  7@ )"?%d.  뀦6    㿀"'"℘#\#`" "   @ 0E` _ 08" c @ ݐ@@# ` J /`dd# ` * \ Y㿘"2`@":`""  #" "b"bb>"d 㿘d`?" ` `J@"J``""a 4 㿘  !"""" m "" "   "? $""` "`b?@㿘N怢`"*` : N b*`㿘    %#y" `   , * ?  ⴒ @ `,     $b$h$$b 㿐1"5%"" ∐ '"@  " $* "#b~#"    _  㿘#@`S 0"`:@3ؐ?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' &0K N )   " '!N    " '2  N  "  "  ""  '" ?`"NN     " '2 , < .. 㿘@ U㿘@  L㿘@ C㿘"b  0s"??m!" y"b "  `*:  _ $2" L b `r cb `sah+  *ys4r b ` U#+  U b  `h *  `㠓*@ `*b  ` *:  _ހ U $ۀ U"??!"  㿘"`'b"  "  N  b$☐ %"☁substitute㿘'#㈐ c@4F`$ $$c@-n !"b@ ㈐`џ$cc@L㿈 C!# f``'''@ c j '''" '`"  @|  c$< , K, @'''"@`'c"@ ; 㿈!# !` '''@L":  d##5`㿈!# ` '''@." :   0d#@ƒ#`expand(NULL)%S%s: bad substitution%s: %sparameter null or not set(  'ap@ʐ  @j  "J`2J 2J 2@!#  ''У  '' (@  ' ''Ԧ?$@@>Ð 8. €N   -  €ب Nհ N Ѱ   ڸ ظ   $,@` (,@N ``?$@@> ,@N `4 )@’2@՛  ' #  $,@` (,@`,@N``?$@@>[ ,@N ` ),@`,@`" ?/  @@d  @eŐL n?$@@>.  ,@L `\  @E ؒ@  @aK  @,@_Ӑ ,@a!2D  2  # Ͻ`" " $ 4$@ 444 $` ` %"  = #    ?  ,@` ,@a `b"( @` ,@T T    %"  = #  E ?/?,@` ),@,` T@e T@2' T@@0^ H`@ @e@e'؀`2T!@ @ @ݒ!@ N '   '~ | 'z ) 쀤@~ J  l'd   J  b'؀ W䀢 2  '܀`N'd#؀  W䀢 X FW䀢 D  A ` % '`  ?"` `  "`@Ji  뀥   ? @J '? @G'W䀢` @")"b 2耥  2,   *`    *` n 2,@i ,@`·$@`@$@ @ @ @ ?(`@7(@`` `c$< , _, @&`&`&@@" &@` `c$< , I, @&`&`&@@ݒ@"@`&@(@  '  ''  ''쀥 w  *` x v  R,?߀`]O"*` €G [`@ ,@?`< `,@ 6`@3 {`@0 ,@`*`( % '  " ('@  @ 2  #? ,@` ' 2,@,@``,@`    4 4 4 4 4 4 4 4 @ 4 d  4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 @ 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4  4  4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 d 4 d ( 4 \  D T P  h %s: parameter not set㿈N@ $`N@ #cNN` _ } `@o [ % *O  * @ *O  ] *@iY@a  @2 '$+ 2 2b @ #`+@aq@b'dc @-@ +bJ `   2& P@[ &@:Đ㈰ @:Ւ`$$@    N :  N   N * `@  @2?N  J  2&?&'N@ * @'  %%=##`` 2 `d#$@ @ +  @`$`` ``?$@$`4`  @Ѷ [ t O  * @n O  ]j  %%=#!# >` '''@h@`ɦ  +  ㈠$< , 6, @'''@aߐ"@`'2" :  d#$@O `@  ㈐ -`6  ㈓,   ,   '''" '$`@ `$`$@O  @`?4` = @ * @ B? ?@`g@a$`$@ + . @2 "@@J`d#@ += -?bJ b bJ `d@#@ . @2 + P@/funny $() command: %s%R%s: cannot open $() input㿐#!`@.? #"`@R"@ $#O V@ .``)``$`    " !" @[Z @-   @CC 0 2!6 "@ܒ@F @C|  @  @ @! 2@ @@ 6 &  㿘@Ѐ %2#0Q@0L@8J.@d㿀@`$< !#' 'ʇ!' ''쀠`  @ ʡ`@&> &.@UG@2|  2   2Z @  "  @  L / '< %@(@ @8  ? @   2. @ (*L /%< @ (@2   @f8  ? @ @<  2 /,@`,@ %$< , , @&&& $@@8"@`&@ /,@`N /?$@@8,@N /`@1 /  ,@*ې @;E 2,@$ @" @7@b@*Ð@&@=P @#@@ D  9@ ` . L 1 .2LL +L .N .#@:˔  @* @"@@7@)˔@&@ @ת 2J`@32,*+?@! 㿘@ή  -$@@)L@`" @% (2 @`L@  @ `@Ε 2 @ @ ,  ",, , `L@  @,@А㿈 #' ' ' 'L@?"@$ `@79 ``*@L@` 2 *@L` /"耢 :*@ @   @.  N "&@?$@7  2,  ,N  &HOMEPWDOLDPWD㿘N  +@]E"@^r2 NN  2 N@]8"@^e - N  @]+"@^X@ d#" 㿘!#@Pa@P 2 @j 2   @6b$ `$ 㿘  @Ò  +N {2( N   `N { }   ,?2 "N  逢` # k$0e   c$< , 3, @& & &ǒ"@`L& 0B> "& 4 N { },  ,? ,% 2# `&#`@(?@(:@@(5,g  2㿘 @ %sPS4%s%scoprocess already exists%s: %sX'D'H'D   H H DR` H?D@ {@4D "H`@R DR`YDD"bD `  *`#c :`'H$DڨJ"`4`/# !"@["@]͒ @D?@ "%d#d  ` cȒ@D( @ @@ʐ# ` @LH ;'HD` 2 !DR`"!DR` !# @`# @"` @'ے D `%D `# %'d@ 6 '`R$`` N@J@ D@?* : `<"ؓ*` €HD@'0.DH`H  'HH 'H@!#  2#  @sR @ #` 2DR`!!@ @a DH@` @W @H 'HD`'DDR@ !# ` @rR# ` 2 HD@`@H`ܠH "'0DR`DHŒ aD`'DDR@ HD ac@&  c 2 @Ғ   @% @3@2"` `   @ڐ"@  @ !#  #2@ # b`2`@2 @ @$  쀢`$   @֔ @ $b`@̔  $ `$ $  @% H c ?2'HDHd@b0VDH %`D!E'D `D R@  `? DH H!'H03D!(`?D '`"` |'''''0 'D` "D G#` #' 2@#`?  @2f@2 c @   'DR` * `D@Z` '@[DHʒ a'`0'D@Z`@[ DH a'@/ '0# 2#`?  @2@1c @  '0DH a'D!DR@@  `? 0D `~D!r DE D Hf a0=D D`'DD`aDR`\D '`  @6;  '@ D 'DD 8DR`01DH a$D`D@HD׈ 0D @^@'@Pi@2DD`@Ljbx !D@@ՠ"8@?'@1l"`H @1  H! J"`@0 @OB  ٌ ٬ $ $ ݘ ݴ   \ ߔ ߔ \ ` d_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not found㿈'H"J` 'P 'J`    2 ( #0"@\9 ?@ZM HL ^""@ 'HH A#8@H c   JP 'P*H ` <"@7  # b@7˔cX p?+  J"`Ȧ ="*`   @ג 'HH H `H `H  `'H ! H Ha@WH H ` Hh  J 2  @ "B7 +)  CM!`(`2  @W"@YΒ  @@@b  ` d#d#Ȑ  @@/  ` @<ѐ   @[j   @ Ȣ``"'0fH J"` @ /  cx@͔S @3'HH    0D 0?H@0:H`NH `H `H!`@# @  ~ c@ H  @- Hj !bx@# @| @J@f @  H ` @f 'H'Hh"&"# `" `` !#H`"`(``  "`  `"( ", "0 "4 "8 "< ,"@"K ! 'H H2 + ! "'H#"2@ؐ   H P  a"`H*H" }H@ #@ &$H` HH@H ?"@ @TH"`"*` € '0a@.@.@.`0@  0UH`H `H!`@3 @ @? ~ `X@9  @c`3 "L `  (#0"@Z H @X2 P @lP "!eL  !e @N?  @N< H c2c"  P""@є?'P " @.-  X h X h h x x hEXECSHELL/bin/sh%s: %s: %s㿘@V8"8@We L " @ L 2 "H  "?& " @I@j !bx@"P@shcomexec: %s㿘#b@IJ@I c @g @㿘#`    @I  L @I& && 㿘 @Iה  2 " ?$$, ` $ @S `2 @Iߐ`?@Q`$ $V``$ 㿘 ! N = *a +@2"@@H͐@Ig` " "" FPATH㿘@HJ" /@8   q` "@I ` @2 /`]   @UA!h@Vndc  & &  @ &   ` @2  ` 2 % `0 ! #@H˔ #`   @     &b ?&  `  T P`N `   #@Hƒ & # &  & "#  @ # @.Db& &  &`@T!h@Udc   @_ c & "c& 㿐c@H̐  J`/  b $ ?$@H 28@)  '?@ `j"x <   I  ?    "&㿈2&@ / Ő 2X 0V"@Q@   #' ' ' '耦`:@ : @ @$" @-@Ҕ /, "@@-@y N@ ɲ`Dz  {㿘'@%!"$|$| @7  #"@3$b  @@8ɐ$b $|$|%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %s ?      /J "`     ' ' ' ''''J`!!'! @@Sx"@TT H  @Nݖ@ /?`P!P*` €I G" J `B&  @?@ <  30.."   @ߒ `'L -  L 2 #     @ ̔| !"8H @N |@ 9 ?J ` bcx@ * ?@! !뀤2~?   P   h p xj@bx@  c?# *`R   ?@  #` *2 "@@ =@    ! H @N& j@Gbx@ ͐  +?@ߐ'?`@ِ` ` А#@   @ @    @6   8 @ \here document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s㿈?''D 'Hah@ v ?!#  @@  ' '쀢`  `@ޒ ' `! p hj @bx @ I쀢 T?@6<# '@*># @   H@*G"#@6?@C䀢`#!`@ 0 D" "$#@X !a@ j c$#: @9Þ @9D@*@6}?0@?j !bx@m!@   ( REPLY-rreadPS3㿘 + )'% , `2 #` @Q`@RJ`@;@Q 0@R@ hb *(  @Q`@RJ@ ۲ @R 4d* ?d#%*d) %s㿘.`@ P`@9ې㿈   @@&     @  '# X ''@1 㿘.`@9㿘   @@&   # 8`@1 㿐   `A`?K  K " K`? ) K  : +@  +@K `@* +@x`   D *`  @h`?   $ 㿘`   "`1d #耢   㿘qdbteste_error: %s (offset %d)㿘 &`@  ++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():x"'ؒ'@&@x'ܐ 'D'L'''@(,'c @  􀢠 *@"@(0  L d1 @#@'ː@l` (2ܐ '@N"`"@ @Vܒ ("D  @C "@Ra 0@P L@Q{D@' end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %s㿐`C"8.` €  ''&"  *( )"  * @P   H @//@ *` @`` `x ```@m 0a@g @'" 0  missing )zero divisormissing :㿘 `Y ߀ ```#@ @`! 86& `"` `?.& 2- (& `@ ϐ`$Pi  @t@  @g S `:@ @X02  ),`@ *`  @A`@5  @  ` ` ` s@耢 ``    $ ` ` *` € @z  @   @   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@ `  "   8  ?3$  @   $   ?$  %pM @Z   $   ?$ "  `$ @"@PP@O˒2&   ,`* `@ 0 H 4 D X l ` p     D X l ` p  t 4missing ]㿘`y"L  `2 &` ( `* @ 4  [ L * `2 [2 ` @U 28 `  !@&`@@ "`#$@&Ԕ@M=#&`ϒ`[ & 6 _'  _  *  @2L #"L㈐ $@&@&` }"`" `"` `@O ㈐x `' '&`   @* :  ` 2  @  M ` 2&` )&`&`㿘@@K` ` & "@OW @Nѐ"& 㿘N 2@@2 .`*   $ .`*    㿘!# `#""" " " * 㿘N`  @@" @b @O   @ "$ `ݒ @@ @M&@O @ *@&@$ e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %s(        %?3`C<"*` € b@u ,`@^c @%o@Hb`  @4M"  @" @+a`* Q   `2 2"@Ґ"0 `J@ `@[ =  #@%`$ @ ,@    2   @"V  @< @  G@–B `@"X6  2  2 2  @s"  `"x @ @W  @Q    @ @  @ `@5  `?`="" ,)뀦)753+"":@37# $"@30b@ 2 "@3%b" ? @/Đ" c @ @# ` j`!bx@F"@  !@2"" ? (@/)? jbx!@ "@l J"` # @KA"`@L1 #됖c"@!J $cT`  @-̖ 2 `@#F @   #'`$ ' '' "  $" @#"@@0 & `@.Ő,@+-$@U # $@c(@V@.            l l l l l  l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l  l  l l l l  l  l l l  㿘@" )+)' @  @, L " @#@    @"@v☀ ,? ߐc@ }%csubstitution failed㿈`#@#`0V@@  #' '  ''$@"  @#@9@4@  〦$ @  @Ґ "@$@"@$j%s: not in history%s: invalid range㿐@% / #` "* @*@ #܀ `+@P/# `!@.%"  "xL ?   1c#ܒ " : ?@u '"`@ #ܑ* @no history (yet)㿘#c  2   @# ?㿘c#􀢀@#ذ 㿘!#c܀ #c%d  "6bc#`?$#$܀`"8@*`  "#  㿘c ܢ " : `? @ cܰcܑ. @@ #@!?- @@b  c܀ c@@ cܰ&@ > cܲ@@ @怦?㿘 )"܀'%ܐ"@ : .  "@@ Qܒؓ,  %"$$܁㿘#`!#쀢  @ę  #쀢 b$#@oc㿘!#܀   "b^"?"c$#܁㿘%#ܨ cܑ* c  'qcܔ @ *cܓ*` @!Q@G$@ (%#J "*%#㿘#@5@@2 @J?` "`$`"@ , @e,HISTFILEr㻐J"`L  " "@G @H J 8"#b@   "@a -   ,@/   c "k @$@``? $@- ݰ @ցw%s%c㿘c  5"c #bܐ" :  *`" #쀢 ! @SbP c􀤀 )  "X@޹ c`@   2@@㿘 "`" N'H'L'P'T'X  3@ c H@/@.p @+c @ 㿘'L'P'T'X@m!# L@/ @.\@+А%s: 㿘 "`" N'H'L'P'T'X 3@L "| `@/c c @/WH@.4 @+c c| J"`""|@u internal error: 㿘'L'P'T'X@ !#  `@.ِL@/)@. @+z @R %s[%d]: 㿘 !#쀢  #  " @#  #J - b# @.` !#쀣     # a @.#"`㿘#'H'L'P'T` 'X!# @.֔H@+*shl_stdout not valid㿘" 'H'L'P'T`'X b "@.H8@   <   ` `㿘!" @)   0@)  ?@)  "ctoo many files open in shell㿘@'n  j"x`  Ӑ#㿘  @놔  `j"x`   ?#@Z㿘 `"@* ``@ې0Ô @Րcan't create pipe - try again㿘@9 6   &  & 㿘@@ bad file descriptorfd not open for readingfd not open for writingillegal file descriptor name㿘y" ` ",NN  2(N*: ?А @  `+ (!h(  %` `  2  !! p N  @K !&??"`""`   㿘!"``  @@:"`?$"`㿘b`   b`` @(?$ 㿘"` `  @?$ no coprocess `h ` "@?㿘  1"` `"` 6"`"` "`@?&"`  "`@?$   @?& /tmp%s/shXXXXXXXX㿘#`  @ @ , $ $$@,@T  @(# $#$$& 5 5 5argument must be %job or process idambiguousno such job㿘 P"`㬔 "@b "e"`@;Δ ) 'J`  *`   @' J 瀢"`$J e h `! .  * $ @; ?. J` "J`@ @B 㿘  ')<% 24  2.  2 "J` "%J` 2!x2   @   @[  2  @  @[q  2 `@ @mx@2"!d#f`@Ē #@w "J` @.*` j_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job control㿘 bJ` "J`@A f  `'"P @ $(@7瀢  "`,jbx!@ x $((  e#@:ٔ !@ @# &0j ,@2  e!`h ,   *  @:?, ( 9 bx, 0 @  jbx!@ :  $(bx!@ Ȕ0 $(@bx  ,jbx!@!  $(d"#bx$,(  a(  5@A%cP01瀢`" ( e!`h ,   *  @:e?, "e h `! , *`` 2` `@:O ?, "J `@Aexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last proc㿐` CaH c@  @ <$@$`$``$` !   #`hڐ ` "#"`@ ` `2$$ $#$ $ $$$ $"$$($0" "`@ Z ` 0@= )`@,@*  j"x`# `  @ _@` @ ,  `?"$` @ "c$` "J ``   `  $@` `(  `f`@ `@`hb@cb  @  @b`"J `` 2J  e!`h ,   *  @9I?, "J ``@* `"J `!e   @9/  @9+ b2  @5 Ƞ  @ː@k`"(""`* @@\* @8|a`@ `@X @GY`8@b "` $0 " `" `#@x"J `!a@)# (` %` # @)@`2` #  @(Ԓ@&H@Ӓ  @ R 㿐c@ H ` `@" @ ; waitlast: no last jobwaitlast: not startedjw:waitlast㿐c @ "```  `b bj  @    }@  @  %s: %sjw:waitfor㿐 c@    &@ #  #@2 2'@{  #   @ Ô "? @  ` !*` #Ԓ?@'  @    &@㿐 c@  @@   @   !*`  #0) `2 @ 2  ``2  @W  @W 6 jbx!@#  @ Z job not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resume㿐 c@ & @ϒ   @   !*` ː#`  ` @  *"@հ "`(`̐"X`(  +)'d  2$ $  b`  "h  2 d#@$ʐ"2$` @ݒ `"` @ҐK` 2?` (` ` f` @=`4 ( -f`h ```@  !`  cP@=Ԕ  @  ` h"p```jbx@ 0a`   ?@ $`" ` A``@W  ;`j"x)`( $``  f` @=cP ( !f# @ ^`,  `,!"x@۠"`  @ Q !"@͐j 0 (`` 7$`@  @ 4 You have %s%s%s jobs stopped and running㿘 ' #bx " J` "J` 2  2  2 " 2  ""# ## ##   jobs㿐 c@ ͐     @o ` @   !*` Ր#B  ``    !% !`  @ @6 ?   "$  2   3 "@?`H 2  @ r  notify㿐c @ e ` '"L` "    @ @  ? 8 "$  2L`   % "@蠔`2 @#   @ 1 㿐c @ (` `"` "` @  `asyncj_async: job not startedj_async: bad nzombie (%d)zombie㿘   !!2  @c@  2 ,cHJ 0B `  "  7$` )+%   "! " @6   `  a   ch  & @v @ 㿘   (& ` 2 & ,c" @L j_waitj: tcsetpgrp(%d, %d) failed: %s㿘``$`$"J `"` @Q#b  " ? @3$$`" @3 2^ "뀎`  `}$ $"J` 51f (`1  .  !@ $`($! @ ) , 6  ,jbx! @!`*    4  @;9$ &',  2 $  @;'cP,  ?R$  `  cP@;  `2, ;$,"J `  2$   e h * "$@2 $ `""` "J `! ""#  @^@!  "J ``@spj bx  #   2  2S" 2 @䶐D@䲐   (`" `  @`2`  2 (  '''"' $" @# $ " @# '''' `$` `  $`@ ?@/ڔ  %bxcheck_job: job started (flags 0x%x)checkjob㿘 2 (b 0`  `  4@`2` ,&  ``"  &  : &   &  ? #b` 2 0 $  0`"  @2   ? $ b`  @b& L : 8b 2L @ L  -b   '#!瀢  `"R``2 2  $@  $@] @  $ ` b a@tbJ `    ?& & `"@Ubȁ%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%s@ `' !p ,  @#0   ?` ' !x!' 2 +" - ( ֗*';d     `0C( `0>:? e:*p @!1``"./ :  ! `!/!' @@#U!`  2 `2  `2     2  /e *p @`` ( ! @#; `a@#`` a@# `2O %`!А '!ؖc@"  '!耢` !c`!ؚc@"   ; 7  3 )'d!/-d+``  #\#\@"2 b  !@"     ڀ` 21  d@"cȁ㿘  * &*@`  , "  2 , |`   z 2 p`:  %`m k&@L`?F Г*` €   V` R`0T@` I  J 2 @`  7  ( "  @  `"`2.&@-    2 (`@>     (`@Ĕ 2`` 2 (`` &@  _H `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D `D _H `D `D `D `D `D _H `D _T `D `D _| _| _| _| _| _| _| _| _| _| `D `D `D `D `D _㿘`0 "`0b d `" & ` 2@`"& 㿘`4 "`4b @remove_job: job not found (%s)㿘  `@2 @b 0*" (瀢` 4 @"`"4 ! # @ `0`?"``0 & #`0#  " 2`"`0"""" """㿘 (   "@ &? 2 no closing quote x'X7/3-?'xX'|'p't @'h 'l Hh '`'d%8&`<H   , @% , 7  J@  \8 `"@  쀦 " #`< &`<`<J@  \8 `"@  퀦 `<?&`<@ c`  ?"` Jb "''`  `  *` `?$@``  \-` € [> *`; *,d@=P  @ܐ\ # ,,\L  `?$@`, , L \x` @$\" 8" " "P% @ + ? ! 'J` `\8 " @  ( ,Q,@Ԑ '"  \ "+ \098 \J@  \8 `"@ = ,,`<`&`< t@ p %*  , t@ p %  \  ` $9 ,/ ,J@  \8 `"@ $͐  \ "` ? `` ?$@`  , \,,J@  \8 `"@q (: {J@  \8 `"@^ (t  @p %  % d $ % @ t2 @p %  % % | U ,,@`J@   \8 `"@ : # ,,J@   \8 `"@ # %@Ґ t @9p %L @Ð t @*p %=  `* @ 0  , X,`?$@!`,J@   \8 `"@ * `2`, ," X `?$@` , X,,, ,, , $,@]t  @p %  ,% J"`Φp @ @ 2% @ ``~ ' p?2@p ,`<&`< " \p?2@p   ? H* € ("  ) " '`<.  \  (  $%  ? % %  %  % `&`<%  " \% 2    %  '2 `<% ?&`<  2',$p ( )  % 2, ? % J` `\8 " @ )p?2@p,"@d   $ @ , (,  % %%  } *p?2@pϐ  } |p?2@p Հ (0׀ ` \,2,J@  \8 `"@x $", \ " 0  ` ,  2,  \, ) (  ?Z% J` `\8 " @F )y @C 'A '  =%  \ 'J@  \8 `"@&  P, "t  @[p %  ,`<`h&`<8  % , _ " \ , %U % J@  \8 `"@ $  \ " `  , \, ,,+ ) | ,?p@p ( , * , , t@p % J@  \8 `"@ ``?$@ `` @= " d < >` L@ } ``* @u㈐ ` L`?$ >`?$J` `\8 " @G <- & >* &  >  $ 28$J` `\8 " @" - $@$ > <  $$   > $ | @$@Ӑ$$ $d!>l"#2h,`2e,l3 )"ذ ) ; & ( 2060 |J` `\8 " @ | ; | &!,!!!& &$!@? J"`J` `\8 " @ (~!@b0zdl$ o"c@Tb `@Ѐ@J@  ` @,@`@ `J@ `Ր @I$ 2,?L? J? H!@&P#@&   !  } `- )"@& #! !8 "  @$ """ "8%]`)?! o pT p` pT p g i s o od q o rP p s t uP r㿘"bX   @b  X$bhere document `%s' unclosed 㿀 ג  '``< "`<#!' '! ''+-  $ ` c L@!?$@ , cJ` `\8 " @`ڀL  `` 6@`%'@<?$@ ѐ, cJ` `\8 " @h` ߀`?$@ , , $ `& `<?"`<㿘#'H'L'P'T'X`?  H `8`? (`8"!d#"o @# ِ㿘? <d#?$`$ $ $ $ $ $ $ 8 $ $!$ 0$ 4*! 0$ , $ ($ ($ ,$ 0$ 4㿘c @J  $@``n$@ "ܓ*` €dm#@b@`   $`$` $`X$@` `dd#$`$@M$`# $`$`G$@`  `8 $@ P" `  J`"`8@5 ?y@ `"`8`8` $ :$` `  `$ "  `` ,`,` $` $`$`8$@%$$@``@#` Ғ``8$@`2 ` d#$`$`$@  !# @@$@J  x$@ l l  X <㿘"J  ` ,  `?   @  (<$@  (,&` & #d "c@W `J`  J` J`  $ & ,F+뀥 " c@ ? & ?#+% ( @"@  `$  `H `"@'3  ("  J "   ,$ (" $٠?@ 9 (Ҡ? `@ ` %c#`d"#@  , && @}$ ,    21&@# -&+"L`J ` * J  *`  2J "L 2  ,葒    [&   @  PS1%dPS2㿐쀦 ""L V!0Y!@0,"X@1Y'@*   B@ J`$1!J`!  'J@ ! `J'@ "``  @TJ`@!#'`'@ # @А  "D "c’ @ e"c@@/ڐ"h@1!$#㿘!# @@͐missing ] 㿐 'J  \  8`" @`k"".` €, :  #^  `* @ V  S  P N   *` G`, :  [A @[ 2."  L #?&@   .L  c`J  \  8`" @   *` ` `2, .: @b 0 ?&@ڐ.p    4 8㿈  #' ' (' '')J@  @ \ 8 `" @U?$@,`: , [  ]":`  , `$&`?㿘`8 ?"`8#dc `#@` "@`$ * * # " " 8"$##㿘 <` #@J  7"@`8  # $`8J  '"#$`8!#@J  "@ \#J` "  # $`8㿘#`Ԑ!" !$ $ 㿘`~&``& !tMAIL8@{  T "# T T`X" 9 @ # T #@.8"    D %%<#   "$ @ْ 2$  2$ ̀@   @$  2  X8 D` !"` ""ؒ"@w$` $`@՞  D<  D$` D" 㿘#@>`@b@V$`@ 4"@ : , @ % N? \ @6 ?@  L  @t ? . @@ "$@㿘 % # %ؐ"b؀ 8b $ $$ @- 2 $ <  2$ $ _%s you have mail in $_㿘$ @. ! @/  $`!$! / @2  P H @ 8 0 P ( P  P  x h P 8  x p h ` X P H @ 8 0 ( whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.RANDOM$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV P ( 8 p @(@8@ 2@e  @!""#z  ????????'7k @*"c'@+)@89@!a5;$#@\ "@W #@R @'1"@K @'ѐ P`"ʢ  B  2ʐ p`   2  2%!`$㌐  @   % @$%@+!8@-b c" *@$*c?@%@.a $c@(c( %c@"a  " *`  @ j"p" *`   #`  @/   `@8"c'"xd    @/#d C#%@+`!@,L /@ P %!@  P@2 T@ @ @J@ @ w @J@ d#@, @&%@+'!@-9%@+"!@L @"x@@-,e@+ f`@,ǔ b0`b0`    @@D &#%!%!"@%@*!ؠ  #  @,@ # "D @,@@¤"#   @ V@ L   ,",  @- 6L @d  ㈐ `. @ $@$` %㲐!. @ R%cN '"L  #㈐ Ȓ`. @  $`  @  0  $` j` x!%"@!ㅒ`&%c `, %b$`j   @ $` @ @   ,,"` `  $` `"$`@ <   ""J `"L @  "L  @ , L  ㈑. `?c@%""&@P L , @L , J@ 2 "L  %b? "L % "8 @[ L `2 "% "H  @O "J ` %"X @E 0%@)"p@+(ג J@    @4 @@ 2  %@)!@@+@  %Ԑ"t" *`" ... . ..Atermcap (aBDX D@ BV .  L  ?'`9D"  3b  [  D&b"`H '@6   L   D `  "` V  쀢 b 2"b@@i"c < < < T T 㿘 e"J `   e t`e  hJ `  !f h@ !#R`)#*` €c@ܐ  #` 2`@# p p p p p㿘#c DH`44 3 c`$ $ $ $ @$c㿘#` " `  `@"` @&`  ` , R@`"   $` ` R `  @  @c` 'T@ !J"`Z`    2 e h, @ @  @K @`$ `㿘#  "    ,`R@ `@`$  $   2 " 㿘# @ @  㿘!#@`@#`"`@㿘  ! #@2@  2 㿘@)) / 2@ r  $@Sc(@ alloc: %s㿘* czd#`     0  3 J ( 2J  0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|㿘 – @  2@ `   @  2@ `*`2# *# *# *# *# *# @+ !0123456789ABCDEF㿘 t?+ ,@̐ @?,@В 㿘   @ߐ @㿘` Ԑ`@* 㿘 @    $  &@ $$  a  c  e x h Xi Pk Hl 8X 0m C n f   b u   p r  s h v   p ` P Hxxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport㿘+", . @ " @(   ". ?%-*s %sonoff㿘 .`@"J  ,!`,!,! @ ܐCurrent option settings set -o %sx "+,,?!+ب",'ؤ  ,` "`@ΐ$?$ؠ @'آ``",`,"$ @ۚ 0!+"b, !,N " `,``"`!``"(Nd#ȁp+b," ` J@  @K@ " *  "`#*`㿘"J  *`6 5 q1     &b* * * !* ` @:!@<$#@B#@P@V@L@Z   b*     cxb* "o:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifierxJ x x`   --  4x@, -``"4 @+b, J`  ``  ,@`" *  "`,@*`J"`-   @&^ / ",` J  -2,`  ,` x @ +"b,S7-`A2  `o`?`0* `0'? ? Đ8  O.  , R @#i+`s", ", `  " #J`@2`R`@ #P-@T耊 !`ؑ*  `J`-`+`J  ``- "J `2* * !ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @(J`- Ȓ,?` &?ؑ, `2 1*`d$ @j ؐ*@+Y ؑ*`" ؔ*`2'؁㿐 @qiN J`2   <#$&@  %s: bad number㿘ސ .!܃X `+ @ミ@ﻐ@@$ $ @# `A@ `?@j*+?@! 㿘   U +. M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  b@  `  | )`02 `  2 *  ``?㿘 0   @퀦   ?" ` [ * kπ # 4 Ȑ_`"̰ @̐ €Ű ?    @ "   ? 2 @ "  2  } 2|  @֐@Д "m   ?a 2` @ N  F 2E  @N@ E?B  @# @ 2     ި   @* `?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% #.   ) |?? |2  2 ` `@b 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@D "" * " " " %s%s-%c: unknown option: %s%s-`%c' requires argument㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@  2J N :2` `&`L.`1 ` 1 2131`:`;;`,@+`?`J O  `&`4&@`;2N/&` :2` `&`.`M :1 Ȁ` 1 1 1   <`` d##1 ? `#@* ?`@ &`%&`2$<`@+`?`K   *`  &`  `* @`&`&@&`<`%s'\''㿘L   *` !2 L L  *`a" L 2 hu0/L ' 2 q%21뀢`'`g$ "ax " ?L@   " *@`" L  `2F x%-*s%*s㿘# 'L`Ődcܦ @ " @?@` ` @$@6ܒ@͐" $  @,  `/2-2+d@!@ L @nȔ@gc @@&ڠ #`㿘`' @Ȕ  `@L@ "` @붔& "$@ @ $,㿘 @L6@ꑔ.㿘 @   #jbx # @  $$bx 㿘 @f   ?  @\  ?  㿘  #$`$@`  @c #`㿘 @) ? ? !j"x@$"x@ 㿘  ` d#N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@ꋐ"@@ʔ@J / /,  $'" @鮔J / /,  @V "@t@镔 "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘   Ȓ d#@ѐ c؀ #"cb@Œ$b@b@@  d##Β`㿈@鰐c ' ' @ ''@  @2*@ /*@`*@`"@㻘?&@b^N /"N Y@Ò / $@@q  N .F 2 N .2 N .  @ (:N@ /@ 3  /&@.@` @" n@菔@.@ @$# 6 .j"x` O / @ " 2N㿘"!#0`#`0 "$`,$`$@$`(@#   4`  @>@ޱ  ,  0` 2@tshf_fdopen: missing read/write㿘`"`` @    "`  `0`0``` 5aե    !#`&  d & !#0` 0& b#`  & ,& & & & & & & & & (`&& $shf_reopen: missing read/writeshf_reopen: bad shf/buf/bsize㿘`"`` @   "`  `0`0``` 5c@?   5  c` (6 5c`0  & & & & & `& & & ` &&& $Pshf_sopen: flags 0x%x㿘 6` 1# 0`#   &,B B `$ @?& &&&&(&&& &&&$㿘   @e@ݙ &?"$ ,0 , 㿘  @I@} &? ?& & & & 㿘   ` &  @ & * & " ,㿘  @"$ ,0 , shf_flush: no fd㿘! 2 0? 66c0c hj $""x ?@  *@ &  ;    @  & & @ @  shf_emptybuf: no fd㿘!   67`() hj $""xr?@ `j * &a ` d@$@2Z?  ,*`   &  " "@      @  + & & & & <& @5  "@ $%j @Ӕ 6$x   (&& $@ &  @ވ @& @ 4 `  * && &     & &  &shf_fillbuf: no fd㿘!2I  67bXӝ @hj $ ""x@ Y ?2,?  && !j  J   & "x 2  "  4 6 j"x& $ h&& &  & 㿘  j "bxW?hj $""xO?@  ?2D?@*2&  6   `" :  2  8   : 2  (   "@& &  & & * & @Ֆ 6  jbx(&& $? shf_read: flags %xshf_read: bsize %d㿘8a0 `8aH ޔ` 4@- @"&& &@`@ ?@ @$@( ?shf_getse: flags %x㿘8bPҢ `4 `0 ?(  @!,@@ " $  4@Д&@ @"&& Ң@,@shf_getchar: flags %x㿘2 8cpY   ? ?  $ @`$ shf_ungetc: flags %x㿘@2@9`4 @('?"7?``@` 2.? ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` shf_putchar: flags %xshf_putchar: no fd㿐@?9a@ ?">?@ "*`` /9aXҐ @(j`$""x*?6` j"x`@ "` (&`$&@` @ڧ  퀢 0 2 `x ?" ?``?&`*@`&`㿘 " ?@䦐@shf_write: flags %xshf_write: nbytes %d㿘9b~ `69b v `@@`4 @㼔$@@"&&`9" ?23?@ #`@T&@ &@%j @2 6$x`  (&&$&? 4 ` @〔@"&&㿘'L'P'T'X@MLshf_snprintf: buf %lx, bsize %dh'P'T 'X` :`Ȑ Ȓ P@*DhȖ'H'L'P'T'X  BА H@00123456789ABCDEF0123456789abcdef(null %s)P `  @, `:  %"N@ `2 ̒`& * & ``   U`* : `L#<"*` €CA?"<@;N@7 261N@ -+ )  *` &,@: , ?Ѐ`  ,@.,* :`@  ?Ѐ` "N@`  & , 8 ۦ ۑ* : `S<!8*` € Ϧ * : ``\< *` €   ,` @ 0,@@ 2 =` u> -9 +42 /`   04  ,@# 0"":!:!Ȯ`   4  ,@  x X,@ 0,@%$@`:!@ː ` // `d`% @"@@ L@`+ @`-` `0  )?"*3 0  ? 0 ?&   @*@`& ?` ` @` x 0  ?*`:  `&   @*@`& `?`@  0 '@, `2 < o& * & ,    @?  ?L@T &   @*@`&  `?$@@, `2 < ;& * & 4 @, W(?  \ \ 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 8 4 4 4 4 8 4 4 4 4 4 8 4 4 4 4 8 4 4 8 $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $  $ $ $ 㿘#!` `?@}$    "`Ȑ $ ) "` ؀` ` `Ȁ ` @ $``@3 㿘@" * #%@   @! 2   @g  @` $ `Ԁ $` | |$ސ $`ԁ㿘ϐ "#%Ȑ  !@   @9 `Ԁ $` $؀!瀤! $`ԁ㿘  )+ Ԁ``% ۧ %`؀  `@c쀢 `瀦 0`* &! ; &   @ 2 2  @  @ޖ $ % ԁtoo many <<'s 㿘 Ԁ`  $ Y瀢! "` # ؀a#% c$  ! `` `?@, c& J`  & "@ `=ܐ#"@"& 㿘Ԁ  ؀@ "0 瀢"`@5 㿐@U  @ @n too many redirections %s: bad identifier forselectP!# ~` # @~` @'''# @~` @'''ز  Ԫ` خ%`ǐ , "`؀aaa tЀa!a `{ a`(#  ,# oa  00"  aaa# %`̀a# %`Ԓ`~ɐ# ~Ē`#~`0 @ %`c"$ T耠 ` " `@:  a`$`Ԁ ؐ %`c%؀a"a`(c!>0ja> ,% צ%`ؐ" :  " :  2 @" "4" :  N #c@"  #$< , ~?, @'''c" ' #$< , ~(, @'''c" '#~1`" : ؐ" :   ؐ" :  " )@  %` %`Ԑ  ( )٤ { }Ԥ@Q c$%` #$< , }ڔ, @'''#e`@ "@`'!  #$< , }, @'''#"@`'@  DDEE  `'%`'''''ڐ!>" @ @G!c@V   #>a  > >   `끐"$@Ȑ@I@$0$@a   @ @$ $@Ð ! #Р$@! @$@@ m @$$! @,!>   @3   @{    @q    ؐ!cВ @!>$,ߠ % ,#} ` $ %#,|$ T  ;# #$< , |, @'''"@`'#"@ |ܔ$ #$< , |Д, @'''"@`'#"@ | $|Ԓ`#|В`㿘`Ԁ  "`؅ "`ؠ! {! }@  N 㿘 H!@   & @ @& 㿘`Ԁ   & R ,"`؀!!  &   @c @ʐ  & &  㿘`Ԁ   ئ$)  "`؀! {!  }@=     @`2$`& Ԁ $ $؀ڒ 㿈!# @| ` @'''@z  Ԣ` ب$`  "`؀( $`%!  ㈠$< , {, @'''" '`Ԁ` $`׸ % ؀|ݐ! $` $< , {ʔ, @'''"@`'㈒"@{ &  m )ڐ `Ԁ` & $`׉ % 0 ؀!Y %s: invalid function name 㿘@ ;L # A *abȀ=b J 2 @ #쀦`& 6 `&  {%  "`c ` U2` /& @Ő c& `{I  c"`{C   ` :"  @* `* `* `"c{+`  "`  "@ "  c` ?2`㿈!# @{` @'''`԰   ئ$`  "`؀;: 8$`% #$< , z, @'''"@`'`Ԁ $`Ɛ $؀߀ ;@ܐ " :  # z`  , #zː ,   '''"@`'#"@ z㿘@" " "                       { }     x p h ` newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenif㿘bؐ#@# B"`" T` "`@@@" `"T`" `@ 2T`unexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s 㿐 C  "`CB"#"`` " Cg C  #C @  @ "@R` 2`@  C// C!:̖"" " "  ́ 㿘# y`22 " " " " " " 㿘bX"#""!#  ȁaliasexportreadonlytypeset㿘J"`* :   a)   CcX@n "  e rCc`@d  r tCch@[  t2 C@Rcx   2 8   "  "  (08@H㿘 Ԡ` $ Ԁ` @ A "` ذ  J" @ ``H`D `AcD9`7(3) (`#` ` e Xe `# @ `ے  #Ѐ ce`P@`? .`,$ Ԁ2 `#D.` @ ``@`*``c$< , x`, "``"`@"``@" "@㿘 Ԁ`  $ [ @"` ؀!"$ $  @`* `c$< , xg , "` " @"` c" "1d# 㿘` & `@ " !"ؐ ?#`Ԑ .` "4J@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` wV  @*``@$.`6 @ 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 w@ב*`w㿘T  ?%  * @ @N N@@2   @ 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@ /2T* `2L`T TX*`T@d wN $@$`$`$`$`@ס`4$"R`"`"      㿘 @:`㿘T`  `w * T``  "@ 2`T` &"@: F_, &Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXIT㿘!e hi"`  2 *"J 2"@` `#` h  T` t#G!c 4"`#"`"` ` @$ T$ t$!$ 4$" $@ @ @ ` @! @ 㿘e h!G"!Ԑ!b@ٔ )㿘%djԦ "x@  $"`$x@$xSIG㿐 `* @洒 D A 4@ 1e*  h;e h %G  /`@S ,@ֈ #x @T  2 @S  @ @s x @  2  @w  ΰ  㿘e h. @ "jbx ""H`@" b"  2"""``"$bx@$bx㿘 `@<"@eh  "  @   eh  " " H2 @  timed out waiting for input㿘dԀ  H aP"H """H @" """e h      "  2@ 㿘  & 2L " @"  )"    " ! & ~&  a! $   !tb &  & 㿘""H"`e""`h  $  "   J@ 㿘e h  2 ` 0 @i< 㿘 !tj"ؒ"U & a` & N@ G#    "@& 2 G# J"` π&   &  &  @( 㿘e" `    @   `  @    @  㿘 e" @ 㿈< ";     `@e 耢 `` & &     J"` @! "&  G& #  '& ''@6  setexecsig: unset signal %d(%s)㿘  2  Ibx   ` π` & ` `  0 `  &  & %S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s㿘 ?* : `lK#*` €   #I@c   2 I(@   K#I@Ԕc   2@ I8 I H@’`3  IP IX@ *:`I `#`I#hI#p @ Ix@ I@  @ #I , @c@  , `2 IȔI @yV 2  I @o ` %I)II@d   #I@Zc   2I@P @K#I А@C `'-I`+I)I@8` "`#  )  |@(  2 `@c``J`J @`!J I@ J  @`    I@J @` `IR@ ߀` @J (@`' 8J*: `@ `J HJ P @ϐJX@ʐJ ``@ĐI J h`@Jp@' J xJ V  J J   @ J @ J@ `6@   @@Y`@ 2@ @  'J@   `  풐  ْ J @bత @ 2@}  ( ) ) ) * * *X *t * * + , -h -h , . - . .0 .l ) .< <<- << >> >| > <> <&>&%s 㿘 `       4`  @ @ `  @ `0/?`.L!*` €K` "KKK`@"LL  L`L@ L @ڒ 2  I@ϔ 0  !L (I# @ 0 1 14 0 1 1@㿘 `    ^ $Ӓ  @ϒ0 2   ^ $Œ ?0쿒㿘 %MN  , @€NҰ NN`   " ` $ \읒N앐 $쒐 (N`&* : N  )쀐 $} (z (N` * : N j ) )g  + " ( "\ $N`{  {UN  sN  NN }   }N>  ( | )7~N 4 2 2 3 3h 3 3 3 4T 4l 4 4㿘'P'T'X@P h'P'T'X   B @PE`N% Nŀ`:~M#*` €zL s *`:  L  iNbdd 2 `2 ݯ `? -,L K *`뺑:  L  AN9! ;  ;룒 렒+ 뛒`  딒?  $N 늒?  N/  zvNr 6 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 6 7 7 7 7d 6 6 7 7 7 7 7 7 7 7 7 7 7 7 7 7 5 6 7 7 7 7 7 7 7 7 7 7 7 7 7 7 5 7 6 㿘 i o 4 4V  @^$$ ` $  $ ? n$  " $@@@$@  `$@  $   $ ? nϒ$  " $@@$@  `$@ " @$ $  $ $ $㿘@ "n@wdscan: unknown char 0x%x (carrying on)㿘 #NN + * c@€N  N N  N`  ?N  N?@? ` 2Nՠ?NN?b` N ; ;H ;H : : : : ; ;$ ;D ;P ;PhȠ   8 B#ON  * a@€璐[NO NJ $ (*  : AN`? )8 $5 ( (*  : ,N`% )' )  $N`{  {N  N  NN }   }N  ( | )N < <( <( <@ < ; ; < =@ =X =p =x㿘  & ?mĐ  `- m $@$`$ `$ ` $ `$ ` "` $ ` "`$ ` "۲$  ب - &㿘 7  " m  " m   m  " m   m " @  ϒ ̒m㿘  " mv " mp  "mjmg  㿘@v㿘@ϒ /dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s㿘f  @þ?$%P `$P @  jbx!P p@h $P `@    @   P` 00 @  $jbx!P@g n    jbx!P@gנ ^ @s?$mcP @f㿘!f @\?$ 㿘!# Pl`lt$` #` P"$`$` $```$`` $`Dc$`H`_ `$`L"`㿘#```L"`T`?,` `@!"?@`@ @1 ?@ ?<` `("#`,#" `0" `4" `8" `<" `@" l㈐lR` E E E E Ex Ep E` EP EH E@ E8 E( E E E E DLINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS㿘bؐ!@” Q h`  @8a@"`@`" %s: subscript out of range㿐&@@- @0L@ [,@ِ ' &@3cټ` ck`c$@ٯ #(&Q"0ck`bad substitution㿐!#`AL@ ` *` h# "#Q#0 "   $ $ ,  $ @ + `+ ` @+` + * :`  ?Ѐ@4 +`@t $[$" L``U߀` " R!ԓ*` €"xE$  @$  :$ 7$  =x$1$ - =@* <  0L 2Z`@`@L$ !$ H I H H I I I I I I I I H I I I I I I I I I I I I I I I I I H؝㿐!# ~  *`  #$ "  $ ;$ `#    L  ɔ " L" @ $""$ $  @``@$ !$0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz㿘! @Ґ dT# M R#R#a  & `" ?.@ ?.@ `  #?. @  ?` . @ ?.@ 0 0? -.0@@2%s: bad number㿐@?2 !S!`%s: is read onlysetstr: %s=%s: assigning to self㿘$`"Sa ^ M d;#"7 " @ @ʪ @@ Sa   i &  ?` &@@Ґ @u ׌ &   & 2   !&@G 㿘"2& #" " "`"`   "`  !&@&㿘! @ΐ L `"P?" &@J @2L@d#L@   :`y"` - #- & # $4+?   *@`    ? ??ɠ?  6? @v ?L@ ΢`2 &@㿐2 b  & h  `& & "!&@%0*s%.*s%*s%.*s%-*.*s㿐@ɽ0@ "$# `h0@V @0@dy"( "  `2"@ #@ @ @@ @`* @T" T"0#\" #b*y" @ ` `@ `2`@ TN@N@ 0"`T8? `@ț@N .ys b `!h*@ `*J 2 0@N yr b `#*@ `*J 2 㿘    @@  &g@& @J =,  $& @?  hENVSHELL%s: restricted㿘@P " L [ =@  @  6   * @` &  L = #$Ȑ@  J"`Qa@x Ua@x Ua@x hU!h6` `͐ .@ @$ S2!!#gz`@y  p   b@ b2   bb "       ?$"2` ?$$ `* $ p$ p@2$ " B  `"  ? " g $  ?$`"  g   2dl#""   4&    b    `d  #㿘 " f @` `"&  ` f f `& `! @ a&!@6㿘 `* `  N* `2 ` [@ 2J1 (*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈!#!f`!'''# PT? H? ?  ; ŤL  . " L@ ?"@ L "   y& $< , eД, @''' " ' 6L2T $< , e, @'''"@`'"@ e㿘@㿘!a!@ΐ  @ 2`㿘!!@O 0㿘ݐ ?`9X `*` € ~`,&@n aL" $ >@&?* ܐ >& >& cP >& !& _ ` `X `X `X _ _ `X `X `X `X `X `X `X ` 8 ?`X#*` €#b !e0"Ɛ"$b 0҉ Ld"# ~&pe  Ԁ 0#c e b$cL /z@Y  u@ p<  jݒbe$c ~&3z4XQF!@`Qo,Ӑ!d G$#ܐ D$#b.^U ~&   ~&@!!(& ~@mA&$"!L" `& "# ~&c" ?"Pa& ` a b a, bx b b b a b bD b( bT aP c ad cH 㿘 ?`/Y *` €!" 1db"cL"$") 0X#Ѽ d "c1# dKb &#ʭ 0Ր 0  d d@ d d d d d d d d d d d d d d` d㿘 @`$2$   &     @cܐ !@X` ~$@$`$`$`$`$$`J@ `]"?["J  ][["  㿘 [@i #"@ǔ㿘,$`S!&ޒ    ʔ   㿘d8$@@ ~j#b   ` $b `$b @~;5"("( @  @2 @Đ~D @   ~r Ϯ @  !` b @ ?@) ~$b ~& ~$ ~!?! @! @Ԑ!  .! "  /?㿘"` Т\!*` €!"+  $b ^@j "b ?b b @$b  "! @ L"b@ G@ b  ?π #!"ጐ?В "$b!X*  #!@ $b@ ! /"` "`Z Z  @ R а?@  b k @ !f! "` "`@â@ < 0f   !`@ h @a*@ "@  C$byb  ` *` * ?3"!X* `L"?π "?В "$b!X* JX` f#!f   1 $byb  ` *` * ?"!!!$!!@Ų $!!X* JX` 7#!f    @k$b$b $b!X* ` "$b  @!̀ J!`  @$ba`*@ @V! $bb(b( 2̀a` @  @4"a "@"" @ ? 0@$b@ 9 b2 !"a̐ "" ?!̤ '!`y" ?  `2 y!`?b ?  `" ̠? !`@ @ᴠ? "@" $  @ " ̀'@  0!`"* 'J"`ᴘ M  - * ᴒ`"  *@ "  ᴘ ^  @* ᴒ`"  *@ "   * `" ᴐ  @ "c b    W 0X  0Ua$b@ȒaX "  ?5 0G? ? 0B"`"!Ȁ @ @ 9 !$b !$!#!@a؀ "߀   0%"`La؀`s`c`C @   @@!܀ @|@ S   @ O  @r$b  i k0 k l l p4 p4 p4 j m m㿘""Đ?#aȐ  #""b#b# "  @T$aȐ@f    .       㿘"( "( 2<"` !a`@ 0!Ȁ ?#!Ȗ"` &` ?"  * !``Ȁ ?"` `?#   #`@#` f2!! "aȔ" @ !` `" "` "`$!`@  !   "  @ې! "@Ȑ" " "Ȑ# "!~" a  "!Ā C]"ܓ.  €o f`"!LȀ "!Đ " a *"J!؀ s c C aܐ?@uI@  E a@  ? J"`! @ @ 5 !!  ?@+?!* #b`"  ` "  @b!`  "` !*@b  "!` ` "` f"!L  v( v v v v u u v v u u v v u v v v v v v v v v v u v v u ^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --㿘  %f@  @@" @  @ @] o! 2"  2@" `2@!!#a"@` @! a!# # #a@ؔ @?* : `ya#p*` €@ e `!f!P, #bܐIN` $? "  JN`@ @dB J @    ``""@ "ؐ ^ʒ @$` ,@ `  @@^,@ ,@  $ " 9" !b  "" `"  # (""" "" "b @y !` "`"]cP @ a @g"]#XN@N``c ]cP @ !;`  ` `@x  &?N@ c'N` w W!y @  ` ᴖ ?  `2?     N` %  N@ c@@N@ y@ " N@ ca"  ""b    %#aА@ ᴰ? a` "? #`" ""b  %#aА@  ? 4  !` ?"` ao?! b  " "!! @! @!` D?B"` "`  #`""!?"@y "" '$"" "" "b#"" "" "]cP @ a" "!" #b@Q@ " $b$" !" #b@D"@ " $b"$" ! `" ""b N` `@   * "  #"" "! `j " "" @ "#@  @""! R "`* c  ᴐ #  c  " ?"ᴀ   ]#`]#h]p ᴰ @ $ !!  " @""b  @!`@’e!!  " ""b   @#!`@"!`"H"`!"!A"#b !@" """ 3$b" @ ?" "!N@f"!H f!H  ?N@`?`N%ꀠ`?' @ࠒ  ꀥ ?@~@ 0""$$ x? & ?m GyJ" J   `2 "* ?&y"J  ` 2Jⴀ J   `2 " ?2J Z '##d L '#dy"  `2     "  J 2 ᴐ   #  "y"JJ   ` c @ 2 ?@  ?  ` ?#` Z"b! ` Q)y# 's%ra  "  $b#  h " a$b# *  (a` `??"`a#!! w *!(" a@ђ J"J"`"?@ @ "` !` @"   $ $ $ $ x $  $ 4 $ x $ $ $ $ $  $ $ $ $ $ $ $ $ $ $ $ $ $ $ $   $ 4 $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ ` x z $ } } $ $ ~8 $ ~ $ $ $ $ $ }( $  z $ ( $ $ { $ $  $ $ ( $ zH $ { { $ $ ~$ $ ~  4 $ $ $ | $ h  $ T $ 4 { $ $ $ $ ĝ㿘@?* :  `t  c!*` €!`?@T !`?@%  a   ?@  a   ԰?@@ !` &ɰ 0N@f"!DN`"!f!D  f FaD aD a  N@ ,ꀠ`?aԔ @u  2 0' `?`   '  `@ 6? `  4{ 0y a   p?@g l a   b?@g ^ '` ?Vy` ⴐ 2 0L! ` 4 2C?0A!` < :!` ` `@J@  $  ` ᴰ ` ??  @J@`"`耤``4 0? 0 l d 0 0 0 l t㿘 ?!%#"` a@`? ? ?!` ?"`$" 㿘&@ꀦ` "!!!В@@ ["  { ( ) 0"  } ]  0   0 ???㿘#a!"X @a` ,"X㿘bX!bX "@" 㿘!"ؤX X$`$`@M $` $`$@㿘`` @7$ ` & `& @@&㿘!" XX㿐!#"f"`a0#!"""`#a0 "`" "` t`#dܒ"@ ?!  ""8#"0@  $",#@ #@$","b4$0""4"H`cܐ?@#c#!"b@ X&"H$b@b@X"H$"Hb@b@@9 "H @5 0c"@   <+bP"T L#"X㿘@ 㿘`2 !@@6(? @4" !  &?@"  @` "`  @ `"`㿘!! " @А!&@ " "  #" ?  2 ?,? H 򀢠" ??㿘3a X??Uy @.`@@ !`(@"-!` 6)! (@""!` & !!!@2! 6 ! @(@"@!`` & ` ??2 @㿘3a NKy? <`2? 2`@(?!,& `(2? , @(2  b@2  ?,  @("@  2?㿘5 NKy? 9  2 / (`  6!?`(2 ?  b2? 6 ?.`@@?2ð 㿘3a '??$y`@` & `"` & ` ??2@`0??,y `` 2`y` 2`! , ` "``??2ے 㿘5 -*y `2 "`  6 ?`" ?2 grabhist: bad history array㿘`"@40?@ (""` g`8 ?%@$  "   @"`""㿘`"E?b?@"=?"`N ^    `  "X@f !?ǰ 0?3a@Ȑa$  " a @ka"`㿘"Lb@*@ H@e p p @$ "0 "b,*P㿘 "T""T@ #@2bL $@* +  @rbL$$bL㿘      !  @O ! ` "<   㿘!`      /<$@2  : a @" a ` <$@2  : $!! @ <2`@:`$@ !"㿘 `@k@ 㿘!b<    /)c7 `a" M - ^  0@` `  ,b<`@, `2,(`bNP <0 @ oC",.P %",",@㿘", + "@o* @ "0.$b,N@o`", @$",#$b,$b,o b,?@&b,$b,"0" @  $b,N@n`", @$",$b,㿀  )!f!L  !! a  %!\$!L! "%!!    #\#`r @d?0AѢ f %!"L"`5/+- 3ꀤ@ d# Z 2?@,`@@dt? `?!  " ``"`b % %&&a 㿀 )!f!L  !  @  $!L !!f!L  !! a  %!$!L `%!`  !    #`#\r; `@ް?0G@@ְ?orː 0s ',`@ rג @+d97/5- . @r’ @d,   ,`@+d97/5-@  @re+d f "L`?97/5-a%!ca"s| 2쀤` f "!LJ?`/ d#v r^ & &'"%3 㿀   #\#` q  o  r? 0@>?   H     ` M-㿘J"`  jm"ذ   mw ^ @mt㿘뀦 #"8 "4% 㿘@m_ mW㿘!"  " `Rzb$" $`$`㿘@㿐@w!j#@ kbd@   %i@@#?H* & @ @t@@ ` ! ." @%y@ `,`@c,`@* ?Р @2 M`@ `  .@ .3`.@`@}x!%y `2@@;@@t?Ц@  `@@``!y"@ ``@@`"`''  @" j"x  usage: %s seconds 㿘0 <kzb(@}!@ސ 㿘@ 㿘@if%s: destination pathname too long8@w,#!%k+i-/k i  $#$c $c$#@@? faH* & @ @@ . @%?@  <   $`@`@@@@^?#(?k@b@7 @E@RM / /-`?< @ /@̐ 2L ?`? ` L /"?* L /2? @" #@@Y  @Đ@3 2  Ȳ@0%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %s: %scannot rename a mount pointcan't remove %s8 @ lА! #`{@D u#` @D  zl!a(@|2`#`+@Dޒ  &@ 2" @(@k @옒 zO1al) 8l!Xl!` @|#\` `/z ```? "`@w `  $` ` z ` ? $ @w`  $`` 2 `y`Y2e @ j] "x`l!h@XS @<   @  l!x@s> @  @a:Ԁ l@c!. @E @<   @s  l @@T l!@ 0@<  @,@%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times㿈 @   l! &@ܔ! 6  l! @ǒ@o @ "j"x ?Ò* @ӫb )@ @?$  %"@  ! @0+@qlb@b "l! @@ m!x@@,@*Y @&!j ,  $"xm!@p 3 6#`2m!@c@V m!@ZD@$"x  "x -mD m!@I ''''@ע耢 m!@:@ l!  @h m !x@' /bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf㿐'D@'H 2!n DnHn` @el! @@! @ ? nn!@`H nn!@ؒ`? :nn!85`@ 2!n!hDnn`p @3l! @@ @Ӕ ? nn!@ah nn!@ah  :n n!8ah@ usage: %s [-fi] source target %s [-fi] source ... directory 㿘#0!z!`<nc(@z`<n@zcH@ 㿘@֔㿘@  2"  @5 "㿘@   @V &  @#  &㿘 @ @2   '"@% J-`?` J y +  (*J?Ї8 `2 "@ 㿐  ɒ 2  @ $$ %d㿘 @  o @   @7 & &㿘 2  `?J@   Đ "   |&=<>+-*/%:()㿘c   8"c ."cL`*L   =o"X@R "#"#L  `<" `>`! 0 0  "c  "c  "c, "c"syntax error㿘ocx@K 㿘!#   # @#  0%shc M+p)p JH`@Ҕ "  @!`@  @И Ȁ ؀  *@ "     @ߐ non-numeric argumentdivision by zero㿘#/' Ր pА  pa@ 2` @C`& ` pa@ @ & @ & v Ҁ Ѐ 㿘#   p  pa@n  ` `" & G ဤ 㿐Ң c s : -5 (?` Xq!*` € -@@J H @D B  /@1 3 QO?` -q!x*` €  @$ $! 0 @82  @2   @ 4 0  @ `? @@ ̐ʐ       ļ Ą          Ĥ 0          @  㿘[c  Q   ^ yc 㿘c  ̐ ^Zc %d %s 㿘@q`p` @+ "#̐ #`"@  qq`@Ð#0`@ӿ#@㿘@"_msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%sh@p̤   j`N""0"@q@z`M`?䀤=  & в?'Ȑ ̖ @9 qc@ ` @'̠ qc@  @̐ 0''Ȑ  @ r` @ϐ @8  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @{ Oـ rz `Oؔ?"``  *  # @ #  8@`@ `z`?"`ฒ * "@   usage: dmesg [-M core] [-N system] 㿘zrc @v!@ 㿘@ssethostnamegethostname%s 㾘@o #r'i)r @?@yc? sH* & @ @0@`" @A@| rc@ @&ג! rc@  #@Ow . 2*#@w@H usage: %s [-s] [name-of-host] 㿘0 <sz`@v@!@5 $Id: logout.c,v 1.4 1998/07/13 02:11:13 millert Exp $/var/run/utmphs!@ @ )  Ȁ @]|  2@&A @&>!@R >Ԓ?@@!, @!,!,O@RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label㹠@  `ms#h@\ < @ @ `0#$@'z/@8 ss xp$@@+? @@@$? a ,@`:s#@YP @2  j"x``@ ?,@# `s#h@ 3 s#h@, e`e@*  `s#@@ @. :`@ z` `s#@  g *` J@   $Id: login_tty.c,v 1.3 1996/06/17 07:46:02 downsj Exp $㿘@ŝ`a@ ??@% @" @  $ @X r%s%s%s%c/dev/%s%s%s㿐&j  "bx?t"t"@MȒ / @ `@< ac #\tt$@# @z& ?$x`?x # tt@$# @\& ?$x㿈   ?'  @L ?/etc/fbtabr /dev/%o%s: bad entry: %s(null):㻐u u`@( aW@MK # 2,u ؐ@sa Iu`@[  ! @sT L 0uu`@Ɣ ` a  @s< u u! @,ݔ@XВ u  a@+ a@s $@& @kd/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...㻘@@u"@X .2`@ٌ  j"x`ubȐ @,@ :j"x`6ub$@%, @S  ub@,i 0 -u+u#@XX @XSc  %@%{@Un 2 @T$Id: logwtmp.c,v 1.4 1999/08/17 09:13:13 millert Exp $/var/log/wtmpv Ȓ @2 "@h Ȓ @%G@%C @%?!@O@!,!, @j @㿈   ?'  @ ?  J%  $ Jp?2 J <"  J쀠%%d%02d%03d㿈g!   @ N''耢 '3!#$  c  @Q$#$ &c $#$N %} N`rd w!\*` €\?vY"`vbh@t dR$vbp@m#K$  $ 2 !  $  $ c *3c *@.'*' `N @$! N @$  ```'' @L* @.  $` `: * "@$ c @:c @$:  $  'c * N m!퀥c !@:@!c *c  D ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ې ܴ ܴ ۤ ܴ ܴ ܴ X t ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ $ ܴ ܴ ܴ d ܴ ܐ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ ܴ L ܴ ܴ ܴ ܴ  ܴ ܴ ܴ ܴ L ܴ ܴ ܴ 㿘 ̔0@I{ 㿐 @@`g a` 8 !`w@Voch`? , %! 8"4!!`g @*!L`g"!4`g"!@ v!` ? "!@J *  @!y ! 2`D! a? "!@Jo *  @!d ! 2`F! f(?  !`Ȁ? "!"f(! "`! f,? !a쀢"!a耢? 2 !a? 2!"f,! "a! R`B?2!R`? ` ? 22`B!``!  `w@Uڐ#p`?, )! `8? "!@J  *  @  ! 2`H! b? "@I *  @  ! 2`J㿘g!`"" ` 6 y!H + , `""@$`* @@X  2``J  뀤 + 㿘g! ")?  @ 6$?y#\`& ,` $"@ "$@  * @W  2   ,`R   ?`@ 䀤`&?㿘g! "=   @ 68 z!4 a ,` &" "$@ $@   * @W  2 `" @,` @ `"  @8 @ @@ @&@ `@ Ф  X P H @ 8 0 (    x p h ` X P H @ 8 0 (    xrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambw 0 (    x p h ` X P H @ 8 0 (    kndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitco x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (    x p h ` X P H @ 8 0 (      x p h ` X P H @ 8 0 (    bxmumlGCGVGHGDGUGLGRG4G1G3G2kobcnlrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXys3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcocopu9u8u7u6u5u4u3u2u1u0WAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPhuuctstawistsasrsfsccvrcrfr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbipalicifi3isi1fsffvbueseeiedtemeaeecussomrmpmkimmhdmtimdmbashddsdldcvsupllndveCMlevihodocmCCchcdceclctcscrblbtJJ " J`?{%d}^%c\%03o㿐?  @   @ c(  * ,@( ",@IS %c( `   \'퀤`%t` `~o)y"@J `ic(* #c(\ L 'R L\N  `~J"@J `Fc(L 'Bc(@2`c(@ϠL {3 " ,'@ '  (c(J }2% ~4" \" @J`c( ' *`' c(* (*( *@ c(* c( *@ ``(c 0`\(^ E` ` (L ^(*` `,` (/ (B s`,`:`^2 `(*( *@Z  ~y" J` `,`: `!`^``^c(*B ` `  (@'  ` L ` ( r2  ( n*( *@$  `~y"@ ` `\c(  ` c(`@1Ӕ`@  c(`@1˔  ``%c(*c(ncurses %s.%d5.2㿘1#0LUaȖ@1㿘g!J `g@'@70!Ra@#g@; @Ӓcg@  "!ga?@L! aa"@@ 㿘g# "z  @㿐g#`  e  /`R@j 0 "z  `? "`` . :  @* "@@ 㿘@ 㿘? g?! 2 ' ` `! !J `  R `g# g"  yg@*Ra!` R y y"  -g`0/ +  ,` *  `?Е: ,` .*   `*Б: @  `2 N *2%@p %N 'y*`:  $  N <"  ƀ $N x`ƀkN `.@A > 2ƀ $ƀ <[N ` ⴕ+  +` *  `?Е: +`N `.*   `*Б: @  ` ⴰ  `2 N  *2  @ N *"N /"N` `  "N@ N ` N }` ` "@t % 㿘#ga $a @h!ga4!`!  g*!㿘 " ?@;@ga""a 22KKnn,,XX ` `%%KK? 2` `  *` 2`#c     ``  *` 2`  㿘#ga!g@j X* 4!:`a`2"`1(1 11110000 0 0 0 0 000000000x0p0h0`0X0P0H0@08000( 0 !0"0#0$0///////// / / / / ///./x/p/h/`/X/P/H/@/8/0/(/ //// D.......... . I. . . ...x.p.h.`.X.P.H.@.8.0.(. ....- -!-"-#-$-%-&-'-(-)-*-+-,---.-/-x0-p1;-h2L-`3-X4-P5-H6-@7-88-09b-(:- ;-<-=->-?,@,A,B,C,D,E,F,G=,H,I,J,K,L,M,N,O,xP,pQ,hR,`S,XT7,PUi,HV,@WQ,8X,0Y,(Z, [,\,],^!,_+`+a+b+c^+d+e+f+g+h+i+j+k+l+m+n+o+xp+pq+hr+`s3+Xt+Pu+Hv+@w+8x+0y+(z+ {+|~+}+~+*****************x*p*h*`*X*P*H*@*8*0*(* ****))))6))))))F)))))))x)p)h)`)X)PP)H)@)8)0)() )e)))(((((((( ((H(((((((x(p(h(`(X(P(H(@(8(0((( ((+(('''' '!'"'#'$'%'&''(')'*'+','x-'p.'h/'`0'X'P2'H3'@4'85'06'(7' 8'9':''<&=&>&?&@&A&B&C&D&& F& G& H& I& &&O&xL&p&h&`&X&P%&H&@&8&0&(& &&&&% %!%"%#%$%%%&%'%(%)%*%+%,%-%.E%/%x0%p1%h2%`3%X4%P5%H6%@7%88%09%(:% ;%<N%=%>%?$@$A$B$C$Dp$E$F$G$H$I$J$K5$L$M/$N$O$xP$pQ$hR$`S$XT$PU$HV$@W$8X$0Y$(Z$ [X$\$]$^|$_#`#a#b[#c#d#e#fW#g#h#i#j#k#l#m#nm#o#xp#pq#hr#`s#Xt#Pu#Hv#@w#0x#(yt# z#{#|#}R#~""""""""""""""!"%"&"x'"p""h#"`"X "P("H)"@$"8%"0&"(" "*"+""!!!!!!!!<!y!!!box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw pp 4$x    T  (xD  P \ t!<  l, <, D  hp H8@   Pd t| L$ \| 0 X 0X!x@`! !$@X   L!``X84 \,  $| H l h0dHD|!lT`t!d 8H P $ h X<TT$ l ! t Dt 4d ( ! |l ( 4P0`L @ |!H0h\(  H!Tl ` \ !0 L$ dH!  L  p @Lx P 4 4,X <p   40  <L t @< X( | P1(1 fee10000 0 0 0 e e0e000eeeeeeeeeeeexep eh!e`"eX#eP$eH/e@/e8//e0e(/ / / e  e eeedddddddddddddddd dxdp.dhd`dXdPdHd@d8 d0 d( d  d dddc.hccc+c.8cccccccc c!c"c#cx$cp%ch&c`'cX(.)cP*cH+c@,c8--.c0/c(0fc 1c2-`3c4c5-H6c7b8b9b:b;b<b=b>b?b@bAbBbCbDbEbFbGbxHbpIbhJb`KbXLbPMbHNb@Ob8Pb0Qb(Rb SbTbUbVbWaXaYaZa[a\#a]a^a_a`aaabacadaeafxagaxhapiahja`kaXlaPmaHna@oa8poa0qa(ra satauavaw`x`y`z`{`|+}+~`*```````**````x`p`h```X%`P`H`@`8u`0`(` ``~``___________t__a_m___xd_p _h_`v_X`_P_HW_@_8_0_(_ ____^^^^^^^^^^^^^^^^^x^p^h^`^X^P^H^@z^8^0^(^ ^.^'^^]X](]]]/]]]]]5]6]7]8]9]:];]x<]p=]h>]`?]X@]PA]HB]@D]8E]0](] ]]]]\\\\\\^\\\\\\\ \ \ \ \x \p\h\`\X\P\H\@\8\0\(\ \\\\[[&% %!%"%#%$%%%&%'%(%)%*[+[,[-[.[/[0[1[2[3[4[50[6[7[8[x9[p:[h;[`<[X=[P>[H?[@@[8A[0B[(C[ Dg[E[Fh[G[HZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZxYZpZZh[Z`\ZX]ZP^ZH_Z@`Z8aZ0bZ(cZ dZeZfZgZhYiYjYkYlYmCYnYo\hpUYqYrYsYtYuYvYwYxYyYxzYp{Yh|Y`}eYX~fYPgYHhY@iY8Y0Y(Y YYYYXXX!X%X&X'X"X#XXY(X)X$X%X&X/{X*Xx+XpXhX`XXXPXHX@X8X0X(X XXXbxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxbLBJM UV$OLSFF|D D<ETKPxRN\WVG0IpAIU(TUO|WQQDFS0QHIRDQVHOT\DD0BFS`WDJ0BBAUTWTNAI|OMB,RLTWNSxJK\A<NIOMK8HPW8CJ$JHANSGEDHP$NM`DRLpTLFEFDO(SUEKPTTK,N8WhLJMEPDVUOXWGPADxE\KPEtANhS G<HhIU4VOWGS<GlHQOThJlHUWG$UXUTDlHNWAIPC(PPOMB8RXR4VNSFPAHPMQFBhRPBM<R(F@POSKP0FdMlRL|ILJ IO4SKPKQ8P`NDWLG H8JM$UUOdTJKAPA0W NtSGHJPV V<OTDGCDGSHGxHJWPQVTUpTtITUUdANWAQ,OMRBDRdNWFJVADEP MMHRVQHLJJ`I(HOWGU@VKhP<N WtLJMBVUO@SFAVlCKPlNPRLGIdJM0IUUV0OpT GVJD@KDW,NS$GTIEWAQOTPHE,VD$EKJA$FLH,STVGIVJTEDB@QU|T@NHQ\K KMQhB R@KDNGI4V`OMBPRpQ NSFDTI@PMMTRLdLDVOSGD`QPPHGN,W\@y`yxcxxdxxdxxcx]_x]`xxcxxcxxchxxcxxdxxdxx_xxbXxxbxxb0xxx`xxpax\b(xxh_xa(bxx`xxXxxPxxHxx@xx@xx8xx0xx(xx xxxxxx_xwcwwbww^ ww^ww^ww^ww^ww[w][wBCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsby#xy#xyx#xyp#xyh*Xxy`(xkselkbtabfont3font2font1font0 P ,Out of memory㿘1#耢 !@|o"c&##耢 2*@)!#㿘!#&@@ 쀢@ *`#@|"쀢 $#@)!@I@string too complex to convert㿘c̀ @)?"0 #c+  "@#ćI'm confused㿘c̀ 2 ?cЀ 2"c@)!#( #+  "#cc "c%'%{㿘N \ ^": ; N 3 06y % ' $6 * \#%  \  "@ `  ')  ` *` Т@  `    y') `b @ `   , ' \ :Hc#$B-#. ';c c $ d@Đ 0-# /#$䀤  @ @  0-#  #$ @ 0-##  }-# $$string may not be optimal%Pa%ga%p%{96}%^%{127}%^㿘#܀`   " !#Ѐ `F@(L" !#ܒb@;$###ԒbH$#01$#!' 0##P$#,cc$##؀`  !#bX$##Ԁ` !#b`$#saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>㿘 "    "# #c##)" "c䀦` #@)9y" `  `@" `2`*:  * ."` `A*`: %21-#`c--#@?ۑ* : `N`#*` € %-#ccܐ  %c#Ԑ  % #ؐ   % @'HN@c`(ߒ cВ`0$cג c`@В c`Pɒ c``$c@c`h$c@cђ`pN@ = + - * /YN` p cSN` ON@ = N` p N` ?Ѐ@  ?$א` @?֑* : `(#*` €c `xc `c`c`Z@$cc܀     " $$в@rN@P @ce`xF @c4`< c-`@2 c#`+ c`N@ 3 22) % c` c` c`<$c'N@ "$?$c`В %-#c#$c!N@@ ؒ@@&K N@c`#$cN@ Ē#cΒ`$c!y%`@" `2 #*:  * . c@#c-#$c$cc#-##               `P (D(xh(Xpx㿐gaȔ@  y" `  ` " \%03oH`yb` J ``:`\ !! \,##,##`@ @@fa@%>㿘bhʒȒ%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r㿈//@{l@J >    v J /2sN@%y? `2?*:  . * <2 ?N $"  #,c~c  `2*:  ." *"?N@ \@N` ^ , *`@*cc*:  $*N` <*`%y`@ `2`*:  . * / >"`:  % *N` %*b:  %퀧 *ccb@Ö b@ b@  c@  @ ;  @ c c(@  c8@ @ + `xҲO`'`P@-  cH}`bX@-     ~`ncPb`@,  2 ```o`_cX@?ۑ* : `N\!*` € %*cMc1 %.##yb @ #`z#@ `2.#N@@{c` ;N@ d8 0E&`"ch``N@ 1 2$  22N@2N@Icp  0 `(> @*c6c N@  `N@ @2N@ #XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX<XXXXXXXX㿘N  N * :`* N@  @_{#㿘* @  `*`   o* @@)t 2V 㿘#L: 2  @)` 2 * @80( xph`XPH@80( OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw`H8 x`H8 hX@ pX@(return_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_marginH@80( xph`XPH@80( OTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcols8pX@(hP@0 pX@0 number_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumns xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xph`XPH@80( xphXPH@80( xph`XPH@80box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtXP@(ѰѠшx`P@0 аИЈx`P8 ϰϘπpX@(θΨΘ΀p`P@0 ͸Ͱͨ͐̀͘͠xp`XH8( ̸̨̰̠̘̐̈xphXH0˰ˠːˀp`P@8(ʸʨʘʈʀphXH8( ɰɠɐɀp`PH8( ȸȨȘȈxhXH8(ǸǨǘLjxhXH8( ƸƨƠƐƀp`P@0 ŰŨŠŘŐňŀxph`XPH@80( ĸİĨĠĘĐĈĀxph`XPH@80( øèØÈxh`P@PH0 ° ˆxhXH0pP8 hP8 hXH0pX@0 p`P@0 p`P8 hP8 p`P@0 box_chars_1memory_unlockmemory_lockacs_plusacs_vlineacs_hlineacs_tteeacs_bteeacs_rteeacs_lteeacs_lrcorneracs_urcorneracs_llcorneracs_ulcornerarrow_key_mapother_non_function_keysbackspace_if_not_bslinefeed_if_not_lftermcap_resettermcap_init2set_pglen_inchset_a_attributesenter_vertical_hl_modeenter_top_hl_modeenter_right_hl_modeenter_low_hl_modeenter_left_hl_modeenter_horizontal_hl_modealt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxoff_characterxon_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tab`XPH@80( ݸݰݨݠݘݐ݈݀xph`XPH@80( ܸܰܨܠܘܐ܈܀xph`XPH@80( ۸۰ۨ۠ۘېۈۀxph`XPH@80( ڸڰڨڠژڐڈڀxph`XPH@80( ٸٰ٨٠ِ٘وـxph`XPH@80( ظذبؠؘؐ؈؀xph`XPH@80( ׸װרנטא׈׀xph`XPH@80( ְָ֨֠֘֐ֈրxph~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@ h* 㿐@XŒ#'@L#* "*"@ *`@*`'@  g LINESCOLUMNS㿐g!`2&@g  )gR`&` Rb&@"@& 4&@" 4&@ 'g@ ))gg!R`(@f})g  j""x%hR(@f "x 2 " 4@&@ 4&@ 4@ R`&@ 4 R@&@  @  & P&@ ` 2 `` 2 R` & %"㿐g# %d€㻘@ O / . @X @   `6` `J@ &*@ `&``   `* ?"" ` &`TERMTERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. CC'%s': I need something more specific. '%s': I can't handle hardcopy terminals. 㿘 @d" N  Ð?z!@0b@c @ej" ?z!b0@0"@c  @5 2 ?z!@0~b`@cs F`@ΐ  $$ $  $ $ $ $ $  $ $$ $`?&z!@0Ob@cD  g2Y&z!b@0B@c7 !R(,$ ,0$ 04$ 48$ 8<$ <@$ @D$ DH$ HL$ LP$ PT$ TȞa` $ @d" "a@Aag"@ !`a@d  " agg2(!>b &a J `z&?!b@/@bߐ J  z & ?!c@/ٔ@bΐ  㿘@cɐ"g  $  @*`* @ J@  @8*:  "*@`J@  @ `  㿐@c' @  "?J ?/usr/share/terminfoTERMINFO㿘#g!g c 2# gg #`2# @cv # @ci#؀  c  *c$# # 㿘ݐg *c ??   2 2  2 2 (2  㿘 @E?/`/` 2/`&@(/`&@/`&@@`N  N2 8&@@‡/`!?#&@&`&`&` &`&`&`&`&` &`$@Y 2 #*` 2 @#### # #*`*  *+`+ @  R OM`K -`/4s @` &`l  ?#""@YE/@ce @3  +&@@" > ;   @Y , ,@3  &`@Y# @Y ' '@3  &` .@Y 2% ` a!@3i  &``-`@X2  `@X2 `` , '!6`6`6` ?c @X֔ g #`#?c@X̔ 2ưcc cc*` c **   cc   *`*  4° /4  ,+ '`6`6` 2`@ 6`&``` @ *`&` ` `@ *`, &`` 6`"``,@X}2 ?c @Xr , 6`$?#,@Xf2 ` `NU? , c @XQ2j ,@_ 5&`@XC\ , #6`&`-`?#@ `K * `. @ "fx`x? "?@bB?@2  &`- ?#,`@  +4 `*  +$` &4 ?. `   &2 !4  . ` !"  㿘@  @  @=   1 @̐@W%s/%s㿘@a# a@Ғ 㿘@ m 0 ' L``:2 ` ,Җ 뀤` @^x%c/%.*sTERMINFO_DIRSp@ 9Nb@q g c  9  2 @` 2'@`#؀  $  @    @`" #㿘@ے /  .㻘@s 6" `j"x`2?@a:#@֐ "@* 7@S ?㿘  "@] " @]  " @] " @]  " @]  " @]  "& $@]& $&& & & & & & & & g(HOMEOut of memory%s/.terminfo㿘@` & gc   @_! "#N "#@`Đ $8#@`@]_ $#@ !a@#TERMINFOHOME%s/.terminfo/usr/share/misc/terminfo㷈@_ʠ耢 @_"  @k$#'@_ 2@_" J@   @;Ғ$#$ "$$ 耢 @. 2 @9$  2 㻘$@*@Ւ / .@ϒ /   *@ 㿈''@ '@~ @~ޒ V @`'@\Ȑ  7@m : 2& @_f ,.@@` *@ N`   ,:2\"*@*@` N  *@*`   @ ݘ g#2  &&& & &&&& & $&$@ V"쀢 `@\`@\@n`? "@ KA \ K ;`J y  #  2 : y`" *!"@  ⴄ  (8\J̀ ``2  J@\2J@  @y "J@` @ 2` J@2*  J@`TERMCAP/usr/share/misc/termcap /etc/termcapTERMPATHHOME%s/.termcap /usr/share/misc/termcap /etc/termcap?#dx'@^P"c @^B  h@"`@ܒ`:$M@ /2@^+ 8 @-$ H@^!/h L@ @= hP@:C"!@``@@`$+@$ L ! *:   :2 , L  "  :"   `$ ۠ L  `$M@ /2 !?@} !?d?J?!?#d@}H A%#`#\' '  ,   *@KJ 2JK @2 !??#p@,`& "@"  ɢ` :..!?#\   #` 2˒#p?#d "@[  @[  $. @@ $'|:@]c 2? @]U ?L /`@y  ?#@@??##!c# #gc@"c|?c    @ gc  -? &@ &` &` &`  &` &` &` &` &`  $&`$$ @   #@-`` 2! 2@M * 8(| `a8  (8*@|2` * "A J< K@ 2 J`K@ J"`J   J + 8J`J2 `  J  "JK@2JĐ   " "`" *@㿘 @ ` ` 㿘`@]G` ` "`@ޒ`@$`` "$` 㿘`@]+` @ "`@’@@$`` "$` Out of memory㿘!. #@_" $#@ %d㿘'H'L'P'T'X@H0 "#@\ !`" @7" $"     ?? ???'#;9K@`%2K@" '`* K        L* : `X'ǐ!*` €  *5 `*   ) "* *    "  *y" @ ` (* +`?Е:  c 4 *  K    %* *   `"*% @?ߑ* : `]9ǐ x*` €1?g*cp" 'K ?Ѐ "     ? ?А  ` @?А (` K@?? K@ 2`#@&DK@ 4  * `" # $c " * * *`#@$c*N*`: `%  " cc  c0" ' *K@ @       L* : `X'Ɛ#*` € @ *5 @*`  ) @"* @*`   "  @*y" @ ` (* + ?Е:  c 4 *` K@  @   %* @*   "*% ?ߑ* : `]RƐ!*` €cc`@ % 3c#* `>%cc  "* ` $c `  c`c@ ##Jcg#h"* ` $c 2@[  cc  @#c)cg#h"* ` $c 2@Z  4c`c@ ##c@#c@Z͐@c@%cK`?πư`* c4N*b * "@ $ccK ` `*`c: ?  "* ` $c@ "x *`c: ?  "* ` $c@ "*|" `  `*`: bxc @ i*`: |bc@c K`*b  *"@ $cS` ` А `* (@*`: В@ cc "* ` $c c  "* ` $c c c "* ` $c c  "* ` $c c#@c "* ` $c c  "* ` $c  @\[cxc "* ` $c c  "* ` $c  @KҒ Rcc "* ` $c c  "* ` $c  @? ,cc   "* ` $c `)ccc   "* ` $c `2 c  "* ` $c `c c4VN*b  *"@ K$cc "* ` $c c  "* ` $c cǚ c "* ` $c c  "* ` $c c c "* ` $c c  "* ` $c c c "* ` $c c  "* ` $c @ch`?c "* ` $c c  "* ` $c @  Fcc "* ` $c c  "* ` $c @  $cc  "* ` $c c`?c  "* ` $c c8 4eN*b  *"@ Z$cЀ  'Ԁ 2PN K'c  "* ` $c 2;N`  2N`3N 2 N , %  N ? ;`뀢 e`N` N 2 N  %  N ? ;`2N`N  N cc  cc#* #(DDD  DDPXDDDDDDDDDDDDDDDDDDDDDDDDDDDDDXDDDDDDD TDDDDDDDDD T TD\DDD pD T DD \ DDD TDDDp                                                                                         $$$0$X0$ 㿘#`*# @x"㿘@ c"%s", line %d, col %d, terminal '%s' 㿘g #x'H'L'P'T`1'Xcz!ǒc@!sgc|ǒc@!kg#ǒc@!cJc cǒc@!Z@Vݐ :@Vڐ @2Hǐ@!Lc㿘cz!ǒc'H'L'P'T'X@!<gc|ǒc@!4g#ǒc@!,Jc cǒc@!#@V :@V H@1ΐǐ@!c@T  㿘cz!ǒc'H'L'P'T'X@!gc|ǒc@ g#ǒc@ Jc cǒc@ @Vo :@Vl H@1ǐ@ ޒc@SӐ 㿘 @R  @Rkj "bx@R>Out of memory㿘@ 2gq"#""#`""a㿘   "!@RA!@R>gc""cgc""c 2 |㿘@ | @6 :  #. #  *`㻈"ߔ"$2  @.[   @} | $@v |  terminal names must start with letter or digit㽐g #x ,cx@3gy ⴐ     b "@T@?2c` gb "bb 2b",cxName collision between %s %sresolution of use=%s failed`g#/'Ȁ`A g# ' 'z-+ɀ@(!@g "! @ި @В耤$ !@ǒb! ဤ@z` ?"`* "@ a`2g C gc?g"c`y'`( 6qa  `0@,, `4`, @g `3Ȥ`0 c "!$ ! `3`?????Ѐ '`@Pڐ" b$ԗ*$ ت $ $ $ $ $ $ $ $ $$!'$ (& `2`(g"#|ɐ* &Đ '`(&@a`2`(Ā`x 0π g`Z `($Sa  Д`0 (`H   @Ւ`( Р`0`(*` *@W `(? $`(@O` "` @P` "`@P` @P{А$@Ԓ $`$`$` $`$`$`$`$` @3$`$ a`2`( gg#`8 ` 6` `J@ ?"*@ `&`` 6` ?` *R ?"2 `&` `  6a`* ?"" ` &`a`2` gc  gc?g`"!ga@~$#|@a`2a exit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair㿘 ` ?2C``  ?"  ` ?2 T ` `  ?"  ` ?2 D  `  ?"  ` ?2 4  `  ?"  ` ?2 $  `  ?"  `d ?2 !  `d  ?"  ` ?2 !X `d  ?"  bH ?2 ! `  ?"  bH ?2 ! `h  ?"  ` ?2 Ԑ! `l  ?"  ` ?2 Đ" `p  ?"  ` ?2 "@ `  ?"  `p ?2 "h `  ?"  `t ?2 " `t  ?"  ` ?2 " `x  ?"  ` ?2 t" `  ?"  `| ?2 d#  `|  ?"  ` ?2 T#P `  ?"  ` ?2 D# `  ?"  ` ?2 4# `  ?"  ` ?2 $# b  ?"  ` ?2   `  ?"  b ?2  8 a  ?"  a ?2  ` a  ?"  a ?2  x a܀  ?"  a ?2 Ԑ  a  ?"  a܀ ?2 Đ  a  ?"  b ?2   b  ?"  a ?2   bX  ?"  bT ?2 ! bT  ?"  bX ?2 !8 b`  ?"  b\ ?2 t!` b\  ?"  b` ?2 d! bt  ?"  bp ?2 T! dP  ?"  dL ?2 D! dL  ?"  dP ?2 4! $  ? $ ?$" 㿘 "  "Ӱ " "Ͱ   , " $ & " $ &   $ &    ,`@* 2 ` " $@@@ɴ@ @* Ĵ  @#- ,` @ "   %`0`0  ,'`@* `n- "% " M $"4 I $ "* 2`6 "6  :&   *?8 1 $ $* 2`6 $6  "&  ,  ??2  $ &* 2`6 &6   &  ,  ??"  $ " &   ړ, ? &  ,  ??" @  "@ ?%& 6 6 Entry does not start with terminal names in column one%s `%.*s' may be too longprimary namealiasusetc%s (%s termcap extension) ignored%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignored%s (%s terminfo extension) aliased to %sextended capability '%s'unknown capability '%s'maMTbooleanstringnumericunknownwrong type used for %s capability '%s'unknown token type㿘@ ư?А#@ g#gggc&!&!&!#L  | *  @ R&& W Ѐ@ ##ђ  g @ | $& (@ސTRgή#cpc@` c@` g@  ( ,*@ *`"  (gc|* * 4"@  ( && (#Ь`c"!, PЀ %!`G!')@{c䀢 2   " 64 @  /` 耤`0)! `! ')@Yc䀢 2   "ǒ,     ` ``@c``g #`cٔ  h oc ` c 0S`NѠ c@  Ѐ @  Ѡ!c@  Ѐ@  ҃'`  s` "   !  ! !!!cf!(0W"*T` 0B'?` " T`  "T`0@" T`0= ? * 72@? * 2"@T`  -*  * (2Ѐ  T`* V@qc@ T` *`"     h0 2!PЀ  , :@ @@(g#Ѐ` @ +    ( @ ,@ + "  (`@ @Z@F@ Ò   `O`2JT J $ @J<*y b2+ 8.􀠠*򀠠/>"*8$+ J`<+ `y` @b2`*8.􀠠*򀠠/>+ + *+   8*8 `㿐///s㿘 @J NPPPHP@P8P0P(P PPPPOOOOOOOOOOOOOOOOOxOpOhO`OXOPOHO@O8O0kcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al%s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~x` ; `Ȁ 2 af( "a@ G "` a쀢 2  f, " @ : "a  `2  R D g`X@݄g#@ " "` 8 2!  R H g`X@l  J %`2 4g#@  "`8 ?2"8 `, 2! f0 ?2"`, J )`"  R F g`X@>g#@ "`,  2(  J &`"# 0 ?" ", J )`"  R F g`X@g#@ "b  Y` J )`2 R F g`X@Bg?# ?"  ?آ! 뢐  +  ` #?"``, ?آ! 념   , @W "a` : J`+ " J`'  "  "`2  R J g`X@ܓg#@1 "b R?2   J *`2  2  `2 @ ` "` J *`2.  R `8 h#  " g^cȀ  ! b@ %  "`2 g@# "b  2` &8 ?`@쮒 i  J` m`?  &8 ""@ "`@HL2`@@ה 2``  ?Ԑ Ȓda@ιb`δa, `2T    * @2T`@Ɛ! E* @` @! :!T` *` !@@@'`,?J" @ $2 J <2 J  >J*@`J  ?"*@@Y@T` *`" @ , |Ӏ ` a4  `c `"a4 "# `2%  J `   ܀`2 !<g@0# "` !<`2 g@&# "a<  `2 g@# "` &@ ?2>#?fD ?28#?fH ?22#?fL ?2,#?fP ?2&#?fT ?2 #?fX ?2#?f\ ?2#?f` ?2#?fd ?2#?fh S?Q#?bئ# H fL j fH k f@ l fD} m fhx n f`s q fPn t fTi u fXd v f\_ w fdZ xL @ "bHx0bH `d  ` @y! "bHacsc string synthesized from AIX capabilities㻈 &t \?Z#w H ftJ  l ftJ q ftJ k ftJ x ftJ j ftJ m ftJ w ftJ u ftJݒ v ftJ ג t ftJ ђ nO  @ "bH7p "&t㿘?2 . "D#$ P @ " @x 2 x  2 V   2 V 2 0 `ȤIllegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldolder tic versions may treat the description field as an aliaswhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %s@%  !U!?$,!հ@Z ϰ?@@@` ` `  \ @   ?Ja : `:`.@l`.g #`  @``.` ` yb `  `2!`.gg #`2g#,`:`@齐   !ؠ (ް@Ma0 !a *agg#gc|ggg?##"""#Ш 5g`,$-a \ @    ,@` `:  ``,@ ,ڐ $-a,Ѐ?   :$-aᰤL " " ,",ᰐ@M | 2L@DL,,@z| |  L 2 p @.   ᰠ@DՐ1+#'ؑ*: `/ "q`@a  2Le(ᰤ: b ` T Ȥ& !g@ob `@ `2,#Ѐ `;`_2,,",,`:`=`#"5 `,z z  v \`@ p Ma@P!Xg"#n @3Ma@   !ؠ!ݡg"#W  5g@b `@ `",,  N,@Ű 2Jؐ!גJ`Ma@̐!ᰒ&"`# a@Z*  `: Ma@!gᰔ#"#"   ?  !ؠ!F! Premature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?㿘'H    ; ^2 \ %/ \@}?퍐!  yb  J ` ?!ڠ!A ?2  ,@h` `4!`" y,@o @N? ^!. @: & ?Ѐ ' `/-y+@7?Hတ?Ѐ   @ `a, ?Ѐ " ,@A?`j+ې!*` € 4,@ 1,@ .,@ +,@ (,@ %,@ ",@ ,@ \,@ ^,@ ,,@ :,@!ڠ!b ,@2,@Ѐ 2,@ ``XX 쩐"  @Oa ? H@ gcЀ 7 5 ^. ,@> mTlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllDllllllllllllllllllllllllllllPltlllDlllllll\ll\llllhll㿘"a!㿘. > @:?㿘9?;57g'! /a#&Ā &g |g 㿘1@BI#Ĕ?y"#  `. > 2   㿘c̀  #ĢJ@  ?y3g#|g`"#|r"#Ā`J@ i3!3%)g/&cȰ ! d a S$ %a !@rbg"c!@"@  !  &c#|g %#|"c "c@ђxcȀ $c@AcİJ@`$J` Ā `@AcĔccĐ J?` 2 cJ? cĔ *?c*@ cĐJ?` !J`#"&ccgc # `? +a##J$cāCan't backspace off beginning of line㿘cȀ2뢐""*㿘#̀ "@q #Ā #&  ̀" 0 Ā H`?(null)(cancelled)\%03o㿘`1i#!1d#. #@A@* 둒`$ ".N@ P` \%y'܀",  @ ` 2,  ,3   ,  n,   r,  b,  e,   `  @,  ^, , @Ȓ@@N@` ",, 㿘 㿘  , '!6 6 6 6 "6 $6 &@=o ,&  2 @=h N&   2 @=a&x&   6   *   &   6  ? *2   &     *"   & "#؁㿘 @Ւ" @?Ք"@㿘!#@@}#آ @/ 1#ؐ@@#ؒ@$#ذ#؁Out of memory?c` %/) $ @ & ,` ?"  "@ `@&  ( @ , 2 ( $ (`@ @< # " `?#   ??  ?"@""@"@` (?#? cؔ? , " "" @<؀ & ݐ#@?@#   @@&? ?    " 2  "   "@  `@`2D ( " $ & < @ ?@ز  @@?` @@"&@`@  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .        b`㿐?h(  @  ?@ `㿐?h!0 h Z !8 Bh!@7ąB' B'@    @q @> . 6`  `6 @3 @h?!0 h$%!@7ąB' B'@@ f !@  D'…B'@@ F #ddh#dd`H B BhPBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @;X  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  h!X4@   "  d`]664,@ ,    "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d ,6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@;@;㿘 `R  $D`  $$` $:  @:5  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  h"X3@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         @    㿈 2j ''   @.Ú ?`@49찒   @. ? !j"x@4P$"x ?@\@4H  "bx " $ 㿘'L'P'T'X@MiL : xxswufsswap ,rwrqro㻐-53#$@=#谒  c@ _#@%쀢 +J #"@ & @ & @.  cȐ @&& ##& c @u @~ 􀢀J `#@c$`@\ @f 􀢀J `@ $` #@C쀢 %J #"@8 $`@4 $` @0 t$` $`$` @( +@1 􀢀eJ a`_#@Z$`@ " @ 􀢀LJ H`F@D$` $@i!@#  #@摒 ) @抒 "c@愒 @~ "%  @Ӓc @6b  #@j %    @ O㿘#耢`@@    1 #㿘@0 " !@; # # 㿘@  ! @%  # /etc/fstabr8!#耢 "@ 0#! @, j̀@<  j O "bx@a0 $# jbx@ 㿘!#耢 @$#fstab: : p" a    ''''''@ː@5''b( '' @5 $OpenBSD: strtok.c,v 1.3 1999/11/09 11:19:46 art Exp $㿘@   2H( HJ  " H?" J  H  2*? " 2HJ$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $㿈`"  `` @'''` @3  &㿐'D D@3Ô 㿐'D D@3 㿘'D@ D`@ 2@@V #  # .@N@J :  *  . : . .  `` % , ,  ,  ,  ,  ,  ,  ,  ,   , , , @E @ `*@ @9  @5  ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   b#\@JY7#b#\#`@JE#!#\#`b@J3!c@J# @@!0aN  ӑ* : `K`"*` €   0,@  ,@L@  @`#+ 0#"# #耢 L@ `" 4  @& ,? @IȒ,@?@I@P!ԝ㿘`&    @5 `   @%$@c? /`4 / &/$̈́ "b@㿀'@5 ?''@&f耢 @5&$OpenBSD: auth_unix.c,v 1.15 2002/01/02 23:00:10 deraadt Exp $authunix_create: out of memory Ц@/ ( Qz@/!  jz`@3!@/̐H bi!,b& & & & & $H$ $  $ @$ H0P' '''''@!@ ) 4@0`€ $$ @/r $ @2 &  &@& 0z!@`а @T!?  @|/@F @ڒ   x   @ #@`㿘` $  !㿀@( $` @Л`   @/=$ @|   & &   & '@o$ & &  & @f `$`@2`8  $`''``@e  @  @ N ''  €@ z "  @$`$`@0$ '@ j``@㿘 $@.   @.@. $  @.@.ːauth_none.c - Fatal marshalling problem㿀 $`!@ @  @ 2 @9!H @$a  `@$O "b@$OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c 㿘hĀ !i!LJ`#hi!H"Ā *@$!LJ@ -"J`"h `$!LJ``- !L"h"H$!Lm?!LhJ  $!L:"b @պ 2J b-!LX?J`iiaH "aHi!D`K ?N :G0 <z!2bp : !Lj"bJ8biaH 2"aH!LJ@ j""$ii!H` "!H"h$!LN`:i :!D` 0 <zb!b@J  ?*`@j"bH"h`$!L"Hb (㿘!j$"x @ "x ? @A $d "b@㿘@`@ @C` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  #,` €?, ?".` ,  ,  ,   , *`$ @$.`.@||㿘   @  (  @3    @ :, @i" .",   @ ` :  , ,  , @ 뀤, (㿘!h"@z @J Ƞ  @z  @: 2 Ȁ @z`` yⴄ `2+` `  `  `  +`\ @ +G` E*` \+  nq+ \+  rk+ \+  be+ \+  a_+ \+  vY+ \+  tS+ \+  fM+ \+  sG+ \+ Є 0+> + 9+ ` @ ` \+0  00+ 0+ ` 0"+` \+  M+ yⴄ `   ^+`  ? +`@+ -+ +  +l$ <T㿘@N@:`'@*``2`"*㿐@*B y" `  *       *: . \  @2`*.?  ` *`N@:`ڔ@*  :  .@*`"&`N@:`Ð@"*`&㿘 N@`N@8N@N@ "*$OpenBSD: bsearch.c,v 1.3 2002/02/16 21:27:24 millert Exp $㿘@1&>@  $>>2 㿐  ?  @% ?? $' "b@/dev/tty 㾰'L'D1j #P@     &"x  #t'x''@,֐ h@,Ґ X@,ΐ H@,ʐ 8@,Ɛ ( @,  @,  @.l  ?????'Ԑ ?'ꀢ  /Ȑ @ ??????'????'@. DD@#L@"+  /y" ` rc* /s!h*`@ `/, @# O` ` Ԁ,Ԁ "xc`@# @ , @O x @,7 h @,3 X @,/ H @,+ 8 @,'  @,#  @, @#T`쀢 "&"x@+`@+`쀢   4 &"x &&"x%`&"x 㿘`h   h`''' ''''' '$'(''Ȁ` ``j j `` `@-u "bx?./㿘 N  x@-$?J? / J /"  J / 16  @" J /2"  1 @Ԑ0j ?"bx $OpenBSD: atexit.c,v 1.2 1996/08/19 08:33:22 tholo Exp $㿘!j"l2 $ @)w "l ?""$"l* "  " $# "b@$R "b@$ "b@$OpenBSD: sigsetjmp.S,v 1.2 1996/08/19 08:17:45 tholo Exp $`" (0@ (`0P$OpenBSD: _setjmp.S,v 1.3 1996/08/19 08:17:25 tholo Exp $" " " @" `&"`@B6 0`$OpenBSD: setjmp.S,v 1.2 1996/08/19 08:17:44 tholo Exp $  0 " 5H P """  """㿠   @" &  g @longjmp botch. 㿘`x @" 㼘 ? c  ` $j `- 5@ `x%" . !/@Ԑ *`  @ *   ` 2?@$ &o @T "j $@+א  @' ? @$ @Tǐ ĒG`$` x<`x @" 4&xx @ &x/J@ @ .   N . 0  b`  @f@z ے @ x"` x`  "`j "b| bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpapj h` @?ؐ@ߒj" @. O؀  c@t   "w /-+)L f"a4e b2b`2_    *2#" ( # $@^ $@V $@Nc  #\$#@C  @$ &    "" 2```22`" @a 2 4 L  f 㷈j h` @?@`Bj" @. O耢  c@۔   "/ L f4 ` b2`$@f  @$ &`X   `@) Ȣ``4 L ـ f 㿘jbd @?@_  bd  bd @A㿘!j"d@& @ d  @:  d@ 2 d @/etc/networksr㿘!"  @Ӓ`$" @jbd"bd㿘!" "j@$" j""d 㿐b    @` $  @X y J?` 2'# !"(@)*, L@ #@! # 2,"",@)̐ ",*  @a0  , L%L "  " @0 ,@`@7",< " ""`  "'$L " *`:    $@) , @ْ0 " $,  "$L  $",㿈N 0   N x X2  N $y"  @+Ғ, ?:` D , :  *??  N + :  . @  $@` y" ` 2$@?$@`$@:   **   x" '" "  @\؀ ?  '㿐 @?.@ .  ?#@.   ?#. ` '@('  㿘"̀`   @L  $b"Р` %@@ $b8 $"5 b̓* @*`@*`@"Г*` 'Ȁ "b@%rb̐ * @*`@*`@*` @%?$"Ѐ $"@ $b̑*` *  *  "Б* @&b́% "b@ذؠؘ؈؀p`P@8(noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd㿘@$ . #X``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ * ,㿐`2&@2&'5+L@ 1#X @  2  `@ِ 2  `@ &@  & ڤ   @q*a 2& $OpenBSD: swab.c,v 1.3 1998/02/10 02:19:48 deraadt Exp $2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ `㿘"ِ@ `  А *`: ?А *`: ? *`: ?ɀ`2    !,  €,@` ,  ,@ ` ,@`@*ؐ $@*؁ ,<hPP   *`j . *@  ` :   *`*@` *@` * *@"$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $㿘@ `@ђ @^` @Y`  ǐ``` @     $OpenBSD: xdr_array.c,v 1.4 2001/09/15 13:51:01 deraadt Exp $xdr_array: out of memory 㿘@@L ' @ 28 @( @   % @"  &@z!@{c@ @%  @ @ @"@&@㿘 :     @ $OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $` "2 J "2 J   "2 J  J  $$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $< ( b("" c4" p ?" d ? l0 "  -  ? s8" w ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$ "b@$OpenBSD: heapsort.c,v 1.3 2002/02/16 21:27:24 millert Exp $㿘`j "bx?@! 6`? -&   ,,-`@'J  6 @'; 4ݢ2ت`k@'+ @,` @' @,`  # @'   @&-  @,`  (5 : @&@&  6  @,`   @,` ڨ@! H @K D% * @,`@@J,`@*` ,  &, @?& @/? (* @,`@@/,`@*` ,  & , @$& @ 2?* . @. ?$u "b@㿐1k"7 A5A;3k&&b &"#'b#  .( > @?*  (@ (   (. @?*? (Pjв0  .@/@.?$kp0㨶  .@/@.7$kX ./$k , 㐐')㐞!㐺,㐔  , "''@#  k(#@4("('P@4(@'@(#ײ`` ʐ k0(=9㐞 51 㐪  )! "@  @  ""(@'@('$"k  " %@( @  b b (@'@('` 􀤠Ok∶ .$k (k ( ( . '   (@&@$ . $( k 0       2*`0"㿐'L`'P ' 'P'' 7㐇7 㐆@7 7 .# /  @4. 954 @@  ;@ 4#@  @. @   @ @c@  c)>' ~!~      6 . ( 0 .`@.  @6  / 00@@ @@/6 ?1#6` (o ..㐄3. c@ `?  !㐷3 3  c 3  +  , 4 * 4  #4c %/ L) 㐄  @   @P  㿈k#0`h֐ / / / / / / //''.@.`.`.`.`.`.`.`㿘k#0`2 2  3Ac1A@15㐘#6  a" 6  $6  *@ .  a &0`@ * ( 0` a*  0` !,@9(`# =  #. " c"О&cA cP"#     <k`H @3>@&5 -22 5 -@ !a@2@ 3>@  :c@ 3?*a:@ #3`3?  @c@; 3;c@3` @ ! < 3`3< c@ @@@#  `=+`A  @ @$@ $$$   㿐k#( *        * $ $*  㿐k#0`L k"  #  + @ @ @   $` ?k" (( +  @ @   ,@ ($OpenBSD: rcmd.c,v 1.41 2002/02/17 19:42:23 millert Exp $㿐 #\.`2`@dRSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0\'L'D'P@'T  @!ؠ L a@ϐ!  .``2 @D@h,` !@a耢  4`@  DLP@T@ظ4` @  D??@ ??Ș '''@n! а? `!A#@!D" '@ #''  c@jbx 0 ?X' =" ` 7/`` !#\! @k 007?z!b@@  @3%x`/`!` #\@O 007?bX@`  ` @-` #z !xa@Ġ"h@א!`@: " j"x # !zz!@Œa `#!@b@黒`  @ @?0-@`@` q`@`2 bp@P '@!'@ 2 `* @  @Yx @@K @,@D @/jx!z#!.b@6 *   +6`& *``+ &%x@   @' x: x  !z#!b@"@60z!@0b@ @`   #\  @i  @+ @@ x!z#!@c@n' '@  #\  @=   z@#z@! z!@ڒcF@LL @@PP @@T T@| @o  Dj@#zbx!a@#H@豔O @U   @W O`   @ @10 @@@%@ @ ?0p  ? ???'`'ܔ@l<Ԁ ?0@˰ 0Ԁ   @P   2 @?㿈  ?  ?//'@4 /etc/hosts.equivr/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner8  !@a `@v @߉[ @߅`2V?k#<`"O?@]ѐ I @Sa @@f@0a@[@0`2@  #!0<  !HT`@ !h` @!  ! h""@/?㿈  ?  ?//'@ 㾐@;!? # * ( &#yr ⴖ J ` `*   *J   * ŐJ  2 *J      J   y"  J `J    * *J  @ݐ L + -L   @ 56 @ɒ -   @dE& L   @ ?@    @d) @N @IL@ + -L`  @`0 # ` @d L`  @ `` @c @˃  ?@|`?  ?   @ 2L?h !#\ /ؐ! @ƚ 29    ? ???''ܐ`'Ԕ@j.Ԁ  0#@ 0 Ԁ Բش !/  !#\ @ 2  @&   2/@ rcmd: address %s not listed for host %shB `#\*` /! @p 2Q  !#\ ! @c 2D    ?? ??''ؐ`''Ԕ@iʖԀ  0-@Y0*Ԁ Բ !/  !#\ @8 2  @’   2/ a  @@/ $ "b@udptcp%d㻘 \2װ?" @    @  *`@ İ? @" ?  /`,   #(#0@  `" @G@ 8?@@ ,`82"@@5 p@ђ   0: < @ 8 22` 2`*`        ?#@2  2   2     ? ?  IG  2D? /@" 7?@ؐ @t- @F  @@ (@?@a "?  @  0@ܖ ? 㼘 @ϖ" '?@`@@0 `@!   ? @Ŕ %@.*` %u㿘 ? ?  ? ?   @6 " @V @  ?㿘jb` @Ǡ@ b` `b` @A b` @㿐@I   3j `" ` 2`22  @ߔ @&bx$j "b@$OpenBSD: rcmdsh.c,v 1.7 2002/03/12 00:05:44 millert Exp $/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s 㿈`!@Y  z!a@Ĕ?@Ƞa   @C 2@?0&   @ !@4R "@˰?0ys@%@=  @=ޒ  @" @ @45 @"8@ @ @,B  " jbx#z!a@Y"`@l@ @Ha  /@B 2 / J  "x /@M  @= j@M  ∘#\@=ݐjbx!z#!@b@.@B @ @r No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): x؀ N  j@'$ a ''j@!b|@$$  " $:$$ @ Resolver internal errorUnknown resolver error k "k"̇* 㿘? @H $OpenBSD: rresvport.c,v 1.5 2000/01/26 03:43:20 deraadt Exp $㿘@ 㾘@’!``j .  /("bx,  @d &!?4@c44@ @ j"x`0 4@, @$?@$@ ?㿈 ''@bv 㿘lBa ! @ @ !j "bxN  "bx 㿘 l)  @%l !B!@.  @j"x$,` !@ @ @/@o  @k  "㿘l @a@ l" @[$1 "b@$2 "b@$` "b@$Ä "b@$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $ ` (  *88 " (" $ "b@ x@wcXؔ  'z''''' '@ 耢  ?*** unknown regexp error code ***invalid @ ...r4X}4X4X4`4`4`44444 4 |4"4.4 =4 I4LW4i4v44 4 4 X54p4484@$4_4_dvma_mapin_block_count.urem_devopen_obp_close.udiv_pgofset__udiv_sprintf_netif_debug_freelist__urem_printf_putchar_obp_strategystart_prom0_iclose_io_twiddle_prom_ioctl_promvec_prom0_close_closeall_vprintf_block_size_prom0_strategy__rtt_dvma_init_dvma_free_prom_boothow_prom_si_prom_bootdevice_memset_memcpy_cputyp_pgshift_prom0_iopen_panic_progname_prom_open_etext_donottwiddle_bzero_prom_init_block_table_ndevs_dvma_mapout_loadboot_nbpg_exit_main_free_debug_alloc_edata_end_dvma_alloc___main_prom_bootfile_devswsrt0.obootxx.ogcc2_compiled.___gnu_compiled_ccloseall.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cpromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.47/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/alloc.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/exit.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/printf.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memcpy.o/usr/src/sys/arch/sparc/stand/bootxx/../libsa/obj/memset.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/__main.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/bzero.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/urem.o/usr/src/sys/arch/sparc/stand/bootxx/../libkern/obj/udiv.odumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: unknown|unknown terminal type:\ :gn:tc=dumb: pcvtXX|pcvt vt200 emulator (DEC VT220):\ :am:km:mi:ms:xn:\ :it#8:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:SF=\E[%dS:\ :SR=\E[%dT:UP=\E[%dA:\ :ac=++,,--..00``aaffgghhiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :ct=\E[3g:dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:im=\E[4h:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:\ :k8=\E[20~:k9=\E[21~:k;=\E[29~:kD=\E[3~:kH=\E[4~:kI=\E[2~:\ :kN=\E[6~:kP=\E[5~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:\ :kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=\EE:\ :r1=\Ec\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m:\ :ve=\E[?25h:vi=\E[?25l: pcvt25|dec vt220 emulation with 25 lines:\ :co#80:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX:tc=ecma+color: pcvt28|dec vt220 emulation with 28 lines:\ :co#80:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35|dec vt220 emulation with 35 lines:\ :co#80:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40|dec vt220 emulation with 40 lines:\ :co#80:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43|dec vt220 emulation with 43 lines:\ :co#80:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50|dec vt220 emulation with 50 lines:\ :co#80:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pcvt25w|dec vt220 emulation with 25 lines and 132 cols:\ :co#132:li#25:\ :is=\E[1;25r\E[25;1H:tc=pcvtXX: pcvt28w|dec vt220 emulation with 28 lines and 132 cols:\ :co#132:li#28:\ :is=\E[1;28r\E[28;1H:tc=pcvtXX: pcvt35w|dec vt220 emulation with 35 lines and 132 cols:\ :co#132:li#35:\ :is=\E[1;35r\E[35;1H:tc=pcvtXX: pcvt40w|dec vt220 emulation with 40 lines and 132 cols:\ :co#132:li#40:\ :is=\E[1;40r\E[40;1H:tc=pcvtXX: pcvt43w|dec vt220 emulation with 43 lines and 132 cols:\ :co#132:li#43:\ :is=\E[1;43r\E[43;1H:tc=pcvtXX: pcvt50w|dec vt220 emulation with 50 lines and 132 cols:\ :co#132:li#50:\ :is=\E[1;50r\E[50;1H:tc=pcvtXX: pc3|BSD/OS on the PC Console:\ :tc=bsdos-pc-nobold: vt52|dec vt52:\ :bs:\ :co#80:it#8:li#24:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\EG:as=\EF:bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :\ :cr=^M:do=\EB:ho=\EH:kb=^H:kd=\EB:kl=\ED:kr=\EC:ku=\EA:\ :le=\ED:nd=\EC:nw=^M^J:sf=^J:sr=\EI:ta=^I:up=\EA: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt100nam|vt100-nam|vt100 no automargins:\ :am@:xn@:tc=vt100-am: vt100-vb|dec vt100 (w/advanced video) & no beep:\ :bl@:vb=\E[?5h\E[?5l:tc=vt100: vt100-w|vt100-w-am|dec vt100 132 cols (w/advanced video):\ :co#132:li#24:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-am: vt100-w-nam|vt100-nam-w|dec vt100 132 cols (w/advanced video no automargin):\ :co#132:li#14:vt@:\ :rs=\E>\E[?3h\E[?4l\E[?5l\E[?8h:tc=vt100-nam: vt100-nav|vt100 without advanced video option:\ :sg#1:\ :mb@:md@:me@:mr@:sa@:se=\E[m:so=\E[7m:ue@:us@:tc=vt100: vt100-nav-w|vt100-w-nav|dec vt100 132 cols 14 lines (no advanced video option):\ :co#132:li#14:tc=vt100-nav: vt100-s|vt100-s-top|vt100-top-s|vt100 for use with top sysline:\ :es:hs:\ :li#23:\ :cl=\E[2;1H\E[J:cm=\E[%i%+^A;%dH:cs=\E[%i%i%d;%dr:\ :ds=\E7\E[1;24r\E8:fs=\E8:ho=\E[2;1H:is=\E7\E[2;24r\E8:\ :ts=\E7\E[1;%p1%dH\E[1K:tc=vt100-am: vt100-s-bot|vt100-bot-s|vt100 for use with bottom sysline:\ :es:hs:\ :li#23:\ :ds=\E7\E[1;24r\E8:fs=\E8:is=\E[1;23r\E[23;1H:\ :ts=\E7\E[24;%p1%dH\E[1K:tc=vt100-am: vt102|dec vt102:\ :mi:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4l:im=\E[4h:tc=vt100: vt102-w|dec vt102 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt102: vt102-nsgr|vt102 no sgr (use if you see snowflakes after highlight changes):\ :me=\E[m:sa@:tc=vt102: vt125|vt125 graphics terminal:\ :cl=\E[H\E[2J\EPpS(E)\E\\:tc=vt100: vt131|dec vt131:\ :am:bs:xn:\ :co#80:it#8:li#24:vt#3:\ :RA=\E[?7h:SA=\E[?7h:bl=^G:cd=50\E[J:ce=3\E[K:\ :cl=50\E[;H\E[2J:cm=5\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :do=^J:ho=\E[H:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:mb=2\E[5m:md=2\E[1m:\ :me=2\E[m:mr=2\E[7m:nd=2\E[C:nw=^M^J:\ :r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:sc=\E7:\ :se=2\E[m:so=2\E[7m:sr=5\EM:ta=^I:ue=2\E[m:up=2\E[A:\ :us=2\E[4m: vt132|DEC vt132:\ :xn:\ :al=\E[L:dc=\E[P:dl=\E[M:ei=\E[4h:im=\E[4l:ip=:sf=\n:\ :tc=vt100: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: vt220-new|vt200-new|dec vt220:\ :5i:am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :%0=\E[29~:%1=\E[28~:*6=\E[4~:@0=\E[1~:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:F1=\E[23~:F2=\E[24~:\ :F3=\E[25~:F4=\E[26~:F7=\E[31~:F8=\E[32~:F9=\E[33~:\ :FA=\E[34~:IC=\E[%d@:LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:\ :SA=\E[?7h:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:\ :cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :eA=\E)0:ec=\E[%dX:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[?7h\E[>\E[?1h\E F\E[?4l:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:\ :k;=\E[21~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:kd=\E[B:\ :kh=\E[H:kl=\E[D:kr=\E[C:ku=\E[A:l1=pf1:l2=pf2:l3=pf3:\ :l4=pf4:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :nw=\EE:pf=\E[4i:po=\E[5i:ps=\E[i:r1=\E[?3l:rc=\E8:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[24m:\ :up=\E[A:us=\E[4m:vb=\E[?5h\E[?5l: vt220-w|vt200-w|DEC vt220 in wide mode:\ :co#132:\ :r3=\E[?3h:tc=vt220: vt220-8bit|vt220-8|vt200-8bit|vt200-8|dec vt220/200 in 8-bit mode:\ :am:bs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\233%dL:DC=\233%dP:DL=\233%dM:DO=\233%dB:IC=\233%d@:\ :LE=\233%dD:RI=\233%dC:UP=\233%dA:ae=^O:al=\233L:as=^N:\ :bl=^G:cd=\233J:ce=\233K:cl=\233H\233J:cm=\233%i%d;%dH:\ :cr=^M:cs=\233%i%d;%dr:ct=\2333g:dc=\233P:dl=\233M:do=^J:\ :ec=\233%dX:ei=\2334l:ho=\233H:\ :if=/usr/share/tabset/vt100:im=\2334h:\ :is=\233?7h\233>\233?1h\E F\233?4l:k1=\EOP:k2=\EOQ:\ :k3=\EOR:k4=\EOS:k6=\23317~:k7=\23318~:k8=\23319~:\ :k9=\23320~:kI=\2332~:kN=\2336~:kP=\2335~:kb=\177:\ :kd=\233B:kh=\233H:kl=\233D:kr=\233C:ku=\233A:le=^H:\ :mb=\2335m:md=\2331m:me=\233m:mr=\2337m:nd=\233C:nw=\EE:\ :rc=\E8:sc=\E7:se=\23327m:sf=\ED:so=\2337m:sr=\EM:st=\EH:\ :ta=^I:ue=\23324m:up=\233A:us=\2334m:vb=\233?5h\233?5l: vt220d|DEC  ((0tLp A8M6D 2,f>AaiFwSZ'd+ ^?V0vr&/|[(v8؄EZ]%!c 7t >Kd+㧅hL2Rsj6(YTTyb|B!_$ jYr عq9C&lq  (\4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H44X4 444H 4`4t! 4L/ 4P8 4I4Q4Y4a4 j4w4 ~44444@44 4H4 444 H44  44  4 44H#48+ 4:4 A4H4Q4`4argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x`> @5$l!@! !@  ` @  2` "`@ `@b@J@k @@0%d㿘l!@ "  @d  2 c@%1#$OpenBSD: strlcat.c,v 1.8 2001/05/13 15:40:15 deraadt Exp $㿘 `"@ J@ "@ 2N@@   @ *@`N &*@$OpenBSD: system.c,v 1.4 2001/09/04 23:35:58 millert Exp $sh-c/bin/shx  !Xa`?' '> ''@y @<? "   @k '? @f jbp !h@;ʒ@  @  @ ܐ@;  @N @  @  ??܁% "b@$ "b@$OpenBSD: sigsuspend.S,v 1.3 1999/01/22 06:07:56 marc Exp $ o "b@no errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error 1 ܇( +#0 (#@ %#` "# # # #    0  X            )))))))x)l)`)T)H)<)0)$$7 "b@$OpenBSD: realpath.c,v 1.6 2002/01/12 16:24:35 millert Exp $./8! "x@Œ  "x .@ `.`N . N  2 "@m$ /@I @`  "@(*`J@ /"*`@/? &h!jLL '@ #< (@ 2 j >M"bx@B# G!j.@@ @/ < "@@@$ "2!jN@ / N``?O @4@1 $j ?"bx  b@@@g j"x @͐ !j"x@Y@Ő$"x /   ` j "bx@# #  /,&@@_@0Đ "#.@##`' . -@!(@ -`d 'j""x' ''@ @"ʠ?! * .* '@ @ ' .- - -@  |`@ u /-   @Ȑ b"x@.$?#5 @ T"xL` .2 `L` `  ``@ߒ@펒 ""x'"x$` `   `c/`@, "&@&@@ 2 `? /, ``$ @@-f' `'"x '"x``@`@ @ܐ `   ` $  @@ @@: <  "  >(` :`@?? D8 >` > >> `` "`@ `  @ 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @@?@ kby@@?@ژ 2 8@Ę@? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘  yb#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @ߔ 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘 @ N * @@   +y @ N@" `   `2  `      ,  `        `0 "  @?  `b `@ ```_` b @ `2 _` `b ` ``_{   `{_  {  @2  @ @r`& ` `㿘  0@ N * @  +y @ N@ `   `2  `      ,  `        `0 "  @X?  `b `@ ```_` b @ `2 _` `b ` ``_{   `{_  {  @2 2 @ @s`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@;  7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(``   ` $  @@ @ ې@: <    >(` :`@?? D8 >` > >> `` "`@` "`$@`$@ 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @/@(?@ kby@ @?@ 2 8@@ݘ? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘  yb#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @ᒔ 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘  ,@ 0 ( N` @x  ,@ @n `@/y @ N@`@ɒ "   `2        ,  `        `0 "  @# ?   ⴒ @ `_ ⴒ @ `2 _ ⴐ  ` _?{    `?{_  ?{  @ L@ @ `@j`@e@Șa& L@  `㿘  4@ 0 ( N` @  , @ /y @ N@ `  ` 2 `,`    `, `         `0 "  @i ?   `ⴒ `@ ```_` ⴒ @ `2 _` `ⴐ ` ` `_?{    `?{_  ?{  @& L 2`@߉ @ `@`@@c㿘>!`+@ @( "v`M) PV~ОDŽ@ d Ş@"x@@n@耠5$@  h"@&("`8@2@ ``2@{ z@u `2u@n 2o@h 4i@b `(`_ ` X@S   @ @. @@O@ H/@(D A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  " @.㿘j "bx@ ( `&& & & & & & & & & $`& $@$$@ @ g `@ ]?46 `-  @ J@s`D&`6`6&` $@ * 2``6`86`8`&` &`%   ئ@@D &"  2 8 $  @Ŕ &  $ & $j "bx@L@d@b @` 㿘`(`D&`$ @:@: / @2`L`  `@}@' &`( `0&`&`& 㿘  ` @- T 6 6 @'  " @  @@  $ `@  j"x @  $  `@j""x?@ ..㿘 $@3 < `4<@ &48`&8* 2   @ * 2``848$   @ $ j"x 48&$: "4:*2  X`"  :$ @ 0 @" : "@  " @$ 4 8ް` *$$@u $  @Ԕ? "" :jbx 4 :$ "[$ $2@   $$@ C$S@ZT6 2<$  @ $ $ 〢 2#@H * 2``48$    @ށ $ j"x $48: 4: 4< $  J / @  /*@(`@DO$@  T6?2 @j""x$C $* T62 :$ 22@s&  $ @h  !j"x @ $$"x@$$$@ 2@? $ $$$   48$ 2`<j  x 㿘`@j E"bx $j@>"x 8  9 27   "@w@2  $& $ T 6   J`/ $ @&   @Ŕ @& @ 2 @T  㿈  $ 'H @   HH Y j"x % S5 82 $ `  ?`  4 ''쀥 H2'@@z jH 2 :x%  :x`@5 :'  ' $ J?`/  $B  / *U 6 `'"'    2 `L` .2 `L` ?` ` `@` "%j `@ '@ `@ː  %jx@Ґ@@ː 5 8 $ & $$xϰ   "   $  '@ "4 6$  ` $ $ ` ` : 4 :  4 8$ 4 8 6$  쀢" $ `  "  $ $  D $ #4 8 $    ($ @f D D$ @  4 8* 2  *`2  $ &```@ː 2` $`@Q耢 @c $   2--􀢠$H 29 U 6   $ @     @s?  5 8 $@W& $2 H  5 8@@@  5 8 $ & $j ?="bx @8 $``@`:    > 86 > X>> > > > (> 0> 8> @> H> Pf ``@; #!j"x@$` 2 &`$"xQ @ j"x&`  > X>> > > > > (> 0> 8> @> H> P:  < @ ((&`0 &`, N`D`.6`4N`E  ?`Dc  2`  `2``0"&@`R`6 6`,  @  @    㿘 ( *@$  2 $   "$ @^$ $   "    @;  `"`" 㿘`$ H@   @`$ ``6 <& & ( M ?& @@ D㿘@  㿘 a   "& @& j ?"bx  @&  2 &   "& @&     D" "  2 D""  P66㿘   @8   8 $ ,   @  ?@ ?`0@j`,@j "bx ?@ 7jx@s&x$  "b@㿘z @ۍ㿘@@$OpenBSD: rand.c,v 1.6 1998/12/07 21:47:22 millert Exp $㿘q@bm `9 1 *$㿘l#l $ "b@㿐 '`v@㿘 @? @]㿘  @] $" "b@㿘` ` 2 `@} j "bx?`?` &``@ , :   @ * &@@s㿘'L'P'T'X@2ĔL$ "b@0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL(    " @M@!S 4x * @`*`@$` $` $`@j @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@$ D$ H@ ڔ `?$ @:   "@j  @z  @ `$ $@ z@ @ -@ 4 (< DbE$ L$e& & & @ߒ ` "`@ `㿘   @J @:  J@ | 2@  @&J@ |!` & "@   "@ e  " @  "@ Z   " @  "@ L$㿘 @?ܑ* : ` X&#!* € @ @m   D`" D D  ,  " @  @J@ )} )  ,  H" @  J`)a&@: ]@   ( "( `, N"`,@  `( "`( 0 A"0@ =@ 8  `@P/ @˔ *@E& @ @  , &@:` @ y @ @ , :`@ @  @?֐ , :  ? {Ր` y ` ` &@ , :  +"(  ? *"  , {J"@ "@b "@u "@V{"@h "@In "@Z "@;  @}" "@2  @t $@) N@r @J@ ,2`& `y  !@\@@E @ @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @  @  @?֐ , :  ? {`  y ` @ Td㿘 @ @ &@ *J㿘   @ J@ ^2 `&@<  `( "`( , ", @-  @  ` :J@2J`` & @  `( "`( 0 "0 @B 㿘J@ ``\ & @ @2   a&a)xa{`." `[`*`0 a(&0 a}a9a1 ~a?Z0} `@Jy @Ŕ t@?p@ l  D`" D D  ,  " @ @ `  J@ \J` ) \K )  ,  H" @ @ ` J@ \ J` )`)&@ %,  H @k `@O@a @    "`H@ @ ~  @"J *  &"@Y "@: "@M "@.w p n`$J \j`$J {f`$&@g @ J@ ,` & `y !@P @9 !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘  y" @ ` `. J* ?а  `  ` . ` @ƒ [:<:]][:>:]]㿘@ǐ    %bX@:  2&   %b`@+  2 (@_  & @: J@ ^2`&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@-   s ` ,`?,"` %y@ `@  `"?@* :  @ `@* ` ,`?<@` @K- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @@ݒ  @’@ߐ@P0@n@| 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @y  @  `  J@ :J` ]3`@f 0m   &@] J - ]@S @ @ @I  @ ` J@ = J` ]`?&@3 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@  @ ` * `@   .`㿘m  y"  @  &   ` a\"` @  @^ 2` @J`2`@ǒ 0!L  @ `@* ` .`L `  `@Ӓ@ L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@Z . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2  ma" a@@ 2`@J`"N``@   @ 0L@yⴆ rs* : h(H㿐 &  ]&///+& &㿘 ` `8yb` ` ː* : ڒ0@`   `4, "`4㿐 &  ^  ]&////& &㿘     .  `y)!*` € $" r&  "@_`Ԕ  "@;  @}" "@2  @t $@) 0M "@; "@  "@^"@  @U $@  ` @ 0% "@ "@0@ِ~0@ϐt0@ 4HHHx "" B" " 㿘   "    _ `& 4 @]   @{,  "`@,  2  @` " "  ` "4 ` @a !"`@ 2  @}` "  "  , `  :`@` @$ ` " ``%   @ @A       -   @:`$   %  * --%% `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@А`  @&`@k @  ` "&` @&`  0 ?@S&` ` ` *? ,8    ` "     ,8   `  "     㿘  '`8? @  Œ `4 &`4,@ @ 2  ʔ 2,@  $ @ $ @㿘  @c@ .` *  @. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@ꡕ* "@    (@> "@㿘   @モ.` 2& ܒ 0& 㿘 &`  @ﭓ*` &` ː &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@  " @  " <@ < @@$$ "b@%x.0.%x%02x㿐!B  !77,a  @@C  ` @ @*`@2 @, %,@a ,a@`@,',L`  @ L 2  @wȀ@*L@6 ,a@j@ aЁJ@ @ υ(85 ,( @*@  `J@ @ H*@`*@ tttttttttxxxxxxxppppppxxxxxxxxxxxxxxxxxxxxxxxxxxdddddd%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%u㿈 !n +   *` *    *  ! - @ #\ `#d#`#h@ߐ㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @’ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& HOME㿘 ~6 (2.?  *@`@  /2*@N @ .@!0 @9@@2F "%  @0 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@  `- `*` / #@ʔ  㿘@@㷐  #\#`@  (\`  : /6@ܔ " a "$  /;< 9@(@2 @۔ 2  2  @ /? 62@ `$ @4  2 `3@  /22#\  / 8  6 /  #d#h@#`㻐\`dhe 6'j$x@I 2  @$ Q?x€ J? "F 0DC @ /41 )" .` ." @4 ` @ ? 6#\#`1 2  2J` @@0@ې㿘`@`` *  @@ꥐ` ` N?@J&`  `` *`@,&`?$@&`  @ `"@: @@{& @ "@@ꗐ?` * $@`&@@` * $@` @   #@j""x ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@?`@ & .㻘  @O$  01 7` @2` @}@㻘@5$ ? @2$@"€㻘@$ ? @2(@€    (*@ ` 2  $OpenBSD: setenv.c,v 1.4 2001/07/09 06:57:45 deraadt Exp $㿐N@ ="`@쭐@뙒 "w @좐*7@* ,`` i j"p `B `  `p@g*` *,`$p `"@*   ,`p@$pjbp" 'L%jL  =2 $@  p*`" (?`*`p* : , *`: ,   =2 =,@ *`,   @* ,``  㿐j"p*`  "  "@  $ "b@$ "b@$+ "b@$/ "b@$ "b@$ "b@㿐`w@ ? ? ? @  gc" "" " `@ 2@@  #  # .@@ :  *  . : . B. " " `%B` 4`4 `4 ` 4 4 4 @9 @Ӑ `*@ @-  @) 4@ 4` 4` 4` 4` 4` %d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dxN -   2c#\@%7#2c#\#`@#!2#\#`c@!2cЖ@ @@!0aN  ӑ* : `K`3"*` €   0,@  ,@L@  @`2#+ 022#"2##耢 L@ `" 4  @ϐ ,? @,@?@@P!ͼͼ͜͜ͼͼͼͼͼͼͼͰͰͰͰͰͰͼ͸ͼͼͼͼͼͼͼͼͼͼͼͼͼͼͼͤͼͼͼͼͼͼͼͼͰͰͰͰͰͰͼ͸ͼͼͼͼͼͼͼͼͼͼͼͼͼͼͼͤ㿘`&    @켒 `   @M$@/? /`4 / &/ @ 7'''L'P'T@'X4`'''''@L     @ `y" `  % ?& &   4@w 2@ @ `2 @2   @ xe`7!,  €  4@V 2B @A` ?& & ޤ@ l2ڤ`פ,* Ѧ?8!0 > 9  8 93 9 / - @@& @# 9    2@w2s"? `88!0    @@ ـ@  ? & &@ݐ 2ɰ @ `2  8B@7!,  €"   @@& @$`%@$& &@ @ٖ "?/ J #  ?& &   4 @  "n0 L`  ?& &  a@  4 @a @J@0 L`  ?&  ,@&`@"=,@"?  @ ` ?&  &  4@, " @ ` ?&  ,@& `  4@  "$@v,@8!H ?Հ`MB7 P*` €` ""  n#\-`R  n#\-`R `` %   @  ,@ `? &  &@ 2 @( @  x X@s$@,@   x: p2l"8!1 ?Հ`:+6#d*` € "   $ !,@ `? &  &@P 2 @(7 @@@. @ e E@ @@$@,@@` 2":"$@ "?0lllllllllllll lllllllllllllllllllllllllllllll @@,,,,,,T,,,,,,Tp|ٌׄӐӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘ$ӘӘӘӘtӘӘӘӘӘҨҨҨҨҨҨҨҨҨҨӘӘӘӘӘӘӘӘӘӘӰӘӘӘӘӘ|ӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘӘ4Ӵ҄ӘӘҌӘX@ҠӘӘӘӘ @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘@貒 2 * $@% &&@@m@@&$@ @8@\"@&&㿘;y'Db'H  `-+L  L0 L x XL )0  ) #?)  > j   $ `%E    7jG "T @ 4?@  @  ?1  *&xҒ<@  b 41@ @  1?#? &x<@ B   b     H  DH"@㿘/yⴺ  `-+M  M0 M x XM 0  >?? ?@u?   ( 5 !j@ @  j ""bx?? ?/<@ B   ⴐ    Ӧ ̦ ``` '@㿘 0 @2 4@b$ $& 0& 4c  @,@< @& ,@ᐒ  @@& 4&& 0 ?㿘?,j P`2` @` 2`0  " ` @ډ E?` &` ?6` &``  6` `0  ``4@& @ "@-?&@*` %&`` ` ?߀6` @@ (` 2 `` &`&@``@@ `B &`&`<&`8&`0&`4&@.`B$  "b@$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  "b@"` $ "b@$) "b@RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx:b`B"''@#  @^ǒ!''T?X:'`'d'hl'   * ` *J`|`:2 p*@:x@:Ē@  :@4b 2X    :@(b 2:X $X:@ : :X $XĒ@?":Ē@$(:Ē@$0:"@$,:$4Ē@` o@` 4Ē@m?  4:Ē@cT?20@C,$8:@VX?24@68$<:Ē@I?. 4H:@?? 4J:Ē@5?  4L:@+? `4N:Ē@!\? $P:@`? $T:Ē@ d?$: @h?:(::8#0::H$#@:  `(/7:#0:  a7:8/ 'o/7 `@/7:#HBb7/ʠ /////@̔?8$$@”||$ @x? x $ Ē@t 2 t@ , , pĒ@?    , @~ @3, `*`:  p  :. P : ?4PB"t7/ 0Ĕ/@w? l`*`$:  4   aW$@ޘ$㿘@  @@_( "&@`@ 2@yb ` > @\o 㿘 1B# "B@cB&#"# @ᒐ!B`@0$#B` "#B#"# @Δ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ %s.dbtc㷀'X'D'H` 'T?X  #Bc @T !B#@ː$ #c@n#' dȦ`@ݼ$ }      @˖ A'=$@^ 0#/o!䀢`+   @ #T@C ` @@ݰ@@݃ D@( @ H"D"" @ h '`9j.M@  `(;,L \27, , %$@ݐ $@m耢  @V '"x?@*M@@l$ 4̨耢 @? ̶? , L " #"T@ 2ݦ\  @> 2Ԧ ` P` @$`??x  ?L: ,?#\$ ? 耣 @@0" ?2 :,??L %L  : $ " ''L?`: :, '"@ #@%$@$&@ '@Ð耢 @լ@ܻ3j@$ @ד@׎@ܧ?=8^ = X耣 $@Ո$H"@ܬ 2j@܉j ""bx@܀?0D#@ 㿈@߫''`?''  ? J ? ?  &@J `?  JJ|:? ?J:|?  㿘@@㿘1B# "B@&#BBB"#"c" r|:㷈B#Ā`$cBc   c?@^` r$%B` B 㼐 "P @^ 㼀`` @W@ؐ c$㼐`$c` ? 0@^` $0C*?yB"#"  `  B*:  : ##  J?`\2## ##J?`\2" "9,@ $LJ  : \2$@"%@ 'h?0; @ ޢ@ @^ 㼀` ` @@h $㼐*??` @'@, #\?N    -㿘 = ?@ d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ @!*` € * ? *? *? *? *? * ? :*???*?  2N"@`d 2  ,?@Ր(? dN :  ^ \ N`:`2 *" @Ӑ 2  ?@ڰ?&Pp`Pp`㿘/ = ;?@G d 2L4? d  `"@@x d 2 `"?@U?@ dL : 2*@*@`"@@] 2 `?@:?&㿘 # 2N@2? 0  `N@ x X `    @˒`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@1.`.`$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $   (8 J2J " $| "b@$9 "b@$OpenBSD: random.c,v 1.9 2000/04/04 14:27:00 millert Exp $㿐o"`o"O"@"o"@ - #)|b,  ##@@l+ @ +` *`" *" *  ** " b"@ "@    bo"*` *  *oo""  "b@ *` * /dev/arandom㿐ob   o"*`A#0 @ ? o"@D @@s@ڥ  z?@ 0  o"o*` o"""㿘oo"b  "o""@ :`*`  "C oo"" $"#"b? o o  o   o o""" $" o ?o $""b#" o`* "b $b"ob "?"b"@ :`*`  "㿘 @ߐ @oob " "o""@ :`*`  "`4. `o,`"o a@ oo """  ⨠  $b( o"@* @o""o* @"㿘o"`oo"q@ bm `9  * $! oob@ "" 2` bob   #bb  #bo"#b$OpenBSD: ldiv.c,v 1.2 1996/08/19 08:33:35 tholo Exp $㿐@@h'@I ' "`?$$  /bin/shsh-c㿈'HN@ r'D wjHJ` j "bxn @Ő ' g @$耢 @߰ 0]@2?` H G`0@8 p@jĐ0 8,`C G!8@s$` `$ "b@$  "b@-_/㿘*`$ #G  А :`aP@{2 2  .2 N .2 *`  gethostby*.getanswer: asked for "%s %s %s", got type "%s"xC@''܀  "" 0 C`#h`?c$ '耢'` j  @H$ GaT@쀢 `j  C@ֆ @"'' %CC"4'"bܪbܖ""""4  2?0 @H GaT@쀢 " @J+* 2 @J&* 2 @J!* 2 w 2u5 2 Cd@ @HW$ G!T %@@'  `"@?@ @ 4Ԩ @i@"''%(%@H&$ &  " @ @ 4 @i'ܐ"'' @A~ @As@ApG %@Y : 07 0@S*܀ p %!7@Gڔ &l 쀢  e  %C#d@%@`?U @՚ @"'K'Ƞ@R쀢  pȐ %!@Y@ @2  @y% "@''D  " ci '! C"@ ' #@ǔ"'@ ''䀥 "  ? 쀧 3j ` !d%@` " C"4@Ȁ @$ @  @h@"%'' `  @j""| j"b| 㿘p@h!j ` `  `@L=? `@(   @  @  @hmabf㻈j ` ` `@L?`@`j?     j /"|"x j "b| C"" " @x . y@- 2 y" ` C/N? .">D#l@Pݔ !C#h!@{```CC!#$"b4''Ș& b4 & #`@j""| " `.2 J 2 J .D"  `D`@x : 2NN :2CN &N? .;D#l@P !C#h!@{ CC!#$""4''b& "4#b& j#"|^  "  `D`2 *:  : . J 2 J .Dj" @s O  Iaؐ@Q5   1 L f"  y b 2`2@ @+$  @`2L Հ f%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.int㷈p!@g8j ` `@J? @א)`&    ?#@"          j?  j / j?j "|"x@f -j, J bH  @g!-j! +J1J 2bh@g "p"p , ,  ,  ,  ,  ,  , , @֔ O耢  Iaؐ@PV   Q -C4M f"= y b ;`29`26`@1  @*$ '/  D#l& & @X%4% `  @L  & & j""|@*`` M  f@fP/etc/hostsr㿘!p!| KK"H@RgbX$!|@Rp"!㿘!p!| p!`@] $!| 㿈p!|` +jKK"H@RCbX %!| ?!|@Q  %b| J?` 2'#!|!C#h@ѹ, N #ߐ@v # 2,K @Sbࠒ D#l, @N   @N j h @ '  ' Cb   !|Cl""4"4""" "L)j CL "  " ܒ""`&"Ȣ @Sfࠒ & `,  !L  `*`:    @$@`@SLࠒ   `,   `L   `   $@h$''"Ȓ@f%b|"ȁ㿘j h @   @ 㿘  0 @O'   "   @O 2 㿘C"" "      @  㿘CCbȒbܖ  C" " " 4C#bȪ   " /C,aK @R’bࠒ Z ,%@M# L  LL "  " c@R  bL " , bȀ  %b@S C#d@$@`ð $bL  C#d*`:    @$@`@Rsࠒ  b,  bL  bȀ b$@% %u.%u.%u.%uhosts.byaddr㿀C"Ġ"Ā`  @N 2 *  M a  @d'C, ,@ͬ"#Ma0$,@ܐ@e䀢  H, j "b|hosts.byname㿐@   C"Ġ` "@N] %C! %C0 0@s"#Mb(@У$0@eX 0 j "b|㿐@  .@?` .@`.@`@ 㿘  , (   & &    @ &@ $&@" &@@$@ `&@?&`2@㿘P  @ ' jȖ`~ /   d .@2` 2 ?(R& `@  `.. V?V 6?6@?`&@&`@ 鶇$OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $2J  J@ `2J 㿘 ( j "bx?6?@͐ @2 P (    ? 2 0    : @  0f  < :@ f  "  :@ F㿘 $OpenBSD: strsignal.c,v 1.3 2002/02/16 21:27:24 millert Exp $㿘D@6c$OpenBSD: __strsignal.c,v 1.6 2001/06/27 00:58:56 lebel Exp $㿘E  @_  0?,@s  @R  0,libcUnknown signal: 㿘O @r i".   @r7@v 0O? @r+ @v@# "@v(@r$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $㿘@ 0? (?#$ "b@$ "b@I @ Jg" 8o-"H XJ+"FG* ?`C*  u2?*  !00  `  `+ *`+ *`` *``*`*`"   *"* 2 㿐L V?'@  @ -@2  @ @  8 ? y"  `8` @Oϔ  ,02+L*  ` 2 А L   @  0 2 0-3  =@'/@  L g  o a *`:  u*` : -)$8 :  + - =ڐ`=*` =  ?* : ` uQ *` €$ ?" ?"" II -@ʱ &`0 ? ?@ -3 =`@ =` ="  +` -@ʌ ݐ& ? ?@ -3  X@  -@t Ő& ? ?@ -L3 @{=`G =` =!``=` ="  -@O & ? ?@ -=`3 @V`" -@6  &`# @ ? ?@ -3  X@6AL  ,**` .@vACLCLCLCLCLCLCLCLCLCLCLCLCLCLACLCLCLCLCLCLCLACLCLAAAACLAA耢`g"*`o`= -`X`+`-0?0<`u07*2 -2   +* )2  &2 *2 <c* 2  * 2 +-  =  *   - +  X2`2 `: J@+-X2@   `J@-+`8  X`8  `( 2 **   2 **  "J@2 ** ʐ $< "b@$ "b@$S "b@%s: 㿘0`<z!Qc@|`@+Q@rc@g㿘@@ @|F @offonsecurelocalrtsctssoftcarmdmbufwindow㿘Eat  @o 1E at@J Ȁ N@pV yatat`? "`@r @  "@ ဢ0" @ ` " L   `2 L "Π #"ˠ EE`"`  @*p$`L $`$`@ɐ$`L $` @ "` "`L M!p 'R@~?   R  R` ?|$` `@~-   R  R`  j$` `@~   R  R`  X$` `@~    R  R`  F$` `@}   R  R`  4$` `@}   R  R`  "$` `@}Ӕ   R  R`  $` `@}  M!pL  =2 M!p@n$`@%L pM!p #" L #2   L "  "  & L "& @oR 2,J AE"62 J\2 J ""  *@'`# *p&*  2 *p* J "   "   J "  "  " 0 Jŀ"*㿘@o =   /etc/ttysr㿘1E!t  SS"@JWb&!t@ @J 㿘1E!t  @O8&!t@ $OpenBSD: rindex.c,v 1.2 1996/08/19 08:34:08 tholo Exp $*`:` J " 㿘 @ʐ  @$@ʊ 㿘pE#ax!@]  ! j""x /dev//var/run/dev.db@lh  @B jP"x< @ H TD " 88.@ T.`  @.`  .`  .` .` @| '  ?PP 'T'X'\7P X` 2 d` @ "@9` @  @@8T@uB 8 &j+"x@v' "@v# `@ @ @  @@`@@v 2@vr BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks㿐T@ȥ"T_"L [@J QT" J``MJ  1T`M*T`k`GT`K`(T#"T"T`m`gT"T"T" !T"% $T"Ф$!"@o"% @T"@f @ˠ !ET#@Zb""!ET0"@m  &&  &&@"$8 "b@?ch?# @  @) Ժ ?@ ?# @!?4#a/?#?  ?# !?$#?#?  ?# ! ?# ?#? ?#  ̀??#`  ?`?``?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ?#?    ?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ#  @n ?`?D '#\   @2@ý  jz? ""x@J d? M J J`, , 4 $   @ J 2, ;`@ :E4&@ @? ?`)` ` % _ J _"@v 2 `?$  ` , `4  ` ,  "J 2L Т`  8 & @ `?@l0#@~SF ӄF @   "  ?b!?#Ȣ@ 4 @ 4    n ΐ i#h ?@o &?`0@`.`    #\   @??@ J `  @y 0:*` *   ?#Ȓ 0   @ `( ( @ߐ @  @¯   @?@?#\  @Ŵ??@ ,`4`$`` @  `J 2,``e0P %L@?`C@ "?L "; @uԒ " L _2  @uʐ 2!` $` ``"   ``  ,` ,` 2  ? ,`4`  ,`` @ "L ̐  8 "   @" @=0@Q㿘q ,?  , @€? 㿘 @u ?@ 㿘`? "`@  "@@ %u㿘 ?*` E* bN  2! #Gc @  $c@ 2$` 1G#YX@n 0 @k  㿘 ?*` G* cN  2! #J` @  $`@ 2$` 1J YX@= 0 @k  㿘qKc  @X`!qJ`Ȕ'  @XX q@XO!K#耢`@     @  @X<a㿘q@X3!@    @Kc@@X !  㿘qKc  @X!qJ`Ȕ'  @X  Β㿘  "7jx'  bx&x㿘q@W!@J    @Kc@j@W֐!  㿘qKc  @Wʐ!qJ`Ȕ'  @W Β㿘  "7jx'  bx&x/etc/groupr㿘1K#耢 "Z@C1L L`" @͐ &   Z @C`&#@ 㿘@ 㿘!q@W{! K "# @Wr!㿘!K#耢  @#L`L$#耢`" @ $`㿘!q!@WV@WTgroup.byname%ugroup.bygid: `  # )L pL `  @Ax `% @j   4V'#L```И#`%L#\  Z b8@Xؠ@K` $`$`$ , ZLb8 @ Ѐ @2%  `  #Zb8@_@XР@%  @ Ԓ@Ƽ@% ',K#@A3$ 2' @g 2L#{#`? "`@ @  "@ k0 +ZL :h  d@@ x !L S%    @@ΐ K  #Z b8@ZbH@VÐ !Z@"P@WР 2* Ԓ@H@!Z̠"`,'̒@ L&@ H&@ D " @Ff ȔJ@  @ P&N&@@Q Zb`@ %̀  " @r   % @j2 Z̠ @ b`  &""`@r 2 "`@ &@  " @F Ȁ@J@ 2 8 &̀ ̀  c@%& J ,  *"@`    ""@*"@ `" ̀@  '"@ 㿘N  @ɐ  " @i $q!` "!`$ @ 㿘q!` " @r 2   2 㿘q!`` @@`@ 2@$`㿘%LM`pq$"!X$ `(L ` ?@ِ @HX"@$ @X"  XL ` ?@ @0X" @  @X"  \Xa" "  ""  XL ` ?@ @X" @  @X"   XL ` ?@ @X" @  @X"  XL ` ?@o @ޒX" @g LX" L`XLX $# $"l: 㿐N@ ' +\J@` :'J@ 2`c'@ &@ & @  ] @DݐUJ 2 N& @  H @DɐAJ 2} : :& @ & @  . @B}'J 2c #@4^ ' @$Z & @ p  @Bb J 2H @4E @4 & $@ \!& & & $c@ Q& @ M& @ IqaX (& q!\`"L 2& Ll  X & l X & X  2& X  2& X `2&  master.passwd.bynamepasswd.byname`L L`q@ 1qad? @2%!d!d L`\ æ L d`  d@> \$\\ yq  L!L "G!L`` , @- "]]"#ؘ#`%L#\  d``@Uh@``  $`` $\@'!L$``h$h@ d ]"]#L``h@ ˚؀ TJ$\@̀ @ $\ "!dJ !d@ d ]]"#@@T؀ #*!Lah  @ d "]]"#!h@ېܚ@T!h@$\  &!h܀ "Q!d@M!d!L@3 p@'Lذ`$ p*@` ;!d0aLP 2`/P"P@  ''@Ȑ N!d I1L $J + -J  @ $  L "`\ L"`\@0L"\@g q"ah!d2) $J  @@԰ ̀` J@ 7 @Ҕ @[!d*!d $ __YP!+X_`  1''_/ @± 1L L ''    L ؟   㿈@%L@q!l? )L` )`2#$L d`  d@<  d$%  d]b@耢 2 $@  $% $l% $l `L L`@ A   L" P?7L9q $J`+`-"J `$#L`d`d @ `@R`h  !L ` "O% `@K% ` p `@`h`h,̐`$ < `$ $05` `@@H ̢ Ā` J@ ؐ @s @`$ː `$@n `$T L @&LJ'!XSLP %PP P 2/А В@H  ''@ !LT L @&Lư %'!X 1/@`  В@'`''@ՐL T` L @&L L $ %umaster.passwd.byuidpasswd.byuid`L L`@ B 7 `bؐ@QTL "`P? 7L9q $J`+`-`$ #L`d`d @; Po $J   @"L_ `!L ` @$ `"`d `"`"@=!L `@Q h _L ``@ % `2`$@Z ̒@Ĭ @?P "LJ L d ]]"##L@ `@Q`h "2!L ` "% `@% ``@ % ``$d 'Ȁ ]]"##L@ݐ `@Q`h  !L ` "N% `@J% ` p `@9`h`h,k`$ ;`$ %04J ` `@@ ̢ Ā` J@ v @ @`$ i `$ T `L @&`LD'!XTLP %PP P 2/ @  ''@ !LT `L @&`Lf  '!X 3/'@̔  ''@zL T` `L @&`L L $ 㿘!L `LLL"`T" P"\@ 5$ `q"!X 㿘 㿘!L LL" P@ $ L!L `L`" \@ $ `q"!X/etc/pwd.db/etc/spwd.db%s: %m㿘Lq?"ad@a"\ b!b!   @n L "`L !L   ba(@?  $  㿐L`L  v L!L@a @" 2 $  "$ @$ _  L" $'L @* .`` $"  @* .`` !L ,@ ` @  ` @ $ ` @* .`` $"  @* .`` $"  @* .`` $" @* .`` L`H@ߔ `$@@X@Ք   $X $OpenBSD: getnetgrent.c,v 1.12 2002/02/17 19:42:22 millert Exp $㿘@ 2 qa@! & & @ߐ P &qa@ 㿘  @2 *@ &  2 & q@q&a@  * "  & 㿘`  @ .`@ @Ͳ` @*@@Ő㿘  @: ,`@@j 2 `@* 㿘yL@ @"@ L@ @ `2` "`y"L@ @K   ` 2  Ly" L    `2  " *: #&   `&@7 qa@n @ה@* & 㿘@!  2qa@X `$ ,  ,   )    "@& @ @ netgroup: db getnetgroupnetgroup.byusernetgroup.byhost㿀)N p / @7 @֐ ,@z p''  ?d0@@a耢 &qa@ & @ @֐ 2" d31d0 d0  ( 8@@N䀢   netgroup: Syntax error `%s'㿘J`"V #d%qJ`#N  y`&J` ` " `2 "(2< &@a.?, y&J  b@ `  # @> &@@v @ߔ@  *L 2 netgroup: Cycle in group `%s'㿈  @>d#0@03<+ 1 *'5q|  ? @0 "` &Ē㿘  ` `@iA  `  @i5     @i)   㿈  @Ԑd#0@EY ђ 1 M ' " ?:( @ 01 "@  "@  @@  Ð@{ 0@w %s.%s㿘@I eqa@  "N q!x`qN@ q!x@(%s,%s,%s)㿘e#(e#8 e#8`e#8@ʐ㿐` @e" @_ @   ,㿘ؖ   і  ǖ    $ @$7f"NN? ,2 N`@\a  @ِ  @Kʒ 逦@ϐ 㿘q!!q`$!%N! $a@ !  "!@!  @@!a $!p  @$p/etc/netgroup.db+㿐q!`'!N p  f!   @j^ $ p p  fb n 1 @5w0@m@_? qa@{ q!$ qᔀ  "@" "ᔐ 㿐!N p'  'f!   @j $ p p f@57 b " 1 @5+ `@`  `  3`  2  2 @^͐  㿘'L'P'T'X@L%s: : %s 㿘j"xz0a <g`@6` @g`@,!g @Q@$@㿘'H'L'P'T'X@ H%s: : %s 㿘j"xz0a <ga@  @ga@!g!@P@㿘'H'L'P'T'X@H%s: 㿘0`<z!gbh@ڐ @g@Вbp$ "b@$ "b@$OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $  J H 2* #2HJ$OpenBSD: yp_first.c,v 1.5 1996/12/03 08:20:03 deraadt Exp $yp_first: clnt_callX  N "q @F @ `"j N@ "f @; @('_ &'@&Đ@LN uS    ?''?'?'' ` #\ h , ؟!Ѐ    g`@NcĐ?"`h@a>ఒ !`@& & @=*@`@'@ ' @.@@*@@^@Mcā$OpenBSD: xdr_ypreq_nokey.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@] @]Ȓ` 㿘hbȢ @@7 b bȀ @/etc/protocolsr㿘!q# hh"@5Ib$#@5shbȐ"bȁ㿘!q# "h@xA$#h""ȁ 㿐qc   hh"@5&bЀ %##@4Β y J?` 2'##!N x@, L@ #@Y # 2,hO  "|@6cX Ҥ, LL "  " @6X  ,@`@6"#J ###O  |"`"``!L  *`:    $@6OX " $,  "$L  $ |$OpenBSD: killpg.c,v 1.4 2002/02/19 19:39:36 millert Exp $㿘 @' j "bx?" ( $OpenBSD: creat.c,v 1.4 2002/02/19 19:39:36 millert Exp $㿘.`2@ђ&$ "b@xp`X@0 hP@0 hP8 User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0$OpenBSD: clnt_udp.c,v 1.17 2001/09/15 13:51:00 deraadt Exp $clntudp_create: out of memory X\@v   `` ? `d@l@ ``zja@~!jbxh "h"`$ X @ɐ `2@S= *` V 6 r $$$   $  ?$  $ $  8$ $ \$ T$ $ (@I$ $ ''''' X@Q @Q +  <`€$ P 6$  '  @S   'j"xh b"b"@RE  b~@$ @P$ $ @ @ 㿈`'' #\b'D ('H? \'L'P'T'X'D`@'T'P$'P('T`!ؐ` 2 * @ U@ƒ  '$$$ $$$$H'|'x8'@$8`€PX@3€ D € PL€ 2  @ $, `€'<'HH X@8<H  j"x$0@ $, P jT Fj""X'7j' T''' @p?/b@!b?'8 2`* `*  $ 8  @R ?% X`x '` | 'd?``d'xP '|TH @3 $, x Mh@s hp"@l'`t"`'d@?`x`@|'Xd@'\@?XX\'xP '|T& @ $,r ȠL )j \'L@ "x "x #"$0@ܐ$,Q (uX`@ 2o @P# @Og .@Oْ,, DD `€   $,$0  %@N D@  @  D'D @O2''$,",@, ,"@0"`4"`㿘  " 8 8@% lH("$"($"(""" "  "" """   㿘   " <@+ < `@ 8@3@1ȨȠȸtcpudp㿐N '@4   J   8  ????' $ $ $ $ $ $ $ `?"V  2y? 2u? 2q? 2m??g? "   "\?$$  $ $ $ $ $ $$ !m `  2`"    ".? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $ m'  ' ' ' ' ' ' `n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   m 2l?g? V$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @.`` `` `     2 `?&   "&@*&fbf㿐@  q j h`@&? nc@, j"@ O nc@,x `+ J@ &`J@ f" y b  2 @  @N@b  `J@ ဢ f`@B `  & j"|` o!*` €???`@*{|t|x& ' @N  j"x`1 @@ 2) @J  "$  " ``@  $  @ $  ?@  & @*3h&'ؐ@̒ 2= @  6 @*ܔ & @`2"?@ $?@   ` `  & @)㿘@ 2B @  2 ; @R %  ,@Uؐ $%?@!?,@   2 @?&`2@ܐ㿘  @ @  &`?@A 㿘`@ &  $  $ $  $  $   $ `$  @$ `  *`@$  $ *  ` `@ 0 㿘@ 㿘`"E    2?         3?1?/?  "(?@(?c ?    m m @+ ߀ 2     2  2   l      㿐N ?`@? ?@?@  ?@/Y "@0 J@ ?gethostby*.getanswer: asked for "%s %s %s", got type "%s"?cH'D  'L????؀  D0M2L D? c  ?D# 5` j 8"b|D@( € j %"b|@@ j "b|&'L ?#" ?@?D@ Bb@ "=@@ * 2 `@ * `4 @ * 2 ` @ ?2&D@Ę$ € " @@ 4?@@+&? _@耢 (Z@@ @@q0L@0 %H@]@)  r`А %@0m6@20@?2*@?# 2  @< & ' ' ' ' ' ' ''  ' @(? %@ ?     2 @ ??"  @D?#  LjΔj"b| j"| 8`  ????'???'???耢 L H $ ''''' '?' $''̢ ' 'Ȑ  $?'̢ 'Ȑ@g ! TĀ   $ `    > 2$ /etc/hostsr㿘!r! rr#@+c$!@+=㿘!r! @n$!# ?cpr!`rr#@*c %a| c@& ?#@a@)% "o L #?s`@,u s ,@,m` ?,  L  *`:    "@,S , @(]  ? ?L  ?#` `` '`'`'`'`''''ؐ Җ ? #@$@` ?  2@?#x  ????M  $ ` ` \  IP  ? ???+s @Nڐ `*@ ` @+ؐ 2*@_] `J@*:    "  @+` " `*@``"`J@  @` `'` '`'`'`'` '''E 2' @&@`+  2@   $` `  hosts.bynameipnodes.bynamePO!  !?`??? @' O_ O!`!@Đ ` %! 1%t!t @@> !%t` @'` '`'`'`'`!?8'   $` ` @ؐ@>u! 2!   $`` 㻈j ` `   @ `j""|\?`=?#`$ $`` ` ` #d#\@ #`  `  $@ 3@v   2   2   &`@`2` `u x-` €j  j j j "b|?j "b|DP8,PP㿘j `  ``   @ hjj""|jj "x"b|N    J .Jd?`2J J .`?  ``@  ``Rgad2  ? @c 4[|  `` ` j 87`` b1j` ,`@@C 4;x =4| "   "  2     2 `"" `@  "@ @   $| `? $|?%s.%s㻐j h` @`j""|2?`@q$  ?N .2@O? @]@Z $uj "b| ? @$㻈j ? &```  @~j""|H?$#d#` #\  @  ``  $@< j ("b|@ 6j "b| ` `v!*` €j  j j j "b|?ؤ|pٔٔ㿘j `  `   @jj""|jj "x"b|N    J .Jd?`2J J .`? ``@ dq``ad2  ? @j 4a|  `` ` j ;:`` b4j` /`@@G 4>bx =7| "   "  2     2 `"" `@  "@ @   $| `? $|?%.*s.%.*s㷐j h` @m`j""|'?`w@?"N .2h@} ,@ `$@:ژ$HOSTALIASESr㻐j h 2x w@!p@ 2p lw@&a "g @d YJ?` '#N@, O y"@ ` 2 L@`L@  @@ `"`L@ 4 ,@@$  )y"` @ `2`!`L` `  1O"J  @ `"! *$@M[@i>0 @%ޒ @i5 Hj ` `` d@`j""|?`  @!@E`  `2@4@@ *` * $@ >*` a ?$@?'D'?Z?2X?? Ժ@ ˑ. $ 2 @.2  @  ;4` 8?@  @  @ @  @ 4`  ` .` ,` @Ց2 .`@ё2 `@Ґ /`2 @ʒ```@T4`&㿘& @%?.@ @ ). @2  . .j h    @ @ `   &6`  㿘.`  .2 .   ,,`6 @2 @6 , 4 @@6` ,`6 㿘@E%?'P)!$8@F #c4  PP2*@42a(8$8 P @-2a,$8  2 !P 4!0! P2a. 5P3r-P7P1r4!0!0 @*  `@ #$8@c4 $8` x" ,,`2   , @4*  2` , 2  @+` ,2`x 62 6a@3<! @< ` ? &46!㿘!P @!!<ra!/ P!<!4 !Pt!P!8 @$!8!8a 2 @/@ $!8a -PPP!.a0)`!(@Y@ג!?4!(`PaP!,(2@ 5aPa*rኔ . 6 r r j`*@ @h*"㿘  8 Qj ` L ?# ߐ @ @2  @2      ) @}  "$   0 #j`` ?c 2 `"  @2  㻐 )@e$ @?@ * `4 @* 2  ` @!   ܤ 㻐  & $?  @.$ @@ؐ* `4 @Ӑ* 2  ` `j ` 'H'Ԁ`'D@,?"I? ` `'H" 'Ĕ`  <''̀  !'Ȑ`  @  ' @  `   @? ` *r!`"  DH`|"*` €   )4?`Ār `!Т`'Ȥ  !rr!؀`! @ "%aЀ @   @C{$!܀ $aj *bx!j$"x@BԔ r *"x "aؠJ@0D H''''aВ@J H` j *bx 7ްaВ@ޠ  ް"@*` 7ހ j@"x6(̀ % @'j @* 2 ' 77"7ހa@ ހ j"x@nB `"b* &7ޑ* 2 ""aД@蠒 ޒ"@*` 7 @ !Т`r !r؀  ! @  `؀ @2   @B$!܀ $aj *Bbxr"!Ԓ ``$ !r`  Ȁ!Ԁ` !r!Ԁ  DaД@B䀢 # $!D a@(HH!Ԁ   /'7aВ@A j$!"bxD aКH@(H Ȑ *t ` `* '@~` '耢 4' ''aВ  @r2  \aИ 2 * +  &   @BS @ j"x`a0B! >''j"bxaВ @؀ 0'Ԑ '@aР ` $ (u a (2 DH a      ` *@r `!``"D  `  " @c'< Ā  ` ` ` ` ar@Pr!䀢`  DaH`/|"*` €   )4%?`D  `@ ` Ȑ  '@Ā jЀ j ="bx <"bx""x?8T@8T\؝㿘!r!Ѐ  @??rrr$!"!""܁$ "b@㿘 @? @$㿐 U?@_`0`  `@@"$`0@ $`0T` $` $`@` 3\@ `@ܐ  ?@Զ`2  `C  $`4` $`$`$@2(" $`4` $@  $`  $`$`$`"h"brjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%d㿘`~!8*` €1}!(1}!01}!81}!@1}!H1}~!P1}{!X1}x!`1}u!p1}r!x1}o!1}l!1}i!1}f!1}c!1}`!1}]!1}Z!1}W!1}T!1}Q!1}N! 1}K!1}H!1}E!1}B!1}?!1}<"1}9"1}6" 1}3"01}0"@1}-"H1}*"P1}'"X1}$"`1}!"p1}"x1}"1}"1}"1}"1}"1} "1} "1P!H}bȔ @3(4@LXdp| $0<HT`lxicmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp㿘`+! *` €1~*#1~'#1~$#1~!#1~#1~#1 1 1 1 1  1  (1P!`}bȔ @2Xdp|%s㿘j `!` G   !\aP@j j ``  @ @  @* 2  &<```!`  !`?` '`@ * '@ @* 㿘z@`;; res options: %s㿘b@iȐ  j `# " @ V@ibȠ2 `?`&`@ * &@@ ;; ->>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed 㻈j ` `@Y?k!`  ( ``" ` `2` ss $ `< d+`  cp@i!`& * & @a`!` (`?`&@ ; ;* &@I`!` "@`c@h2``c@h$c@h"c@hڐ!c@hӐ c@h̐ @c@hŐ c@h c@h`!` !` c@h !?#` @h `@h  `(@h`!` +" ?`& * & @ђ  t`!`  "?`8@hu? gj `-+)`  @@heH@8`   @ @D$ @ `s@m`  " `@* @2 @h8`P`@8Z`   @ϐ* @2 @h% `` ` "? ?`&* & @^?<`@/  p?c#\  ՚ %@  #\ @ǚ @  #\    0 @gْ`0@gԒ`ȁ㿘"㻐@$ O ?`&@ .* &@ .@t㿘Ԕ".㿘@ & @^ J?`."  ##.  *`㻐 ؘ$ @80  %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) ?cj ` ` @j""|   =$ @@p*  2 @k*  2 @k @b `a`*  2 `d ``h@f `!`   !@! p@f@ p@f`eC!$*` €``2?%?@˔   T"@ @q@  p2,T"@ @f@   @* 2 `x ` @fd?`&@   @9 6:5%@?a  \?`&@ \* &@~?` &@  * & @i`*?`&@ " "* &@RM H `@Ȓ6:5%@?  \?`&@ \* &@,?` &@  * & @`*?`&@ "| " 2g@~ `@e]?`&@  * &@  "[ ?`&@  * &@ϒ @E @ @en`@! @| @eb@! @p!@eV@ ! @d! @eJ@ !!8@X @e>!@ ۠!P* 2 @e3x !@ Р!P* 2 @e(  " ?`Z&@6WZ  @ߒ9 6:5%@>"  \?`&@ \* &@??` &@  * & @*`*?`&@ " "?`&@  * &@g "?`&@ "* &@ 9 6:5%@=  \?`&@ \* &@ Ӓ?` &@  * & @ `* "?`&@ "* &@  ?`&@ * &@  ? @l p?   .@6 ޒ p?`  @Ւ p@ ǐ * @ ¡4 * 2  @daX! !`@d @d @cC@  * @ 4` * @ 4 * 2  ah@c,?`&@  * &@ "[ " ?`&@  * &@ C 2h| ?`&@  * &@ @ mO 2M!@ >!x@cB  ?!? @̔ !T#"@ @@ra @cv  * ' ``@ 4 @ / ?`&@ * &@ ,`*?`&@ ) )* &@ ?`&@&  * &@ r@ Ő* 2  @ca a@ca @c?aX ✒$@Ô @+1`?2@b!L?`&@  * & @ 1`@倌`?}a@ ~*  b@92 @bђ a@bː@D aؔ@b@ da@b !@ W"@R @b@ O@J @b!@ @"* 2 @b ?aX ✒$@G @"+1`?2@b{!L?`&@  * & @ `@倌`?a@b`a@bZ@b@bQ?`& * & @ &b@b:   x xX x x x x ll ,<Dh4( ANYHESIODHSCHAOSIN&(& &&&%%%%%%%%x%p%h%P %H%8 %0%( % % $$ $$$$$$$$x$p$X$P$8$0$ $$$####$########X#P#@#8#(# #"" ""!"""""`"X"8"0" "!!!d!!e!!f!!h#!`!H!@"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA㿘    @" 2 2 &   2 2&㿘   2 2&   2P!x}b@(m2&㿘   2 2&   2P!}b@(O2&㿘#, 㿘" initdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2inet6edns0?0x%lx?㿘@"K1"?1671O1P8121F1P 11A1P61.1(141P'1/1P'1!1%1P"11P1!#####       (  8  H P!`X@'0 secs%d day%ss%d hour%s%d min%s%d sec%s㿘  !! Pa"a6 . @s <@y <@l <@r <@e @k P`!`"""@'d L 2 ` , " ""@'L L 2 ` ", "0""@'1 L 2   `2 !Ѐ2!Ѐ2!Ѐ` 2,",  "@""@' !Ё%ld.%.2ld㿘  @2   @ r* @1P!! @ d d@Ӑ@&㿘y"    `1r +   +` *  `?Е: L .+`  ⴐ `*  :`Д *` * + Б: @ +` *  "*   ```@:`",`@ 4 * $ 㿘y    .(`(б> `b2bi.) (б> `b2bK.+(б> `.2*b!. 8(( `(/ 8а( (`/ ?Ѕ8b"b2(82) ((` (( (( (1 ((` (( (( (1 &(& (82 @( " ""b"b2"111111111111111111111111111111111111111111111111111111111111111111`1111`1111111111111111111111111111`1111`㿀''@U'@@  / /    /逢`  2 쀢 2   J@ - +`'?J@ +y`'y"4' 4' 4`5 5 5  K ' , @ *  `?Ѐ K .,  ' b ` '* :`Д@ *` * +`Б:  ', @*`@*`@@L&%b  @ `   ' @ `  4  4 b4 ' @ `  :X.`/b  `' @ `  b  `' @ `  :/.`r/b  `' @ `  b  `' @ `  :.`I/.`.@.` .`.`.`.`.`.`.`.` .` .` .` .` .`?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smH '&%`@#0 ` ``*`  `* `*`     `*``+ @ +`**@ *  @`   / /ސ†"??ڐ!  N S/ /@u͒#'@#@uƒ <@ܒ <@u <@Ւ <` W/  E/@u#@Œ#@u <@ <@u <@ < d@u d@@l @7.+r "be@7' "b^@7  "b#\`#p#`#d#h#l#t#x#|##@#EbЀ b@.bЀb@(bЀ@"㿘@R   L ." `@ &L L * 2?J?`.2 %04d%02d%02d%02d%02d%02d㿈'@ 1P l  "  " #\"#``p@"=㿈`B r"   `2`*3  *2  `? /// ///ꀢ`?/@??@@`?@T` . . . .Ğ`? ///@ * `@    2`*  2+ 2  //逢`?/@ ?@?@@r" `. . = . =..?㿘N  ^ yb   Q`"ؒ @2 _ "`   `9N +`3N@L"@* .@*  `C"@@: .@@**`  ` `3"@@: .@@**`   @%"@@ .@` N  ⴒ @ `2N=r=@ N    #9 64?y" @ `  =N   `2N=2?N  y"  `"?N ` @ ?0?㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@n  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ ??"? >*@*,2$? $     ? " ?  y @r*`P㿘D`4 ` "' 8?, ., \" Ґ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*`  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~2r(P㿘`` &`` 2 @@ j "bx&?@``"  @U ? `@?&`*@``&@`  @> ?ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR㿀@' ?''@~%?Ѐ 8?Ʌ(8㿘 B :@'s.3+1// #y4 b `h*   ` D "$ Ӑ   h*  b ` D "  ,  .@`   ǀ. P 4  6%* . @ 0 07( @ ` 07(*& @*   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~2sh(P%d.%d.%d.%d㿈'1Q!#\@e. 㿘   j@  @" /"bx 㿈 sa @ @Jj "bx %x8  ???? Ț 4`@ :`*`$@*`#@ * * ``# ?''  ?,`` ?'' ' ?Ā@$''''``,` ?Ā@''?Ā ??'?#  : .+@  Đ@@ `@ 2,`,( ``, ,` ,`Ā  ,`,`$%  ] ( @  b@`` Đ@ 2, :, , $@j "bx fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserver%dsortlistoptionsconfRES_OPTIONSenv j ` `'`''  j"`` 2 $  "$ 5 ,4h ,$@"d<*@  $da$  $`@Ɛ@) =-@! 7`!@/UL` '$DH \  .  $@` ' N" N@ 2NNN    2 .$@!@؀ '!ja"@z /e'#a@~, a@  .O Pa@:  )O  $b 2@N "  " N 2 0!j !@.ڐ@ Na 2."'b@:  2AO  ;j"@@   N   `L@ y @ b f,  ,``L@ y @ b f , "Ӱ b@:=  UO  Pb`2N "  " N  !j !@.f@+Ԓ 2.&?L ?耢  ?@N  . " $@`  N @   N   2 .$@ 'b@9 2O  2 N "  " N d a y" `  .J  "@ `"*  ??  ??''b   5@bg' 6` 1` h"+  `@>  "*  @!  j p+  @)  j p*@" " "" ' "@Yb(@9T  O  ֐` jhb `lcc-y7sN "  " N π ̀ ;@ `2N N`"N@*ܐ@ 2 NN ; N.@= Bj `ah-`$@@@* %`. N   ;  `" *: @. %h@{'%@@u'%`h*`c"  ' S'@  @ N` -`@*` '@ @@"#"#"#"# . `N   ;  `" *: & ./ @Q @U  ?    4,, *,`` ` =.b8@8t   O  b@@@7 `j`" j `d `**` "d@Hj `L`` @U  @) . `` @,!`-j `" ` $@N   !j*:   .Nd` ?@$$@@)В . $@`@$@@ j` @  " @"H @bXj `` "` ndots:debuginet6insecure1insecure2edns0㿐N sj `c+-)'%*:  N "  " cȐ@7Ô    @ C@yb  2` ``7* ad+  < -$adc@7  '@7  `#@7 2`$@7 2` (@7~  2N` $`N   2 N  0 ???$OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $㿘 @0 $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` @2@0 㿈  ?'  @{y ?? 㿐@ ?㿈)y" `y 0   N x X   "*:   `  @ ?;   D` +`ɚ@ ;  . = $" $5" `0$:  `2"l*` €?#@!耢 * #@?#@耢 쀢`* *` ` 耢 쀢`*   *` * @`2&@ j8jTiij㿘   j@  @G /"bx?㿐N  / ( s#@'ْ " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿈 @  N :   N :"Nt K N  `D ?#s# @' s#8@'|  ",R (N`:`.`GNN A >4, ,   6  @2l  0+N`°   !4, , `$   ? % **   @&   $OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $ @(*`  *02 @$OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $  s `     @ ` "s` @ @ @`  @ # 2 @ $OpenBSD: _yp_check.c,v 1.3 1996/08/19 08:34:57 tholo Exp $㿐iJ#P` @#    #P&@ܐ#P`?$OpenBSD: yp_get_default_domain.c,v 1.3 1996/08/19 08:35:09 tholo Exp $㿘i&J#P` #P @ ! #P #P& 㿈  ?'  @y3 ?? 㿘`6 "@"&&@G+, @? `"&&@-&@`", 値@Hi ހ" ,㿘#t@Ua4!j@M"` @1А `  @1Ő   20 `b` @1 b`@N 2b` @5@&4㿘tQ!8a0@  / /etc/servicesr㿘!t! #H@'cX$!@Qjb`"b`㿘!t! "j@D$!j""` ,/㿐ta   #H@cX $@  J?` 2'#!U!0@|, L@ #@%s # 2,V "4 @oc࢒ ,@`L@L@ "` "`c@^ ,@}  J ?#*V!4D2"` "`"` @;ࠒ "&$@,  "!$@L  `*`:    @$@`@!ࠒ " $@,  "$@L  $@!4$OpenBSD: fgetln.c,v 1.2 1996/08/19 08:32:29 tholo Exp $㿘 H* D  @} "?& H& D 㿘 4@G) 2F&@ @  $&@ @ "$4 4$  @  $@Ò D@$"@$@`P $@D@@F ئ&@D&@ 㿐@K & @uQ  @[X! 6  "cL6 6 & $& ,& (& &    @u 㿘 @R  j 6 ""x8j P`@un(`jK  ?jB ;j> @u @2P  @ ? 2 ?  : @ 0d < :@  d  " : @ DE      "bx2 @t' h €d#@2 T & @ 2  <   (4 ؐ$$L4 2T @ Ȫ@B 2#0 @" P  @ ? : @ 0d "< :@ d0 " :@ D8<" @d  "@@d   @2'L4$L@@@D 4%@2L@%@&0$  $@"$0@{ $0  ?T4 L  :  @ @?2"$0` $@@"$0@{ɐ $0 @ ?04 @E  @ "@$"$@t ?@?20?0`@@"$0@{ $0 $ ?4 $ 㿘 ;   $OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $J H ? 2H  J  $OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $㿘7yⴢ @ `` - +L@  L@` 0 L@ x XL` ` 0  ) #@dQ@pg$ $    -j) "6"&? ? %x@"  #?%x @  @`ⴐ    Ҡ? ??ˠ`2&@ 㿐@$    "  2 @- 2  @z j "bxx   ?''D'''   @t      @zbܮ   @tښ ܚq  h   2c  ^ T`  T ` ?@` ` L`D/ 2 ` @{v>  : `   * @"   ?     + "    ? 2@`2@@+ * @ ,`D "@y0ɐ"* @yҐ @y? @|ܐܢ @    2  1 2  ) T %` %` @|R \ . %`  T@|H T   ?@`` ?%` @|8 D`%@ h`Df / 2 ` @z"Y  T`` %`` %`%`  *  @"   ?    .  @"'   ? "%` "%`" %`  @|F@@{Ք@Ց.%@ܨ *a @yA䀥@ D%@""@y7 㿘@y1$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $㿘%y @ `` - +L@  L@` 0 L@ x XL` ` 0  @}?@~?  /j "#@8? ??%x@~  @`    ? ??ޠ 4 `&@ 㿘'L'P'T'X@L㿘tb@[㿘t@m"㿘t@w"㿘t@⤁㿘t@"㿘t@b㿘'P'T'X@.Psyslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%d]Error %d /dev/console p<t"@ b ##А ##` : j#"x`t"@@#Ԣ@V((  (6'$@@!#@ Ԗ@ & 6$@` 2` 2`0 <&``@V| & 6$@` !@yZ#@Vi & 6$@`   :,@` ,@`*`0$t"-+:` % N m @ @@V5c @V.6?&$, ?*`ّ:`,@ & 6@` $@'$c0 '''' @z `  `` @@D@@ *@*@8@@ ` #8 @U  >@Đ $@$cH ''''ؐ@zq@p!㿘?"& @p?&& /dev/log(?   @a ?3& @S ?,  (  ? j ?/???????????/c7@! h@ j? @o&& 㿘 2&& "&   &㿘@o?&&  `"`㿘 @ $ "b@$OpenBSD: strftime.c,v 1.8 2002/04/04 19:12:09 millert Exp $XPH@80( 8xph`XPH@8(%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c㿐@' `@2"`2*? *?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%Y-+PLF`%<L`z6"*` €/``!*` |  Ȓ@``!*` `  Ȓ@ `` !*` 0  Ȓ@`` !*`  Ȓ@` d@j'l`@ob @ ޠ'ː"` `@TȰ` `@L ``@@` @^g@^c " `@-` `@$``@` @^C@^? " `@ }``@u` `@l @e` ""@XO!K!@`@ԖH`@'`'` '`'`'`'`'` '`$'`('@ 'a@ @$"!(@` `?@i"`@ ` " a0@@iВ > ``'l` $2m@] d 2 n@]! 2mn!m@] d  !n@]! !m!n? @]$?@] $@?& Ζ 4` -`` -` 5-`:  V g `2  ' d@]Y`Дa8@#!@``` " @i\  @iW `@ `a0@wnbb ',` '@hf' '` d@]'l`@ݖQ`'la8@ԖH`( @ؔ@` D` tc @ @ɔ9` 5`$`6!P !X@@h <@h <* , ,  <@\ɐa8@ bĘ  . L  ``````````````````````````````````````````8`````````````````````,|`lp```l`|`` l@``````l @`ll` ``@0d㿈@ @@ `@  (*@  J ? * ``VК tth ㄀`" ]'L  ( " a  @ t]'L% (( ` (@  @../etc/localtime/usr/share/zoneinfo/?` #@t  N : /@ / 2 a@ o 2  N /@ .   2N! " ?N :" N /`?""`"?@u@u #@ b @n@k@ . 2 @  2?@P ?? @ @k5@k 2ذ?;`8`5`&@2` &`/`$&`,`(@`, 2&` ` 4?` !r4?``24? 2? 2?* + * @ @` ?@@  *@ $@@$@ r 6``, & ` `` 6`e @*` Y`` & @` 6` gLΐ`& @` E&  @``@& ` @4Y?`  `   #L@ @*`   `#L@*@ 6`!L@&`& @ ` ` gL" "` L@` "` ?` `  gL" "`L@` "`?` ` mnJJ Ѐ ,-+2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ۖ $* "@*`@*`&@N :  ʖ ; *@" * @&@N :   < 2@  &@㿘N -   +    @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` v  "$ N . `      &@` !m` 2N  / u` &`㿘 ` @Y d 2  @Y! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @#\*`@ ?* @*`" *" *  @Y>    &@ d@eO d@Y1,`@*`@*`@eB  ``:```: .`" @Y  & @,` +`- @* *` \  `& +` * "*"@ *` posixrules,M4.1.0,M10.5.0X '@r!'{$>?L :ԒĠ 5?! 2&@L '_$ (!?L  , ;  2L?Đ1'L 2L`!L , ;j  ࠒ "?L , Ȑ "?L 2?Đ     &`&`&gL&gP&g` &gT&gd&gh`eب '9 Ĕ̐Ɣ$ $@$@,`$@ ,,`$@ ,` # @XF d 2  @X@! . .*@ *`" *" * Ȩ&` 2?  `@e gP* *  ``gL   eؔgP@gL * @*` ` @6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &gh  &`&gL &`&gP&gT&` &` ` "8?#L@@| @@u  㿘t#xʒ  㿘f V?!"  o㿘!t#|@@TZ㿘@p# #fמ` e#@!f 4@qQ!@ $`e#@L VV"]t"T!cx"""P@"L0!Аl L :A 㿘!t#|@@㿐V!``'`  %tgP@ *`` eؘ%t``   *@ 6* , 'L@ @@m &  #L@@ *" &(㿘!t#|@Vc @P㿘tf`# ,@H " 㿘t#@7f` !^ "`  @. @,`t#hd#&(㿘 ޔ㿘tf`# ,@ " 㿘!f Ŕ㿘  ? D+!L!P +  2.   4  ?*      ?+    @2   @     @??ɑ+ %T@b:@V&@ T T!  ?"  `@b.&@V.@b <& <@U&`@U  & &0'@b!m`&* @*`@*`@ <  d@a$@a! <  d@a$@aޒ!$$@`Ѧc @U d 2  @U! ,  , @ , @#\*`@&&&@`*``*`&$@ @ 6`&$& & 㿘ː@h@͒ "  2`㿘@ &8@a@a8@q@"&@`` ` ` `@ ('D'P&@`'H'L'Ȑ  '̒`'Д 'Ԗ 'ؐ  ' ' $'('' ' < K?В < C?  <?ܨ 4?z'l .?Ԁ )!n'o? "ؤ  ܤ  㼀 @Tג d 2  @Tђ! ,  , @@ `'Ԁ!n(+ؤ  ܤ  c @T d 2  @T! ,  , $@ 'Ԑ*  Ԁ!nݢ'"@ 'Ԁ  ''ؐ  ̰?ؤ\ܣ*   @T d 2  @T}! ,  , * @Ԁ@ؒȶ 8 ?Ȁ`;8''l'4'?ŀ ?Ȑ ;''w''Ƞ 'IH @^V!Ь ? |,* 'P@P@耢@2-?? (/ * 'L@L耢@@ " L'H 2耢@츇???줄ϪC?LH  4? `?' *"@' *@'耢`   @' 2?'LHD P"@?㿘  w 㿐  &  `" K &&  @^V!Ь ? :- * P@P@ @2-? (,* @  L`?"@  && `2 "@  " `?&& ޢ쨅?Ϫ?㿘!t#|@ِ `@ѐ㿘?" 㿘& b 㿘& b}VВ L*` 㿘'DDD&㿐'DސDD@ 'א D"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  $! "b@SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d 㿈 "P*@ "@  *"P@ "%@  'l X#h #\ #`#d@G  㿘uf`  @ " Ȑ $OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $ @( *` @ (* $OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $㿘N@ `@l;N    2N@ 2N?@#?"77'''''L'P'T'X@GL*@8`#`? "77''''@Gݐ*@$OpenBSD: ypmatch_cache.c,v 1.7 1998/01/20 18:40:27 deraadt Exp $㿐@f`        6 2 @hm  D`$$ $ $ $ $  $ $$`  " @h$  @hy$ @hO &$ @hJ $  @hk $$  $ @j$  @j    @  u@hT @& $  u   $ 㿐!f  (  & #'@ "  2 @q 2 @D~ 2 @$  2  yp_match: clnt_callX  L " @k< @`" N@ " @k1 @$' '@Đ@@ iz #P@(  u쀢 `@g'@ '@ 0_ @jK@@*@@0Uu  Ė ?''''''''' ` #\ Ʀ x П"Ā    `@Y`Đ?"`h@ 谒 !`@gf'@ ' @j@#P@@*  @ʔ " @S@.āyp_next: clnt_callP\ `N "w @j @`"p N@ "l @j @$$a '$@'@@ uU    ?''?'?'''' ` #\ ƪ x П!Ѐ    `@Ғb?"`h@ఒ !!`@f'@ ' @i@@*@`@f$@ $ @ir@@*@!@̒@$OpenBSD: yp_bind.c,v 1.12 2002/01/02 20:18:32 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFDH'D!@D  ? ^ @ " ?jbx # @_P @_@h u ?i#H  ` " @@fv 2 `%cH`$&@D ( @i #i#H D@  2 2 h@f/ l   @i< l?& \& h  h 2> hD0@$ @Dϐ@D ?"- h@  x #  '''̒ '@z̒@ @_& h@_l@_"̰ @f Ȱ     ?А   ?؄?//'a'bД  @_ 2 @!P" @e #  u @" @eא  '''' #\@Ŕ ", D耢  "  zD!@4a` `€ ?f& h @ `* @7 `/# 2 & H"W @eS   & L. H. I& P& T ` . J ` . K A. L `. M `. N ` J. O6 X& h@Du '2`@:`' ` ? @& \a''Ēb H Q \ & `@!& h \ @A̔ ?@ ݐ!cH&%cH`2&@ 㿘 ` @?& \& `㿘 㿘i#H  @m  2 ` @`$@$H@e0 $OpenBSD: clnt_perror.c,v 1.13 2001/09/15 13:51:00 deraadt Exp $㿘1f 耢 2 @dϐ!&  %s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... 㿈Ƞ !j  `€!@  !@CC" ! @L$@ 耢`;#*` €!@ @C'3@C " @ @+$@ @얒 @C@C@B @B(a@. @0H @B ڤ$ڤ㿘!z#!`v@2ݠ݈p`8ܸܐpX8RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code) !* 㿘!z#!`@1%s: %s - %s %s: %s 㿘z h/ "Ѐ` "Ѐ`!!"pА  !"pǐ @@A!  " @Aے! ,,%s㿘!z#!ch@1pP8Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK  * $OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $J" @ J2  @(*`  $OpenBSD: strerror.c,v 1.3 2002/02/16 21:27:24 millert Exp $㿘f@`$OpenBSD: clnt_tcp.c,v 1.18 2001/09/15 13:51:00 deraadt Exp $clnttcp_create: out of memory `@bk  @bf d 2 za@0!jbxh ""` 2@= *` 26 @bn@bly  6#$   @ &@z  @   j"xh "bДb"?O @[7K $ $$ $  $   L$  $  @@$ @@&' ''''Đ 0 @ @ 2  P  # @[  `€ P$ H``@ ̚c@@ou $@$$  @a @a h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@ q $@  $ $h 2@d   ` %j $ $Y %jǬ &@'`'`''@'耢 F@  $ "'0<Ȁ2' @ $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@ $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " P@Y P `@ L@`@`P2 `!ؐ` 2 * @` ?@c  '$ $ $ $ $ $ $  @?  Ȩb@''+j 2`* `*  $   @ bx@> Ȗ"@'̒"`'Đ@? "@ '"`'@?' '`  ` & $@`v)?bx " & (& $@`i?"@`b@Yq 2  6 & $& (?bx & $& (㿘#j @Y[?&bx?$ $$ ( @$OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $㿀!f! 2  < @3 @ 2$!+  < 'j"u"&  `&  && &  &  & @T (@< @9 @& <  `@㿘f!  ` (<   $OpenBSD: rpc_prot.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $㿘@ *  ``@ b!㿘@  㿘 @ ` " `    ``€ @ `  @ `㿘@  " @   @ `  @ `@ ֒` 㿘@ ڒ @ Ȓ` " ` 2  u`  `@ =  㿘 &`&` 2 @  @ ` @ `  @ ` @ `  `*  "@ "@ "@  "@ "@"@ "`"@"`@(4     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &`$OpenBSD: xdr_mem.c,v 1.8 2001/09/17 18:34:51 jason Exp $`"uLu," " " "  "  "@ "   "@   "   " ? @dd(*#d ` * `* `*d# "  #"@d 0#d*@  *` *` *` "  #㿘 "  $  @`  @$  㿘 "  $  @`  @$    "    @4 " "       " "   $OpenBSD: bindresvport.c,v 1.13 2000/01/26 03:43:21 deraadt Exp $㿘@㾈`!'@l?2`\?@`  `   '`  'j ."bxE? '` ' ) .` *`.@ '@A찒 +@A  #@" !j  "x@-   $"x@ @ &$"x $h "b@$  "b@$v "b@$i "b@$b "b@$OpenBSD: pmap_getport.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $pu o6 a|?a|!'''#\ab7ڐ ! /u!'!`''''' #\#d ڀ  h "b b`  ڀ 2 h "b @܀?"6 @U6 ځ$OpenBSD: pmap_prot.c,v 1.4 2002/02/13 22:36:52 deraadt Exp $㿘@  @ `  @ ` @ `  $] "b@$a "b@$OpenBSD: xdr_rec.c,v 1.9 2002/02/16 21:27:24 millert Exp $xdrrec_create: out of memory 㿘@\o D z!@*a05@ @$ <@ @\\$ @  $ z!@*a@\y0 $   2 $  u $ 8a& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @- 2  & @ "㿘   4   8 2 @a 󀦠 8@9 & 4"$ 4@㿘!    " 8 @^m & @@$  @$ @  2  㿘`   @T–  ?@  "  , ?  "  0" &㿘 ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘 @[c @[a㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` "@ @?* "   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@]: ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?$ "b@: x؀ N " j@]'$ b ''jbx@Dؒ@]$$  " $:$$ @] $OpenBSD: __strerror.c,v 1.8 2001/12/08 20:37:32 deraadt Exp $㿘f !@Ce  0?,@Oy  @CX  0,libcUnknown error: 㿘 @#u"Ԁ . "  @<@ #j? @/@ @]' "@,j "bx#jbx@$bx㿘? j "bx ?" @\ @Yѐ 㿘? j = x @ @7   @.@08/`(@ @ @?@4@08/`(@р 6`6`@؆@NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC㻘 "?N @ / @w@[ 2 @["X 2"`@[" "J B  ?* : `(3 *` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@9?2 L 2 L ?x(((((((((((((((((((((X((((((((X(((((((X0@7 ?,@[ @Q$?#\   @[ @Q?2???#@ @Xt  && ̐@[?$OpenBSD: index.c,v 1.2 1996/08/19 08:34:02 tholo Exp $*`:`J   $OpenBSD: errlist.c,v 1.3 1996/09/15 09:30:59 tholo Exp $X@ hH0pX8 X@`H0p`H X0      h X @ (       h H Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: strlcpy.c,v 1.5 2001/05/13 15:40:16 deraadt Exp $   (+  2 2 " 2+J " ?$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $JJ2 @(*`*$x "b@$OpenBSD: xdr_ypbind_resp.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@K " @  2  @`@`$OpenBSD: xdr_ypbind_binding.c,v 1.3 1996/08/19 08:35:00 tholo Exp $㿘@Ք  `@ϔ  $OpenBSD: xdr_ypbind_resptype.c,v 1.3 1996/08/19 08:35:01 tholo Exp $㿘@$OpenBSD: strdup.c,v 1.3 1997/08/20 04:18:52 millert Exp $㿘@X` @U @W0 㿐@3d  ?&$OpenBSD: xdr_ypreq_key.c,v 1.3 1996/08/19 08:35:03 tholo Exp $㿘@#  @5` @n` $OpenBSD: xdr_domainname.c,v 1.3 1996/08/19 08:34:58 tholo Exp $㿘@ @$OpenBSD: xdr_mapname.c,v 1.3 1996/08/19 08:34:59 tholo Exp $㿘@ؔ @$OpenBSD: xdr_ypresp_key_val.c,v 1.3 1996/08/19 08:35:04 tholo Exp $㿘@r  @U` @` $OpenBSD: xdr_keydat.c,v 1.4 1996/08/19 08:34:58 tholo Exp $㿘`@-$$OpenBSD: xdr_ypresp_val.c,v 1.3 1996/08/19 08:35:06 tholo Exp $㿘@5 @` $OpenBSD: xdr_valdat.c,v 1.4 1996/08/19 08:35:00 tholo Exp $㿘`@$$OpenBSD: xdr_ypstat.c,v 1.4 1996/12/14 06:49:45 tholo Exp $㿘@$OpenBSD: xdr.c,v 1.6 2001/09/15 13:51:01 deraadt Exp $㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐N@'   .@ 㿐@'В   .@ 㿐 "    0@  @ '€@€    @ &@  㿘㿘$ "      f  b2      2   u c`?xdr_bytes: out of memory 㿘@[ "2  2+ "   0"   @R &@  zȐ!@ c    @R&@㿘`–$㿘{ "   @ "  2    €xdr_string: out of memory 㿐 @   "7 @U' -8+ `  ` 0!  2@Q&@  zɐ!@ ` ,#@Q&@  㿘?$OpenBSD: ypprot_err.c,v 1.4 1996/12/14 06:49:47 tholo Exp $  Ʉ(             &&&&&&&|&t&d&\&l㿘@ union㽐@/  @T  j<  j "bx @- ?@Q @$#"`@ ɒb4@           c@Q( @@Q0%@Ӗ  $@䀤c``@Iސ@/?  @P@Pr $@&  5ˤ"   ` , %   `$@@$ '8@> , %   @ @ "$  2``2$`@ 퀤@P   @Pg*  2 & $& @P\&  & @P~@Ik  & && & @& 8  F@S @Ȕ ?  @P6, 7 0:" ƀ 4   ?@P&  ' $@ `,`  4`  @V,` . @S| Ȕ   @PH, 2 ?@P%?. "?@ Ā@ @ &@㿘@ @M`㿘@ @S` `@@?` $@@O$`@O@Hސ@SP 㿘@㿘@O  ff *`    #" # # #?㿘`f*`"@@  2 "  @  " : @H  & &   @6@  2 @O$@㿘  @&   22 &   2   2    @R  &   @ 2   "   & @ `"   2   2  㿘  % @R #j$bx  bx  @R bx  @Q@R  "&& $Ą "b@$OpenBSD: qsort.c,v 1.7 2002/02/17 19:42:24 millert Exp $㿘  `@ `= @T3%``@$@#6 $"    ,*  @$@ ֘ Т06`@T|`@Tu`(q@Tn6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **@S-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =@S%``@$@#6 $"    ,*  @$@ ֘ Т0a@Rߐ$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  @QĖ@Qג%$OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $J@   J@J`  % "b@㿈f"`"   '?   @F ?"?"$OpenBSD: merge.c,v 1.5 2002/02/17 19:42:24 millert Exp $㿀'D'H 'Pj "bxB? 'D ``?'H@R@L6  D0?H'P@,H@R` @@'耢' H@Q'` ?' @  ?&@  ?&@P€ ?  2" MP€F'€464'- P%@€$@($@P%@@Q2 P€4@P€4=" "  $@ `$@`/  ,@ ` ,@`!`" $@ `$@ ` ,@ ` ,@ ` VP ` $@ `   ,@ `䀤` " $@ `  ,@ `"  ''` ?@ @ 'D H@P@F@K+ 㿐.@` ?@P̒@$ &@PÐ@@@P@  ?@P@$   @P'     "``"@ "@   @,*@`$ P*$   $@ "@   @,*@`"@ * *ܢ$$  @,*@`"@ * $ $@ " "`?  㿘  ,*  @ `$@ `$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $2J@ "J`  2J@ 㿘 I@8 j @ @o@ @o @ @oj "bx ?ф" " " " " " r @(: а  ?j' ' ''''''!  ! @   "  "& `& . ``& i& &`D9j'"x  @B ?#` `"x 2``oj  & ђ`@ f&  @"& "x#& jS   & @Lx 2K5j@ !& ߐ#0`@x# a& & & & & & &  @F "'5j`  2   "` @̔ @Ȕ !  )€??5j0j "bx5j x@`"&x@B&x 㿘  `"" @ & " (j" "bx?@C: '|'d 'h'`'l't'x'p ?"@j  t  'lt  |x"X`'tߐ"'x| "'||ߐ"Xb 't'l'x'd'`'|'p| ဢ@d[j@H"$ \ @K"$?$a| $$a$at$ax$b@Hr$a J$`&& & & & & & & & ab  $b "0b a`& & & & & & & && ` "j  j j b  $b @& $aaА` j@i?$ab  $b aВ @$ ?`a@K `̀@wa@AD  • jL!b@b ?F$b \ $b X'\ T/ P/ L/\'X/ H/ / /X'T/ `/ `/ `T//'P///P'L////L'H/ / / H//L!b@j  O?"@~j_2zj'pb  $b $a$bp `؀!'p"'pp@ 8'p` b  $b b $aԐ $b $bp$ad p?*  'dpd* @ *'ddaؐ@L?l@L??* 2``4aܐ 4aaЖa@ې +$@b Ր b@@3?b  $b  b  $b @b  $b j j O"bx` ` "a@GEaЀ?@@.@G= 㿐 @1 j  2 2   @j "bx, bx 2,?"bx@  "@  `2? $4 $ $ !ڒ 4 $ !ؒ @I@  @ 0?TMPDIR%s/bt.XXXXXX/tmp㻐@IG @I: Ԕ Ԗ В$@%c?'@H @#T?@N> @H  㿘  `"" @? & " j!А "bx?㿈  `@* $ j "bx'?@  ?  @@ 0#\  @ 2!Ȱ" @ @@0@$ P" `2@0' ` ` `.' .. . .' . .  .. '... . .. 7...7  `?2 .O.* 2   ܄ؚԘБ.`2 7 **  '. ***'**** ' `* `* `**' * * **`*`2  ² 0ki* 2  e ΰȞĆ.`2 @7 **@  '  . * **' * * ** 1'****'****' `* `* `**' * * **`*`2   P" `2@0 ? ``U2 * 2  Ģ+ 2 @  '``. +``+`+``@' +@ +` +`+`` @ `@' +@ +` +`+``@'+@+`+`+`@ 7 + 2`*@ *t`Ģk* 2  f ܰ؞ԆЄ̪ʑ+ 2   '``. +``+`+``@'`+@`+``+`+`` @1`@' +@ +` +`+``@' +@ +` +`+``@'+@+`+`+``@'+@+`+`+`2  7 `+ ʒ@2*` *`' . . .'. `. `. `.'. . .  . . ' . . .7. .7. ..t#tp * d * #p* l t`*  * (` (` ph(`  #l  * (` (` l(`  #h * (` (` h(`  #d  * (` (` d(`  #` ` `* (` `(` `(`#h ``"b @@ $`b j "`(  j `  j "bx?`aܐ < (`Ԑ@2? '' @> `@> `aܐ Ԑ@?Ӑ '' @> @> `aܐ ̠Ԁ2 a@ @` "?)`  Ж@ 2 @ ?  Ѐ @@  Ѐ "`b "`@m?2 `@@ ?`    ?  "@ @ #\@J c0m,* 2 2`   , "*@>.  ,  6 "@6  2  ` &  $ ,@ `@>`@>`(@ @@ 2 a`@2a`  4`a . ..chown0dmesg0fsck_ffs0Bfsck0reboot0halt0ifconfig0Bdhclient0Binit0mknod0mount0 mount_cd96606( mount_ffsB mount_nfsBnewfs0 mount_mfsBping0route0umount0dhclient-script disklabel6(#!/bin/sh # # $OpenBSD: dhclient-script,v 1.11 2000/10/18 23:42:56 todd Exp $ # if [ "x$new_network_number" != "x" ]; then echo "New Network Number: $new_network_number" fi if [ "x$new_broadcast_address" != "x" ]; then echo "New Broadcast Address: $new_broadcast_address" fi if [ "x$reason" = "xMEDIUM" ]; then ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 exit 0 fi if [ "x$reason" = "xPREINIT" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 \ broadcast 255.255.255.255 up exit 0 fi if [ "x$reason" = "xARPCHECK" ] || [ "x$reason" = "xARPSEND" ]; then exit 0; fi if [ "x$reason" = "xBOUND" ] || [ "x$reason" = "xRENEW" ] || \ [ "x$reason" = "xREBIND" ] || [ "x$reason" = "xREBOOT" ]; then if [ "x$old_ip_address" != "x" ] && [ "x$alias_ip_address" != "x" ] && \ [ "x$alias_ip_address" != "x$old_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi if [ "x$old_ip_address" != "x" ] && [ "x$old_ip_address" != "x$new_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.1 >/dev/null 2>&1 for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' |sh fi if [ "x$old_ip_address" = "x" ] || \ [ "x$old_ip_address" != "x$new_ip_address" ] || \ [ "x$reason" = "xBOUND" ] || [ "x$reason" = "xREBOOT" ]; then ifconfig $interface inet $new_ip_address netmask $new_subnet_mask \ broadcast $new_broadcast_address $medium route add $new_ip_address 127.1 >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 done if [ "$new_static_routes" != "" ]; then set "$new_static_routes" while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi fi if [ "x$new_ip_address" != "x$alias_ip_address" ] && [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi if [ "x$new_domain_name" != "x" ]; then if [ -n "$new_domain_name_servers" ]; then echo "search $new_domain_name" >/etc/resolv.conf for nameserver in $new_domain_name_servers; do echo nameserver $nameserver >>/etc/resolv.conf done if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf fi exit 0 fi fi fi if [ "x$reason" = "xEXPIRE" ] || [ "x$reason" = "xFAIL" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi if [ "x$old_ip_address" != "x" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete $old_ip_address 127.1 >/dev/null 2>&1 for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set "$old_static_routes" while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' \ |sh >/dev/null 2>&1 fi if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi exit 0 fi if [ "x$reason" = "xTIMEOUT" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi ifconfig $interface inet $new_ip_address netmask $new_subnet_mask \ broadcast $new_broadcast_address $medium sleep 1 if [ "$new_routers" != "" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "x$new_ip_address" != "x$alias_ip_address" ] && \ [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi route add $new_ip_address 127.1 >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 done if [ "$new_static_routes" != "" ]; then set "$new_static_routes" while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi if [ "$new_domain_name" != "" ]; then if [ -n "$new_domain_name_servers" ]; then echo "search $new_domain_name" >/etc/resolv.conf.std for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then rm -f /etc/resolv.conf fi mv /etc/resolv.conf.std /etc/resolv.conf exit 0 fi fi fi fi ifconfig $interface inet -alias $new_ip_address $medium for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set "$old_static_routes" while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' \ |sh >/dev/null 2>&1 exit 1 fi exit 0 c2_compiled.___gnu_compiled_c_open_countnetif_sun.ogcc2_compiled.___gnu_compiled_c_netif_prompromdev.ogcc2_compiled.___gnu_compiled_c_filestore.9_bootstore.10_prom0_fake_saveecho_pv_putchar_sun4_idprom.65_dtab_stringbuf.75_promdev_inuse_prom_mapin_prom_mapinfo_prom_mapinfo_cnt_prom_devmap_promvecstore.88version.ogcc2_compiled.___gnu_compiled_cufs.ostrncpy.obootparam.ocd9660.ogets.onfs.orpc.ostrerror.orarp.onet.oin_cksum.oether.oglobals.omemcmp.oexit.ocloseall.ocread.oalloc.omemcpy.omemset.oclose.olseek.oopen.oread.oprintf.oarp.osdiv.oashrdi3.ostrcmp.o__main.ostrlen.oudiv.oumul.ourem.obzero.orem.oinflate.oadler32.oinfblock.oinfcodes.oinffast.oinfutil.oinftrees.ocrc32.o (??2 4  4 @ @ @ ה  !& ?2 @2 @ Ŕ `2 @ ) 2$?4  & &㿘  " (@=& &  (&   . (6 㿘 ,&! @  2& l  2`*`    , 2 @6 @-   "@!&P, `?, 2   +" 2$&-`    @Y 20 4 ?2 @2&  @# 2 &6  , 2!,2"!2`! &!   @ *㿐 @ ` ' 7@Ĕ  @  0 @   & & & 㿐 @ i` '  ?2 ?7@  @  0 @   & & & 㿘@`* @\7    @A 2n?$`2" @@ @;  @<7 "T?&& @6&& && "B  `   @` 4?0@`2 " @"$  `  (@ @;  @; 2'@?  '`@`  @6  ' @'  ' 㿐    2    * @  2   * @    ' '   !@!̀ "!?'!€ `8 @  " ` `` @ @    ``@㿘` `@Ք $ @& ?2" ?$ "@>M" 2?" ( @@"! @4" 2?@?"?p `` @ $` 2 @ |  t 2 €??"k?  @3 @2c?$ '' "آ   24$$@3䀢 G   "$$  ? ''@= ` '   $$?  @3  ? @Ȕ  ? *@$  ?㿘 ``@@ $`@0 ?"+?@@?2`$? "a@:s$` $`a "a@:k$a$aaȀ "a@:c$a$aa@:^@:\@3I  ?㿘  ``@۔ $ `j "bx?" `  `@? ?@ " ?$" 㿀 @# L" !ؐ!b!Ԕ " ?'''' @4@  ?㿘T  j "bx+?` @34 `" @  &? " 0@9  0` @@"$ 0@9 $ 0 D "$ @9$ D$ 4 $ 㿘 @=1   ? ɚ @<ʖ @=$ 㿘  `@D $ j@`2"j "bx)?@ " )" !€ @t  ? @4 "   @@0@$ 㿐̀ Ȁ @9J @9`2B?$$'3'Ƞ `? "`@@  "@?2,?2,` @<)@ ̀?*   !$ 㿐bK ba#a̐@ 9?D?2.a̤!!a$à &@8ߐ  @9 $a. a`? "`@aa@  "@?׀aȀ?&''`Ő?*aȀ b  !$b 㿐bà aȀ @8 @8`2 b6?b  !1$b $a$aab'b'b$b b a* 2" b@; @ Ѡ  ဦ$b 㿐bb  b%b*'b  !$b   2 &'@Ж  ? ߰ $b 㿈  `"" @ڔ $ " "-" "*8Tj!̀ :!Ȁ @8 @8L`?"$!$!@3 !!" "@; " !'"''' (!. € (  j $!"@"  @j"@ j" R j "bxM? 5" )2 "!€???" %" "" '@7" '"'@: " "'@3 #?"`" "@7@   "$ $"  $"  @H l0Lllxa @֔䀢?/ ?' ' b@  @M  "b@@?2 @@ J?     ?`"@ @. 2 #\@>ڔ 3b /$b. * 2`2   .  "*@2  .   4 "@4  2    $  * @1b b$b @$b@ 㿘  `@ $ j$ @`"j"@@% (  " 2 $ @  $?$ $ "bx ? "  @$" 㿘@ 2@?`@ @G  @B 㿘`. @   " @( ?2I?`` @& @1{. ``@ " @: ?6`?* c2  @ 3@*`2  ``? ? @" : ?* `+ 2 ` *3@*` `` 6`b?$b㿘@  ? ?$  @`$㿘  @/t㿘j P`@.  $ 2 0 j ""x@4 G?"  @/T @? $  ?4 $   4 ` @@" <@6  <$ 0 $  8 &$  2 @- @/Q#X  $  $  ?Ȑ*@$  4 2 @ 4 4 $  㿘  `"@^ $ `."*` €@%j(" ( #  $    ( " "  $?2"G " )2"!€??<?"j "bx5?" " )2 "!€ $" ـ8 @\   ( , ($ $@"   @@0@$ \x㿘'L!Ā ! @5% @5c `; &!&!!L@0#  &!& "@ @`* @   !@3!̀ 2.?&!" @"#!̲ @ !Ȁ @4@5*`2&!? &!!Ȓ@/' !'''  㿐@/ה ` @/Ӑ& :! @4 @4`$?&'!?@' @ 8@/@K "@`' 㿐` !@?@@k %? $$ $ $ 4 @4  @/x $@ &ۦ@  㿐@/] `@/Y  @l 2` ? "!@   ? @Z "'`'@ @ 㿘&`!Ԓ&`"  @&!@&" 㿘!Ԁ`@2   !&@" `$" $!@ 㿘 ,&!  @ Jj $@& 6 m   ?2  !*`2 @`*+@   @( !2 !&! В*2 ?@    ?*2 ?@    # @e @` "x' ,` *`  ? *`   #  @F !?&! ` @@ ߀$x 8@6 # <  j "bx  @ $(  &&   ""  [&$ &$&$&$"$$"$"$ mpool_new: page allocation overflow. 㿘$?zb@Ő!@4@. , $ &$@"&@" &$   *   * "" 2 "" "" " @2 &" & 㿘  *  䀢@ ""`@ "@@ & "`  @"@"`@3  㿘@O ?`  *  @ `"`"` ,@"@$`$@` 2@"`" "@`@` & "` ` @`"`$` $` @2 &" &  ` `T,`&"@@ 2$I @8k $`@#$  ? j`@5 j "bx$` ,`` `  `*  ,`  $@$`` 2 "`" "@$` $` @2 &" & $"`$$``` `*` *` 㿘 @ & "`  @ &"`@2T 2@2N 㿘   @f?2  ? 2 @$  ?㿘dd @*;d@"7d  2/  @A?<    *  @@  ""` @ "@ @ $`"`  @ "`, $@"2 d@1ǐ    d@4֔ $ , d $d 㿘$ "$$$``$`@7 `$@K$ "$ ?"`$$``` .``("   2 2  㿘'L'P'T'X@L$_ "b@㿐@6  @   ``  @j "bx @) " 3  `!3 "cL3 # $# ,# (#  # Jr  waj j        &  " x J+b  J +    "@ %$sniglet^&8`  j "bx@!ܢ  ?$a$a@[?$aj"x @ w a@4@   ̀@`@  ` @ Njx "x$a  $a a@)!?!j"xp!j2 O@!a@2 O`?  a  €#`@ "` OX!j`(@& $a@ 2V ` `D* a8` `*@ :@ *`$a@3   `@=`$a0@=\@$a0  a @ ?$a$$a4@0Z $ !j"x@֐"$"x#a<D К`x0 & & & & & & & &  &`@)Ja@0Y$"x 㿘 ?@ @0L " ? ?j  x?8x ` ! @$ $ $ $ $ $ 4$! $ 8$  D @3  Ē @3 @` @ :  @ $ $ - " @ w *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$ j "bx  $ @  㿘 4@%'  & @ @  *  D# *#  * ,& $& `@ږ " ?!.`2 ? & ,& < & 0@%& (@  , @4& @㿘!4@<|   j"x!؀ !!ؐ?* &! @/!??&!@/!@W 2!j"x! 6!!8, @ "!@/q! , ! "!@/f! "!@/`!?@(I@/Xj ""x?㿘`j "bx? "? !4  @<  2 ?@  2?&!0 㿘!4 1aa!  &&  #& @!! @  ?!? Oj""x&!, !8 đ, ` , @ @  2?  ,  㿘  @=  j""x#!,?㿘  !  j""x#!,?  @ 㿘      @   j""x",?㿐 @ @:w ?P ` ` -` G`   % 2  `@ @  G`   @:J "s ``݀@ +2 `'@* 2 `@:, "W ``  T?` ` @ F?F ` `C `! ``+00 `6 `,@  @͘  & "@&@ђ 2 `@k  `?@  ?0 @/0?? ` ?-`㿘    j""x$!,?!$   $!($!$$!  ! 2!$ $!( ( @9 "m?$! @ "  ($!$?$!$_ !(*  `2@ *@ @9 $! $!(`  @ `!$$!  $!$"! @ "! !**`     @   *?0)! ` @ @ &@@ ? " &`! ( 2  @& *@ 2" &@  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @Ȓ !ؓ,` "  ?!! `&!&! (@     D*` + "&  ,  & ,& 0@+㿘@,  @'&@0 @-$㿘! € , (  0㿘 @z   &!  @s.@   !j"xJ$"x?6  + +* !ؐ@" ! `&! `7 ``20(* * * * * * * * ؔ Lt`$OpenBSD: calloc.c,v 1.5 1999/11/10 20:12:31 millert Exp $㿘@23@,W @/g 㿘,` ``$, @2 `@'N,`2`6 $, 2 @'C`,`2`,``2 6**`@6$ 2`2`㿘`. `@C"?. "  ,"* *`@`2 `" @ @' @4.`22@22*   @4 248?$8``.`㿈  @7Ė   @7 2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'2%* "@ , 2 $ @ @&@ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@; 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`@7 c  @e   l  i,`,`2  ' %@ '`' `# '`2#  * @  `@  @Ӑ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?@6P "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  Ҕ`@M "`?@`  .` 8` & 8 (@{` 4 $ Ő?㿘 4@@ `2  & 4 & 4``@h.`,`2 `@5֖  &` ` *`*2*  2224`㿐!  6@  ?6` {6`  <@A ?*  D@  3 *  <  '@0 ?*  D @ @> @"? J?j O"bxB?6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.@.`@  `@?7 .@.`` 㿐!? @ϐ 2i?  ဢ@,! "@ :  $'++ + +   `@`7 **  <@ ?*  D@  4 *  <  '@y ?*  D @ @> @{?j  O"bx?㿘@( !!<   , &! @+ʐ " @+Đ?* $ ĕ.2 !8.`" $      (HASH: Out of overflow pages. Increase page size 㿘 D, `$* : ?: 1 8. @ @c À2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$ % *` ,$   ?$   * ?2%``m, L  2l ` g $Z% * ,$  , ?$  :** %  * @% , ;I  :**$   * @%  @-*` $ ?%$  D D .  4  ?* D@$@ g. .  6 a @  1j "bx 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @{  :**$   * *# @4TMPDIR%s/_hash.XXXXXX/tmp㻐@) @)" "("8$@ ?'@)< @?&!@.! @ݔ  @)- ! ?㿘,``$4, @2 `@".`$ 6, 2 @"%64`4`` *`$ @2`* 2 㿘!@6 @& .`!8$ .`     *  2@'  ?*@    2@* *@ 㿘`*  m* 2 *`*  4`$ , 2 @!  +  +  42*`4$ 2+ * 2 4 `|%0+   &@2 @ ,$@,`4 2 @!4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2 @!@ +  +  42*`4$@ 2@*  2 +  4 ! 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2`@1ٖ ?`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`   8 ?$ 8㿘`,  " * 2`@( `$*, 2 @ & @1u $@``" *2   **2  ?,  @ ??㿘 @+  ? @1H "    +  @  `+ &@  㿘`.  `2.*  ? @1 "s?`  .  `*  ? @1 ]` ?* @   2  "?@0 -,`D?  &" !&  * !$  &!(&!$&!  ?@0Ӗ (&!  &!(`@ 2" !$&!  &!$ ,`2 @?&  j!@ƒ ! & "bx?㿘`   "@(`! @$@$ @&!, &!( * ?@0 /&!  `,!$&!  &!$* @0p Ĕ $?,` 2 @ j! `@n@ 0 "bx?㿘@  ?&! &?㿘```? * 2 "@ ` ! @$^@$5 /$!  ,%?@* @0 ΐ ,` 2 @ j!``@@ 0 "bx?㿈\'P 2d? @ P* 2`` 4 P@/ؖ $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ $OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $" @ ` ?  2    (  $\ "b@㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘8`j "bxL 2 $?j "bx@$ L@ a  0,@v ?L`XL X`?#@  @) 4GA,?L X` ``%<'+j L/2?,@a X, `Q%bx8L`*@6!  &@D , A, a,j"x`5 " @-! j"x`' @ jbx `? ayL Z2b" ,  @ `ʀzŀ  /dev/arandomx @ۨ"@ߒ ?@ x@s   %?p    , 'l p l @ʚ ?2 ?. ` `.   @  @.  ` , , . 㿘j X` f⨐ *@? # X**⨁㿘j X`ff bb? *b ` `,  @ R@, ` - - ,㿘j X`ff⨞⨐ (⨖   ` + *  *⨔  (⨄ ,   ` + *  *⨔  (⨢ +` +  *  *⨘ (⨔ ( + *  * $t "b@$ "b@$ "b@$ "b@$ "b@㿐#\#`  @$  㿐#\#`  @$z  @'P'T`'X#?"77'P`''''@o`*$OpenBSD: vfprintf.c,v 1.17 2002/02/19 19:39:37 millert Exp $㿘` @&`&`&` @   ? ,$ 7''7'''''@1 @5 2? @  @4 InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.㼐@'H'` ` 2 ` @I j "bx*?`   HW` HH<'$'8 ''''' '$ @'$  $< %'$'$$ $$@ '耢 '[ ޤ ' $  '$''?/+$J@`'$?`X!Г*` €O+ $ /+ $ L ?Ѐ 8, L** ?Г:`  L $ 8  '8H8@8 .' '$.' $ '  +/+$J  *>'$L ? 8, L** ?Г:`  L $ 8  '8H8@8 .'$.?&i?h$?Ѐ  , * $?РJ@`?Ѐ '$ $?&U?T?M  , * $?РJ?Ѐ '$ $2A'8 9'8H8@k2$/ - @$J l2( '$$ 8`@.@/@   ''8 @ `.@*  : `.@:  6q  -/+`k ? g   G  "  8`.@''ȴ?`".@''ȴ?@&L x#  -/+ X @&K  ` ,#`!#\7@ƚ0 g G00?@$ g g E e e f'0@' , @ ,`  O7 @  O7`  " O7 C  -@/+  8`.@ :`:  `.@ " @ 8`.@ 2`.@ "   '' 8 @ `.@  `.@  8`.@`h '  q x8`.@   @! "$/+@!   'x'|x 8 @ `.@  `.@ /   h  ''X'\X  8 @ `.@  `.@   2 /+ '?`S "  7F   4`,  `4 0 , 806 03,  @!o `0, y  ` `0, , 4`  ` 4  ,'@  ' ? @/@ /+ ''O+ `' '`4O+" . 3xc $$` '耢 ': ? c$$@ '耢 '$ O+  + $$`  0/8/98 $$` '耢 ' `4" . +xc $$` '耢 ' e? 4$c$$@ '耢 '̒ O" - +xc $$` '耢 ' 5? 4$c$$@ '耢 ' ! e$$@ Fx BV0  $$` '耢 'u 0,@  $$` '耢 '\ ߤ,?  +xc $$` '耢 'B Ť? 4$c$$@^ ``,  $$` '耢 ' $$` '耢 '  0  - +xc $$` '耢 ' u? 4$c$$@ '耢 'ܒ _$,$,@R$,$, @ '耢 ' B0,"@ - +xc $$` '耢 ' '? 4$c$$@ '耢 '   Ȕ $$` 0$0 @ '耢 'o 0  Ȕ $$` '耢 'Y ܤ$0," $,0" @ t , 4 R   ./8/98 $$` '耢 ', x B,$,?$, .@ ? 4 +xc $$` '耢 ' ? 4$c$$@$$` '耢 ' f$ $  @ '耢 'ϒ R 1" , 3xc $$` '耢 ' 5? 4$c$$`'耢`' !8 &  ' 耢  8' 耢  8'8`@"` @ ` @?  (((((((((D ?`/*`d * d *`d * d*`d*d* N%2   N `X! *` €N ?` %L* @ L*`ДЀ @LN*6 N ?`  L* @ L*`ДЀ @L $@  @ d@r`d *@`@4 d@d`d *@`@4NЀ NЀ   +  * ?И NЀ  $ @ `@d@2`d *@`@4qpN `@d@ `d *@`@4_^N@d@`d *@`@4ONN@`@d@`d *@`@4>=N@d@`d *@`@40/N`@d@`d *@`@4N@d@Ғ`d *@`@4N `@d@`d *@`@4N@d@`d *@`@4N@`@d@`d *@`@4ߦN@d@`d *@`@4ѦN `@d@`d *@`@4N@d@p`d *@`@4N@`@d@_`d *@`@4N@d@Q`d *@`@4N`@d@B`d *@`@4N`@d@3`d *@`@4rqN `@d@!`d *@`@4`_N@d@`d *@`@4PON@`@d@`d *@`@4?>N@d@`d *@`@410N `@d@`d *@`@4 N@d@ђ`d *@`@4N@`@d@`d *@`@4N@d@`d *@`@4N2N@* & )d+ " d ` ȓ*` €`@?``@? ``@?``@?x`` $d @           < P  d x           , 888888888               x  T                      TX X       ԝ㿘@  * @P&@@@& @  @S$ &@㿀?"\ f#   e E  x#( 9/ -/?#\  ?@W耤 g G f# fJ 02 @xc( B  '@@x#( B3'@   0`*@@ '`" "@ ``, -,   +,  ` @-  0.@ A ` `0..   & 0. `0. &@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  $OpenBSD: strtod.c,v 1.15 2002/02/19 19:39:37 millert Exp $㿘f#.  ` @ " ,, @ސ "`"`"`"`  f`㸅("@ 㿘? #  @ @@4`4  *  $ 2  ,   * @L ː, " & 㿘 @   *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c@ @  @4`4 444 4  $@? #@ 4 4@4 @   4 $@  $'  "' 㿘` x#4*  >``#!f#```"q$# $@ 2^$@"`" >`U>``2@㿘>` @ *@  Z `  " * ` " * " 2@ ` "`" & C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  8 4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?` " *`"  * #??ā`@ 'Hyb @y@ `  H  ' ` @ `2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : *'     -*   ?4`+  *  ?Ъ`M@ /9뀥 :E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*`%@ "@" 2     `H &@  'y PB?  x?c@* @ $'%H y PBD? >'@ 2:%`"_H%`  x#@.` ?$%% B"@ $%xc@*@?$&@ .`% B@?$% B x#@*` ?$% ?*%@P x#@* ?$% B?4$ :y!hj ""bx䀢 H  x + @?$% B?: + ?,$ ?%( B?  y$(#a?_]  x#@* ?$% ?K:4y y`  + ?$% B?: + ` @?"y# H D(?)F!?()BD F?y Hj ""bx䀢`|H 2?@?r  2'''m  0[5 # @  I ?   ? ?2@ :?8 ?y ? H! B0& y X!+'y y``&1'? y"yy `!`hy `yy`p pB'`pB &'??@n?Ѐ B- %?,??? @'cD?   #"yD?y ` y`pB B?d?? @D?   F#' €y?yy x y` 0  ``` *@s` ܒ `       $@  ?3 6" @   4`% & $@    2`&  u & V  ?H 2"?"쀢 #㿘 t -    `@a `1?#  @ @@4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' InfinityNaN0hf#'L'P'T ?f# *@  ""f"#Ȁ`6'@ '@ * ' y T#"@̀  ?    \ N    \" B T "\ ְ`Ȑ "  +ȓ2g Ⱥ| ?* &' $2`   @Ȓ"@̐$* 2@ ̐"*@' y B?{͔ ? '?y y 'y F`yyJHBH ' B# 'x#@, $ȇ%)'#?    '% 'L 8'LL` 'L L "'!\* €?'? 'P'P`P 'PP' 'P '쀧` f ` "#  ,  `"㴪f"# ` Ⱥ  ' x c@* @<"  #yȠ    ?Ȁ x# /`@ &' B<  `ȅ!?Ȳx`c@* @>`$Ȁ %B?x#  /`@ $ȇ%B?ȡ<  `耢 y` 9' 쀢 y`ȉ B ?'yȀF ?0D'@'&y ظ  '$% ?ȅ)  P?䀢 Ixc@* @`$y% ȑȍB'`0-@ȍ…&' Z?ȉ"y #ā) 0 @6T?y ȑ DDB?ȅ'`0.Ȱ …&' 8?ȅƁ)} 0`@4?Ȑ* c@@ $y% B Ȁ@B'`0.Ȱ ?y D-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZXx#@, "P #    y`؅ Bȁ  1-@ Ȁ@ȍB'`0 H.Ȱ  ?ȉ"#B  ?ȅ$%H` 0?N 92?-@ . y ȉ By? D`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 4 y p L̀ 2'?@2 '   ''  *`p  "@ `  ` "```@h b耢`  ݒ  Ԕ 쀥L  Ɣ x  1Pɤ8 1-@`Ĥ``'܀'  Ը* @     Ԁ   ' 'Ԑ  `Ԣ 01G  %a` L` ̀ `9+ 4`f.& ``L`̀ `  4`2N.`"K.``:  9E. `9` 9., ;..@   # ` 0.@  ɒ 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ސ ܐڐ2. 0-@` .T"\2"4L4L4d44h4@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  +dd0H(#$OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $y$gy#        $((()(*(+ (,!(-"(.#(/"y yT" "` "`"EEEEEEEEEE.㿘` ` ` 2 @@ j "bx?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @ a` ``&@$`$`$@$`` "`*@@ `@"@$`$@.@` @ @@@<$@ 2` `` `,` $u` ` @ `@"@$`$@`" $&`b   `  ` @ j "@  `@ ` `@ @ @ K@@@$@ +0@ `,` 0   @ 1`@"@$`$@2`@Ɛ   `" $&` ` ? @4` 㿘j P`2 @& 2   +?"  0` @@"& 0@u & 0 &   ?6 &  6   2 @   &  &   &  㿐  C & & (&@&@    C  & 6 & &"h"b& &  &@ xV  2  6 8T  &&@ `  &<  ؐ`?`&$&@( "&@$ L ( (#@"$㿀. * "* @Đ  * ?  ? # g 0 0? P? ?    ( 0 8 @ H?88888 8(80888@8H8PX㿘j P`z@Qz!h   R X 2 &  ?2 2 """""""0"4"D"H㿘@zh " `h  ` "@` 2`} $㿘@Ɛ!Hhj """`P㿘T @j  P > B< P ?Đ*@4 㿘 ! V  @6  ?Ē* 6 V @R㿘T   @#?  2  ?Đ*@4   4 < P㿘@V $ "b@㿐 @ f  ??#\  ǔ@   @ V $ "b@$ "b@㿘 2 @7!H   j@  "bx?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘z!h ? T` "??`X2$OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $㿘@ x? `}' *` € G  @耢 ~?|z d W  7  @耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @R ? ܀ ?j "bx ? ܖؘ @> ??܁RRSSS$S S\ShSSSSSSSSSTTTT(T4T@TLTXSDSPStSTd$„ "b@/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin㿘 @lU  Nj`2Jj   < ; <"a@f <9    1 ",  ?`##T*` €#?###    (",&  &j "bx?VVVVVWW W0WW W W W W W W W W(W0$ʄ "b@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @* error: x0 >"*` €#<* <%#<#<2 8%#<h5""h 1"bh.""h *"bh'""h #"bh ""h "bh""h "bh""h "b %  %!h"#$"$"L   h "b#\   @y?h?"bl @ c 2 "`?h#<"bd(h""p &"` %#<#< *` @z%#<h"b&bx]]]]]]0]]]]]]]L]]]]]]]]]]h]]]]]]]]]]]]]]]$]]]]]]]@]]x]]]]]]]]\]]]]]]]]̝㿘#h?bt   * `""` "@""" 6  4 hbd" h* "l   "@  "l"  `h"`. @ƒ Ѐ` hb "b@㿘? (    )h?:   :  "l,    2 2 *   *,`  @    6 6   : 6 * 2 2@6 6 & @ 6 @@M 2@*6 6 6 6 &  4 `   ?2 * #@ `" 6   2*  (   # h`  +@ 2*` +@*#  $@ ?6 6 `hbd "l * "@"l&""l7 "l `  "   `* @ " *` 6 "l"@&hb#: *   ,    @ allocation failed. 㿘h"``h"`@  h"` 2h h"` @ malloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. 㿘h"`@h"``2ha!"d4` "@ Y!h"h R!h"l*  ?@E"`@ !`@  h"`8@6?@20D )  * ?@#"0?,@2 2 *`  2"P hb* 2 @2 @ 0"hp 0   ` @0@z@page is already free. freelist is destroyed. 㿘 h"``hB!0"`h"d6 "@ 4!0h"h ,!0h"l*  @0  *@ ?. 2 "00t2 *  2@  ` "P0eh"` , @ Е,@  *@$@    `4  "l* @"l 2  @"@ "@   :@ @" @ "@  * @$'"@$@@@2@"@  bd2 " "l* " `2  @P  VT in malloc():recursive call. out of memory. 㿘!h" ch"  $"#" ?$","hb?$" K# in free():㿘!h" `Xh" $"Z#" "?$" in realloc():㿘h h"b  "<#" ?$"  O"hb?$" #㿘  0Ȁ"h0? "0hl.` " `l* @ #h3h`   bl" bl@  h"`+  @nh"`@ b  $bb" " " bt`bt" "A&bt ` :`@ 2@`@ b"`" &` "@0$b` @`&` @`%&``2"@  &` &` &@" 2@`&`&`  b" "&@$bd @ 0#z`c<@)!h` "@%@ "@c<`&`@&` @ ` h"d2 "@ h$" #bhhl+ " bh  l$OpenBSD: abort.c,v 1.7 2001/08/12 12:03:01 heko Exp $㿐?ߒ'  @ zD  h"` @"D@A@G  @L  @ @6@< @ $OpenBSD: exit.c,v 1.4 2000/01/06 08:45:50 d Exp $㿘j"l`h`?, @`, @?, @`2`h" @$ $ "b@$% "b@x  ??''쀢' j"bx ?j" *@ @  '@؀ ?؁$. "b@$OpenBSD: sigprocmask.S,v 1.3 1999/01/22 06:07:56 marc Exp $@2@  0 "b@2"$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $zc@4   :z"b@ c$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $z   : "b@"$OpenBSD: getenv.c,v 1.4 1998/07/16 18:02:33 deraadt Exp $ 4jp / "p#8*"@ J=2"p"  J JJ 2 J=ې    㿐ƒ$ "b@$K "b@$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*$OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $(㿈'XX#d#h#\#` @ Ł$Ƅ "b@$J "b@$I "b@$: "b@$OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " $y "b@$ "b@h @   @8@ @   㿘 `@$6 "b@$OpenBSD: memchr.c,v 1.4 2001/09/07 08:09:31 espie Exp $"  `  ?2  㿐@H 'T{ @] T 31?T2 7耦(7耢 2: % 4`44`44`4`ؤ45 5 ȕ4'5 5  B'? 8' `@%`@`*  @@ `*  @@`*  @T  -`@T :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', @@ '@H. 2, @ ( ?#   ?#*`/@.  ?@+'$$66`% @"6``4@  * . ?  @26`@4@Ā2T`#@  " . @?* :@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 8 2 + ( 2@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $OpenBSD: umul.S,v 1.2 1996/08/19 08:17:46 tholo Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  $OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@;`` (` `?#;```0  ?2 `2 #$OpenBSD: multibyte.c,v 1.3 2002/02/19 19:39:37 millert Exp $ "  J` ? `   ?J@"J@@  " *   J@"`   `(*`  $  "b@$OpenBSD: cerror.S,v 1.2 1996/08/19 08:18:02 tholo Exp $j bx??x@\ 7ޤޠ@+ ޠ@ ?  ޒ"@6 * 2     & , @ & $ ,  @ Y,  @ ?Ş V@:?`,Bἔ  W  7  "  "  0= 9 ; 07   5 ?   `( ?  *   2`*`2  (" ` ? ? @ @ ` '' '@'` ?:      "   @q @   * ޓ2   * "@ *h    6   "  "  0 @ e0 ޔ"6 *`3 ޒ*  F}$  ޔ"6 *`2 ހ`*  & &  $   ,  $ `[` @ݐ?`0Sހ ? * @      @` @ؐ$@$  ޔ"6 *6 ޓ*`@ &,$  ? * @      @` `?2 $@$  ޔ"6 *`6  * 2`&  $  `"@ 2 @Ӓ?@?X T ἀ?$ἠ  D  @0; 7  2? .㿐Y a  4`$@4``$`@$`` $` ```?2 @  &`4`7&&CIؠ 2 8  R` @`$` @ ``$ $ 4 4 $  L 2@K & Ԕ @Ɩؐ"3&&㿐    $@$@$`$ $ $`4 4`!ڒ4 4``  $ $` @&&㿘!ڐ?6`6`*  2 `@?2 @$$ `6`6`*` 2` @ ?2 @$ $ ` 6` `&` b  㿘!ڐ?* 6`6`2`&@ @ &.`  ' 6  ` " 6`6` * 2 &@@&.   `"`  @C?2`  ? ` ?" *2 @ 6`6`p&`   ? 6`&`    x`!ڐ?2 7'T*`* 2`'X2`     -'7  ''`'-`2 2` X6  "-  -0*  -0$2 @ @ `  2 @ @ ` `  ? `-2  @   2  @ @   ?G-`2 7   /`2   :/*`2 -2`@ $* "6 2  'ܐݔܒ`@*`2     -`-2  `-` 2  @6    - @@-`-2 @ `22@:# # "2-`- <#T@"2@ *H`--@2 <``  "*  *0  *0@ @ `  @ @ `   ?*  @ @ @ ` -`"2`64 T*` `-`2 -@6 6㿘 T     " ߔ  ?` (0 `*`0`@*`0  㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?  ,$ ! " "@!&& $! "㿘! ! ` "`      $`ʐ   ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` F 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?       21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   ɬ 2?`"  "     " "!2  @"``"` *` @`"!"`!"@! ` $OpenBSD: crt0.c,v 1.4 2002/02/16 21:27:20 millert Exp $0.8.@.(U. ZH.q.h..Đ-x- - - --x-0-T-z -z -߸-߸--x-p-h-X-P0-H0-@`-0`-(+- ~p--0,,,а,lp,H,H,H, 9, 9, 9, D, D, 8, 'x,x 'x,p x,h ,` ,X p,P ,H ,@ ,8 ,0 p,( , Ǩ, h**$OpenBSD: args.c,v 1.12 2002/02/16 21:27:06 millert Exp $$OpenBSD: conv.c,v 1.8 2001/08/07 14:39:27 hugh Exp $$OpenBSD: conv_tab.c,v 1.3 1996/06/23 14:19:46 deraadt Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.12 2002/02/16 21:27:06 millert Exp $$OpenBSD: misc.c,v 1.10 2001/08/07 14:39:27 hugh Exp $A.$OpenBSD: position.c,v 1.4 2001/08/07 14:39:27 hugh Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.12 2002/02/16 21:27:36 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.31 2002/02/16 21:27:06 millert Exp $@A0?PA>Bp>C=p<@$AA@Y@Y@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.26 2002/02/17 19:42:28 millert Exp $@rrrrprXr@r8r0r rrr qq@qqq qzz$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.3 2001/05/18 07:32:36 mickey Exp $$OpenBSD: cchar.c,v 1.8 1998/11/18 23:26:13 deraadt Exp $$OpenBSD: gfmt.c,v 1.4 1997/09/01 18:30:33 deraadt Exp $$OpenBSD: key.c,v 1.10 2002/02/16 21:27:08 millert Exp $`P<Xx t T0xPph` $OpenBSD: modes.c,v 1.5 1999/10/26 22:53:52 deraadt Exp $$OpenBSD: print.c,v 1.9 2002/02/16 21:27:08 millert Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.9 2001/09/06 13:29:08 mpech Exp $@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.7 2002/02/16 21:27:07 millert Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.73 2002/03/24 22:51:54 millert Exp $ɸɰɨɠɘʨʠʐʀxp`XPH@80( ɰɘʸʰ/tmp/EdDk.aXXXXXXXXXX@A$OpenBSD: dkcksum.c,v 1.3 2001/11/05 07:39:16 mpech Exp $$OpenBSD: editor.c,v 1.79 2002/02/16 21:27:33 millert Exp $             xp`XPH@80(   AA?DISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--nn] [--ccdd | --rr] [--tt] [--vv] _d_i_s_k ddiisskkllaabbeell --ww [--nn] [--ccdd | --rr] [--vv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --EE [--ff _t_e_m_p_f_i_l_e] [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] [--vv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] [--vv] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN The ddiisskkllaabbeell utility can be used to install, examine, or modify the la- bel on a disk drive or pack. The disk label contains information about disk characteristics (size, type, etc.) and the partition layout, stored on the disk itself. It is used by the operating system to optimize disk I/O and locate the filesystems resident on the disk. The options are as follows: --nn Make no permanent changes to the disklabel (useful for debugging purposes). --vv Print additional information during operation (verbose mode). --rr Causes the label to be read from or written to the disk directly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk without kernel support for a label, such as when labels are first in- stalled on a system. This flag does not work on a number of ar- chitectures, thus it is not considered the right way to put a new label on a disk. Its use is discouraged. --BB Install bootstrap code. The --rr flag is implied by --BB and never needs to be specified. --bb Specify the single level boot program, or the primary boot pro- gram, depending on the system boot architecture (single or two- level). --ss On machines with a two-level bootstrap (such as i386-based sys- tems), specify the secondary boot program. --dd Use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD parti- tions on the disk. Note that this option will only work for disks that are capable of reporting their geometry, such as SCSI, IDE, and ESDI. May not be used in conjunction with the --rr flag. --cc Clear the system's in-core copy of the label and update it based on the on-disk label. May not be used in conjunction with the --rr flag. --ff _t_e_m_p_f_i_l_e Write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The --ff flag is only valid when used in conjunction with the --EE flag. If _t_e_m_p_f_i_l_e already exists, it will be overwritten. --tt Format the label as a disktab(5) entry. --ww Write a standard label on the designated drive. --ee Edit an existing disk label using the editor specified in the EDITOR environment variable, or vi(1) if none is specified. --EE Use a simple initial label editor, using the command-driven built-in editor described below. --RR Restore a disk label that was formatted in a prior operation and saved in an ASCII file. --NN Disallow writing of the pack label area on the selected disk. --WW Allow writing of the pack label area on the selected disk. The first form of the command (read) is used to examine the label on the named disk drive (e.g., sd0 or _/_d_e_v_/_r_s_d_0_c). It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is dis- played; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. The second form of the command (write) is used to write a standard label on the designated drive. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab en- tries describing each, or to edit the label after installation as de- scribed below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it contains blanks. If the --rr flag is given, the disk sectors containing the label and boot- strap will be written directly. A side-effect of this is that any exist- ing bootstrap code will be overwritten and the disk rendered unbootable. If --rr is not specified, the existing label will be updated via the in- core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In either case, the kernel's in-core label is replaced. In the third form of the command (edit), the label is read from the in- core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an editor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. The initial label editor mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are `b' for bytes, `c' for cylinders, `k' for kilobytes, `m' for megabytes, and `g' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Com- mands may be aborted by entering `^D' (Control-D). Entering `^D' at the main `>' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The edi- tor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sectors/cylin- der, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. d [part] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the `c' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). D Sets the disk label to the default values as reported by the kernel. This similates the case where there is no disk label. m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. X Toggle ``expert mode''. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). z Zeroes out the existing partition table, leaving only the ``c'' partition. The drive parameters are not changed. In the restore form of the command, the prototype file used to create the label should be in the same format as that produced when reading or edit- ing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. When installing bootstrap code with the --BB flag, if the names are not ex- plicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. Note that when a disk has no real BSD disklabel the kernel creates a de- fault label so that the disk can be used. This default label will in- clude other partitions found on the disk if they are supported on your architechture. For example, on systems that support fdisk(8) partitions the default label will also include DOS and Linux partitions. However, these entries are not dynamic, they are fixed at the time ddiisskkllaabbeell is run. That means that subsequent changes that affect non-OpenBSD parti- tions will not be present in the default label, though you may update them by hand. To see the default label, run ddiisskkllaabbeell with the --dd flag. You can then run ddiisskkllaabbeell with the --ee flag and paste any entries you want from the default label into the real one. EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x SSEEEE AALLSSOO disklabel(5), disktab(5), scan_ffs(5) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. On some machines, such as the sparc and amiga, partition tables may not exhibit the full functionality that is described above. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 3.1 October 27, 1997 5 $OpenBSD: ar_io.c,v 1.26 2002/02/19 19:39:35 millert Exp $$OpenBSD: ar_subs.c,v 1.18 2002/02/19 19:39:35 millert Exp $$OpenBSD: buf_subs.c,v 1.11 2002/02/19 19:39:35 millert Exp $ $OpenBSD: cache.c,v 1.10 2002/02/19 19:39:35 millert Exp $$OpenBSD: cpio.c,v 1.9 2002/02/19 19:39:35 millert Exp $$OpenBSD: file_subs.c,v 1.17 2002/02/19 19:39:35 millert Exp $$OpenBSD: ftree.c,v 1.18 2002/02/19 19:39:35 millert Exp $$OpenBSD: gen_subs.c,v 1.13 2002/02/19 19:39:35 millert Exp $$OpenBSD: getoldopt.c,v 1.4 2000/01/22 20:24:51 deraadt Exp $$OpenBSD: options.c,v 1.50 2002/02/19 19:39:35 millert Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZ.,8||L.LH||L.n, ||L-n, ,||L-(0PPx||H-(`Lx||L$OpenBSD: pat_rep.c,v 1.17 2002/02/19 19:39:35 millert Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.20 2002/02/19 19:39:35 millert Exp $$OpenBSD: sel_subs.c,v 1.10 2002/02/19 19:39:35 millert Exp $$OpenBSD: tables.c,v 1.15 2002/02/19 19:39:35 millert Exp $$OpenBSD: tar.c,v 1.25 2002/02/19 19:39:35 millert Exp $$OpenBSD: tty_subs.c,v 1.8 2002/02/19 19:39:35 millert Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.50 2002/02/17 02:04:38 deraadt Exp $8Y.? ;A??zG{A.@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.13 2002/03/14 21:17:50 millert Exp $@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.61 2002/04/10 18:52:27 millert Exp $7]\]]^]h]]]\]]]\]]]0^^H^($OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.17 2002/03/12 01:05:15 millert Exp $P.($OpenBSD: print.c,v 1.16 2002/02/16 21:27:07 millert Exp $$OpenBSD: util.c,v 1.7 2001/09/06 13:29:08 mpech Exp $z@<$OpenBSD: termcap.c,v 1.3 2001/07/16 06:14:31 pvalchev Exp $xpXP80,,,,-------- e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular file//a0b (BpchH dHefxXg8hHApPi0jkHlHmn"pX8o`(O@pHPqr!pHs!D0S!LtTT(u" pVw!@x$XAy`zH(?d| (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t5290@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ @(#)getmntopts.c 8.3 (Berkeley) 3/29/95$OpenBSD: grep.c,v 1.1 2001/09/21 23:12:00 deraadt Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: basename.c,v 1.4 2002/02/16 21:27:44 millert Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.13 2002/02/16 21:27:38 millert Exp $@(#) Copyright (c) 1983, 1990 The Regents of the University of California. All rights reserved. $OpenBSD: rsh.c,v 1.25 2002/02/19 19:39:39 millert Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.10 2002/02/16 21:27:35 millert Exp $@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.44 2002/02/16 21:27:37 millert Exp $0123456789abcdef>a````p`@`_____`_0_ pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRDoHzzzzzzzzz z z z z zzpzhz`zXzPzHz@z8z0z(zzzzyyyy y!y"y#y$y%y&y'y(yx)yp*y`+yX,yP-yH.y8/$OpenBSD: cmds.c,v 1.40 2002/01/04 16:18:59 art Exp $~~~~~~~~~~~( $OpenBSD: cmdtab.c,v 1.15 2001/10/04 22:49:55 pjanzen Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagertoggle passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress metertoggle interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose modeG@@׀>4??0X?HL?h0FLָ?ְ?֨?֠@l֘@֐@P ֈ@,ր@px@h@`AXFLPA0$H@0sh@FH8AP0AD(A Ac\B?h0B@DDҴB`0BBBBCCC@ոCpհCըDҴՠC`՘C`ՐC,ՈDՀD0xD`Pp@0shhDҴ`DPE@EX8Ex0Et(Gp EFLF((FHFXFFMF FGG(GHɠGp԰D`ԨGԠH ԘH ԐH8ԈHX`ԀHxHpHhHh`HHXIPI(HAc\S$OpenBSD: domacro.c,v 1.7 1997/07/25 21:56:19 millert Exp $$OpenBSD: fetch.c,v 1.38 2002/02/16 21:27:46 millert Exp $$OpenBSD: ftp.c,v 1.43 2002/02/19 19:39:38 millert Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.48 2001/06/23 22:48:45 millert Exp $$OpenBSD: ruserpass.c,v 1.13 2002/02/16 21:27:46 millert Exp $eeeeee e$OpenBSD: util.c,v 1.29 2002/03/30 17:45:44 deraadt Exp $ KMGTPA.A.>?P@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.12 2002/02/16 21:27:36 millert Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $QPhCopyright 1995, 1996, 1997, 1998, 1999 The Internet Software Consortium.All rights reserved.Internet Software Consortium DHCP ClientPlease contribute if you find this software useful.For info, please visit http://www.isc.org/dhcp-contrib.htmlPATH=/usr/bin:/usr/sbin:/bin:/sbin/sbin/dhclient-script( 0(EHC  3X3X3X3X3Xp3XX3XH3X83X(3X 3X 3X 3X 3X 3X3X3X3Xp3X`X3X8X3X( 3X3X3X3X3X3XX3Xp3XXX3XHX3X0X3X3X  3X!X3X"3X#X3X$3X%3X&xX3X'h3X(X3X)H3X*(3X+3X,3X-3X.3X/3X03X13X23X3h3X4P3X583X63X73X83X93X:3X;3X<3X=x3X>h3X?X3X@H3XA03XB 3XC3XD3XE3XF3XG3XH3XI3XJ3XKh3XLX3XMH3XN83XO(3XP3XQ3XR3XS3XT3XU3XV3XW3XX3XY3XZx3X[h3X\X3X]H3X^83X_(3X`3Xa3Xb3Xc3Xd3Xe3Xf3Xg3Xh3Xi3Xjx3Xkh3XlX3XmH3Xn83Xo(3Xp3Xq3Xr3Xs3Xt3Xu3Xv3Xw3Xx3Xy3Xzx3X{h3X|X3X}H3X~83X(3X3X3X3X3X3X3X3X3X3X3Xx3Xh3XX3XH3X83X(3X3X3X3X3X3X3X3X3X3X3Xx3Xh3XX3XH3X83X(3X3X3X3X3X3X3X3X3X3X3Xx3Xh3XX3XH3X83X(3X3X3X3X3X3X3X3X3X3X3Xx3Xh3XX3XH3X83X(3X3X3X3X3X3X3X3X3X3X3Xx3Xh3XX3XH3X83X(3X3X3X3X3X3X3X3X3X3X3Xx3Xh3XX3XH3X83X(3X3X3X3X3X3X3X3X3X3X3Xx3Xh3XX3XH3X83X(3X3X3X3X3X3X3X3X3X3X3Xx3Xh3XX3XH3X803X249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~p`XH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(xhXH8(;Zx0N@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.23 2002/02/16 21:27:37 millert Exp $$OpenBSD: buf.c,v 1.12 2002/03/24 22:17:04 millert Exp $;x$OpenBSD: cbc.c,v 1.7 2002/01/16 18:44:21 mpech Exp $@ $OpenBSD: glbl.c,v 1.9 2002/03/24 22:17:04 millert Exp $$OpenBSD: io.c,v 1.10 2002/03/24 22:17:04 millert Exp $$OpenBSD: main.c,v 1.26 2002/03/24 22:17:04 millert Exp $H$OpenBSD: re.c,v 1.8 2001/01/16 03:04:46 deraadt Exp $$OpenBSD: sub.c,v 1.8 2002/03/24 22:17:04 millert Exp $$OpenBSD: undo.c,v 1.6 2002/03/24 22:17:04 millert Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.18 2002/02/16 21:27:06 millert Exp $ol$OpenBSD: utils.c,v 1.18 2001/11/05 07:39:16 mpech Exp $0X@8`08h0a ccddfhlLnNqqrStTvVx1p9hZ`bp@xPP(xXXPH@80xXX8X8888      ;Ew DJHwJx            #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.13 2002/02/16 21:27:06 millert Exp $$OpenBSD: dir.c,v 1.11 2002/02/16 21:27:34 millert Exp $ E ... ...$OpenBSD: inode.c,v 1.19 2002/02/16 21:27:34 millert Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.20 2002/02/16 21:27:34 millert Exp $$OpenBSD: pass1.c,v 1.11 2002/02/16 21:27:34 millert Exp $$OpenBSD: pass1b.c,v 1.6 2002/02/16 21:27:34 millert Exp $$OpenBSD: pass2.c,v 1.12 2002/02/16 21:27:34 millert Exp $$OpenBSD: pass3.c,v 1.6 2001/11/05 07:39:16 mpech Exp $$OpenBSD: pass4.c,v 1.5 2001/11/05 07:39:16 mpech Exp $$OpenBSD: pass5.c,v 1.14 2001/12/01 19:04:41 deraadt Exp $$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.15 2002/02/16 21:27:34 millert Exp $ ˸ ˰ ˨ ˠ ˘ ː ˈ ˀ x p h ` X h ` P @ 8 0    p X ̘ ̘ ̘ ̘ ̘ ̘ ̘ ̐ ̈ ̀ ̘ ̘ x ̘ p ̘ ̘ ̘ ̘$OpenBSD: utilities.c,v 1.15 2002/02/23 21:23:46 deraadt Exp $ ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.25 2002/02/19 19:39:38 millert Exp $  $OpenBSD: dkcksum.c,v 1.3 2001/11/05 07:39:16 mpech Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.32 2002/02/19 19:39:38 millert Exp $ ) )x )p )h )` )P )H )@ )8 )0 )( ) )@ )@@ @%s: can't read disk label; disk type must be specified F F Fp F` F@ F0 F E E E E Ep EP E0 E D D D Dp DX D8 D D C C$OpenBSD: mkfs.c,v 1.20 2001/11/05 07:39:17 mpech Exp $>......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.12 2002/02/16 21:27:07 millert Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.20 2002/02/16 21:27:07 millert Exp $       x  p h ` X P H 8 0 X @ 0@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.12 2002/02/16 21:27:07 millert Exp $ {}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. ( p ܈ / PIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSION Xlet||&&!()]]<>       x p h P H 8 0 (              x p ` X H @ (              p h P H (            h ` P@(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.12 2002/02/16 21:27:07 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.23 2002/02/16 21:27:07 millert Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: dmesg.c,v 1.15 2002/02/16 21:27:33 millert Exp $ @(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.5 2002/02/16 21:27:07 millert Exp $  ΐ Έ ΀ x p h ` X P H @ 8 0 ( 0 (   ΐ θ ΰ Ψ Π Θ 8 ` ` ` ` ` ` ` X P H ` ` @ ` 8 ` ` Θ ` ` ($NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $ ؐ$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+$OpenBSD: read_bsd_terminfo.c,v 1.10 2002/02/16 21:27:26 millert Exp $2H  @%&*!# =A@A$OpenBSD: confstr.c,v 1.4 2001/06/27 00:58:54 lebel Exp $$OpenBSD: cfsetispeed.c,v 1.2 1996/08/19 08:34:36 tholo Exp $$OpenBSD: fscanf.c,v 1.5 2002/02/19 19:39:36 millert Exp $$OpenBSD: fstab.c,v 1.10 2002/02/16 21:27:22 millert Exp $$OpenBSD: ipx_addr.c,v 1.5 2001/06/27 00:58:55 lebel Exp $$OpenBSD: _vwarnx.c,v 1.3 1996/08/19 08:21:35 tholo Exp $$OpenBSD: fwrite.c,v 1.2 1996/08/19 08:32:50 tholo Exp $ 4(h$OpenBSD: cfgetospeed.c,v 1.2 1996/08/19 08:34:35 tholo Exp $$OpenBSD: nice.c,v 1.3 1998/05/06 23:11:43 deraadt Exp $$OpenBSD: linkaddr.c,v 1.2 1996/08/19 08:29:27 tholo Exp $0123456789abcdef$OpenBSD: getprotoname.c,v 1.3 1997/07/09 01:08:32 millert Exp $$OpenBSD: vis.c,v 1.8 2002/02/19 19:39:36 millert Exp $$OpenBSD: _warn.c,v 1.3 1996/08/19 08:21:36 tholo Exp $H$OpenBSD: sethostname.c,v 1.5 2002/02/19 19:39:36 millert Exp $$OpenBSD: readpassphrase.c,v 1.12 2001/12/15 05:41:00 millert Exp $$OpenBSD: tcsetattr.c,v 1.2 1996/08/19 08:34:42 tholo Exp $$OpenBSD: basename.c,v 1.6 2001/06/28 04:27:19 pjanzen Exp $ŀ$OpenBSD: setjmperr.c,v 1.2 1996/08/19 08:25:52 tholo Exp $$OpenBSD: getnetnamadr.c,v 1.15 2002/02/16 21:27:23 millert Exp $$OpenBSD: getnetbyaddr.c,v 1.5 1997/07/09 01:08:28 millert Exp $$OpenBSD: getnetbyname.c,v 1.5 1997/07/09 01:08:29 millert Exp $$OpenBSD: getnetent.c,v 1.8 1998/03/16 05:06:57 millert Exp $$OpenBSD: inet_network.c,v 1.7 1997/07/09 01:08:37 millert Exp $$OpenBSD: alarm.c,v 1.3 1996/09/15 09:30:54 tholo Exp $$OpenBSD: inet_makeaddr.c,v 1.3 1997/04/05 21:13:12 millert Exp $$OpenBSD: getmntinfo.c,v 1.4 1999/06/01 15:31:13 millert Exp $$OpenBSD: strtofflags.c,v 1.1 2000/07/19 19:26:04 mickey Exp $$OpenBSD: iso_addr.c,v 1.2 1996/08/19 08:29:23 tholo Exp $0123456789abcdef($OpenBSD: cfgetispeed.c,v 1.2 1996/08/19 08:34:34 tholo Exp $h8$OpenBSD: times.c,v 1.2 1996/08/19 08:26:43 tholo Exp $$OpenBSD: morecrypt.c,v 1.9 1998/03/22 19:01:20 niklas Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ h$OpenBSD: getservbyport.c,v 1.3 1997/07/09 01:08:35 millert Exp $p$OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $p$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $@$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $$OpenBSD: getlogin.c,v 1.7 2002/02/16 21:27:22 millert Exp $$OpenBSD: puts.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: regerror.c,v 1.7 2002/02/16 21:27:24 millert Exp $""""x"h"H"8" "!!!!!!!h !X!@ !0! !       h X 0 $8%$OpenBSD: _warnx.c,v 1.3 1996/08/19 08:21:38 tholo Exp $*8$OpenBSD: getcwd.c,v 1.6 2000/07/19 15:25:13 deraadt Exp $$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.5 2002/02/16 21:27:24 millert Exp $$OpenBSD: fts.c,v 1.30 2002/02/16 21:27:22 millert Exp $$OpenBSD: vprintf.c,v 1.3 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $z$OpenBSD: tcsetpgrp.c,v 1.4 2002/02/19 19:39:37 millert Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: fputc.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: _errx.c,v 1.4 1996/08/19 08:21:21 tholo Exp $$OpenBSD: errx.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: regcomp.c,v 1.8 2002/02/16 21:27:24 millert Exp $h( ~ ~~ ~~ ~~ ~~  ~} }} }}` }X}P }H}( } }  ph ` X P H 8 0    xph`X}X @!0" #$%&'()*+,-p-h.X.P/H/@08102(3 456789:;<=>?@p[`\P\8](^^__`{{|}}x~p$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $$OpenBSD: ns_ntoa.c,v 1.8 2002/02/16 21:27:23 millert Exp $$OpenBSD: ipx_ntoa.c,v 1.2 1996/08/19 08:29:20 tholo Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: glob.c,v 1.18 2002/02/17 19:42:22 millert Exp $8$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.3 1998/08/20 19:45:57 deraadt Exp $$OpenBSD: ns_addr.c,v 1.7 2002/02/16 21:27:23 millert Exp $$OpenBSD: sscanf.c,v 1.5 2002/02/19 19:39:37 millert Exp $$OpenBSD: vfscanf.c,v 1.8 2002/02/19 19:39:37 millert Exp $  $OpenBSD: fread.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: strtoq.c,v 1.4 1996/08/19 08:33:52 tholo Exp $$OpenBSD: strtouq.c,v 1.4 1996/08/19 08:33:53 tholo Exp $$OpenBSD: ungetc.c,v 1.4 2002/02/16 21:27:24 millert Exp $$OpenBSD: disklabel.c,v 1.6 2002/02/16 21:27:22 millert Exp $xph`XPH@80( ( 0XXXXXXXPH@XX8X0XXXX$OpenBSD: getcap.c,v 1.20 2002/02/16 21:27:22 millert Exp $?9gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA,   $OpenBSD: popen.c,v 1.12 2002/01/16 01:28:54 millert Exp $$OpenBSD: exec.c,v 1.12 2002/02/19 19:39:36 millert Exp $$OpenBSD: waitpid.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: printf.c,v 1.4 2002/02/19 19:39:37 millert Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: setlocale.c,v 1.8 2002/02/16 21:27:23 millert Exp $xhXP@CCCCCCC$OpenBSD: gethostnamadr.c,v 1.45 2002/02/17 19:42:23 millert Exp $gethostby*.getanswer: asked for "%s", got "%s"9p$OpenBSD: ftell.c,v 1.3 2000/02/21 22:11:22 millert Exp $;;`<$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $$OpenBSD: setmode.c,v 1.11 2002/02/19 19:39:36 millert Exp $$OpenBSD: _err.c,v 1.4 1996/08/19 08:21:19 tholo Exp $$OpenBSD: verrx.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: getttyent.c,v 1.5 2002/02/16 21:27:22 millert Exp $O($OpenBSD: ttyname.c,v 1.8 2002/02/16 21:27:23 millert Exp $$OpenBSD: getbsize.c,v 1.7 2001/08/18 22:56:22 deraadt Exp $$OpenBSD: nlist.c,v 1.41 2002/02/16 21:27:23 millert Exp $UX_H$OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $$OpenBSD: pwcache.c,v 1.5 2001/06/27 00:58:54 lebel Exp $$OpenBSD: getgrent.c,v 1.15 2002/02/16 21:27:22 millert Exp $$OpenBSD: getpwent.c,v 1.24 2002/02/19 19:39:36 millert Exp $*netgroup: %m$OpenBSD: err.c,v 1.5 2002/02/19 19:39:36 millert Exp $$OpenBSD: verr.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: warn.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: vwarn.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: warnx.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: vwarnx.c,v 1.3 2002/02/19 19:39:36 millert Exp $$OpenBSD: getproto.c,v 1.3 1997/07/09 01:08:31 millert Exp $$OpenBSD: getprotoent.c,v 1.4 1999/09/03 16:23:18 millert Exp $$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $ $OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $pLl\gethostby*.getanswer: asked for "%s", got "%s"$OpenBSD: res_query.c,v 1.17 2002/02/16 21:27:23 millert Exp $$OpenBSD: res_mkquery.c,v 1.10 2001/07/31 22:02:18 jakob Exp $$OpenBSD: res_send.c,v 1.11 2002/02/16 21:27:23 millert Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: setvbuf.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: res_debug.c,v 1.11 2001/06/11 10:05:59 itojun Exp $ d'B@;8xABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/$OpenBSD: res_comp.c,v 1.10 2002/02/19 19:39:36 millert Exp $$OpenBSD: tolower_.c,v 1.3 2001/06/27 07:17:08 pjanzen Exp $H$OpenBSD: wbuf.c,v 1.5 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $LLLLLLLxLpLhL`LXLHL@L0L LM(M MMLLLxLpLhLLLLLLL$OpenBSD: fputs.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: toupper_.c,v 1.3 2001/06/27 07:17:09 pjanzen Exp $O$OpenBSD: inet_ntoa.c,v 1.2 1996/08/19 08:29:16 tholo Exp $$OpenBSD: inet_ntop.c,v 1.2 2002/02/16 21:27:23 millert Exp $%u.%u.%u.%u$OpenBSD: res_init.c,v 1.25 2002/02/16 21:27:23 millert Exp $/&f $OpenBSD: gethostname.c,v 1.3 1998/05/13 08:50:58 deraadt Exp $$OpenBSD: inet_addr.c,v 1.6 1999/05/03 22:31:14 yanick Exp $$OpenBSD: inet_pton.c,v 1.4 2002/02/16 21:27:23 millert Exp $01234567890123456789abcdef0123456789ABCDEFmn  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~op8$OpenBSD: getdomainname.c,v 1.3 1998/05/13 08:50:55 deraadt Exp $$OpenBSD: fgets.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: getservbyname.c,v 1.5 2000/01/06 08:24:17 d Exp $$OpenBSD: getservent.c,v 1.5 1999/09/03 16:23:19 millert Exp $vP$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.4 2002/02/16 21:27:24 millert Exp $~P~$OpenBSD: syslog.c,v 1.16 2002/02/19 19:39:36 millert Exp $$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $@(#)strftime.c 7.64@(#)localtime.c 7.75$OpenBSD: localtime.c,v 1.21 2002/04/04 19:12:09 millert Exp $WILDABBRGMThh@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $Lj$OpenBSD: sprintf.c,v 1.5 2002/02/19 19:39:37 millert Exp $$OpenBSD: vsnprintf.c,v 1.5 1998/07/27 02:28:28 millert Exp $p 0Xx $0dDx X x @<  P$OpenBSD: perror.c,v 1.4 2002/02/16 21:27:24 millert Exp $H$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catopen.c,v 1.10 2002/02/16 21:27:23 millert Exp $ 8 Pp(x$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $8( `%$OpenBSD: opendir.c,v 1.6 1998/08/15 08:10:14 deraadt Exp $$OpenBSD: scandir.c,v 1.5 2002/02/16 21:27:23 millert Exp $$OpenBSD: closedir.c,v 1.3 1998/11/20 11:18:37 d Exp $$OpenBSD: seekdir.c,v 1.4 2002/02/16 21:27:23 millert Exp $$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.5 2001/05/17 20:20:36 rees Exp $/9@$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $:XCH$OpenBSD: db.c,v 1.5 2002/02/25 23:45:15 millert Exp $$OpenBSD: rec_open.c,v 1.7 2002/01/31 17:19:11 millert Exp $$OpenBSD: bt_open.c,v 1.9 2002/02/25 23:45:14 millert Exp $$OpenBSD: bt_get.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_conv.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_put.c,v 1.7 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_delete.c,v 1.6 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_seq.c,v 1.6 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_search.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_utils.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_close.c,v 1.7 2002/02/25 23:45:15 millert Exp $$OpenBSD: bt_close.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: ftruncate.c,v 1.7 1998/11/20 11:18:52 d Exp $$OpenBSD: rec_get.c,v 1.6 2000/11/21 02:11:02 deraadt Exp $$OpenBSD: rec_put.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_delete.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: rget.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: refill.c,v 1.5 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: rec_seq.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: bt_overflow.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_page.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_search.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: mpool.c,v 1.10 2002/02/25 23:45:15 millert Exp $$OpenBSD: fprintf.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $$OpenBSD: hash.c,v 1.14 2002/03/25 19:08:48 millert Exp $$OpenBSD: hash_func.c,v 1.6 2002/02/16 21:27:22 millert Exp $ $OpenBSD: hash_page.c,v 1.12 2002/02/25 23:45:15 millert Exp $$OpenBSD: ashldi3.c,v 1.2 1996/08/19 08:30:16 tholo Exp $$OpenBSD: hash_bigkey.c,v 1.10 2002/02/25 23:45:15 millert Exp $ݐ$OpenBSD: hash_log2.c,v 1.4 1999/02/15 05:11:24 millert Exp $$OpenBSD: mktemp.c,v 1.15 2002/02/16 21:27:24 millert Exp $$OpenBSD: pread.c,v 1.2 2001/05/05 22:58:29 millert Exp $$OpenBSD: pwrite.c,v 1.2 2001/05/05 22:58:30 millert Exp $$OpenBSD: snprintf.c,v 1.7 2002/02/19 19:39:37 millert Exp $8 0000000000000000}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5A??҇coCa?Ɗ(`ȳ?DPy?@$@@?$OpenBSD: flt_rounds.c,v 1.3 1997/08/01 21:36:33 deraadt Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: ctype_.c,v 1.5 2001/01/06 20:34:48 naddy Exp $ ((((( AAAAAABBBBBB ((((( D$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $E$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $E$OpenBSD: fvwrite.c,v 1.11 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: wsetup.c,v 1.3 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: makebuf.c,v 1.3 1998/11/25 05:18:49 millert Exp $$OpenBSD: findfp.c,v 1.2 1996/08/19 08:32:36 tholo Exp $`PNOOLPNOOL PNOOLT`$OpenBSD: stdio.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: lseek.c,v 1.6 1998/11/20 11:18:53 d Exp $$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $$OpenBSD: fwalk.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $RP$OpenBSD: sysconf.c,v 1.4 1998/06/02 06:10:26 deraadt Exp $$OpenBSD: sysctl.c,v 1.4 2002/02/16 21:27:23 millert Exp $W$OpenBSD: malloc.c,v 1.47 2002/02/16 21:27:24 millert Exp $pq$OpenBSD: signal.c,v 1.4 1998/06/26 02:12:49 deraadt Exp $tv8w$OpenBSD: mmap.c,v 1.8 1998/01/02 05:32:50 deraadt Exp $$OpenBSD: isatty.c,v 1.3 1998/11/20 11:18:39 d Exp $$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $zH$OpenBSD: umoddi3.c,v 1.2 1996/08/19 08:30:48 tholo Exp $$OpenBSD: qdivrem.c,v 1.3 2002/02/16 21:27:23 millert Exp $$OpenBSD: isinf.c,v 1.4 2001/09/10 22:38:11 millert Exp $$OpenBSD: isnan.c,v 1.4 2001/09/10 22:38:11 millert Exp $$OpenBSD: bt_split.c,v 1.9 2002/02/25 23:45:14 millert Exp $$OpenBSD: hash_buf.c,v 1.10 2002/02/25 23:45:15 millert Exp $ ?/ i?/ / ?/ X @2 `. `(. @@@6` 3"` @ . `. @(@@ 2l```&@/6/ 6`` 8) &@" "@'@`'@"@"`"`"42 ` "`8) &@" "@'@`'@"@"`"`"4? &``6` 8) &@" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0 ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@&` & 0 #+3;CScspp !1Aa  0@` 'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#/ @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@?&@0 '48' - @ `  @ `.@(&@h H`@*@ @ h'H'0?'p  '(+ '$??Hh((+`', M+`$   % ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? '  .@+`@?2[  H+ ` 2?oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths tree㿀   ( ' #?#d#`#\#h   | ??*" ' *@ 2 (*"' ? ( $€oversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths㿀d !  ( `' R?((X#Ԛ#\#`#d#h! ?  ,??*#-$ +*'#))\#`#dP #\#h  ? 2 (??+  $ ?+ + @$ ? ( $€0 ( $€ --""-"@1"" w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-+" `Y G8+ @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` + @0(`88! 8$8%$8%8%8&X8-828284L84T848:8=(8=p8>,8>48>8 88 88 8 8X8 8l8 8888888   8@` 0123456789abcdef/8P?? inflate 1.1.4 Copyright 1995-2002 Mark Adler `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`8, 8@8W!84- 8 58u:8(C8r@I8I R8,[8 f86u8kXz8 8 8l8)8 8$ 8(8h8q@8n 8088+08+8? 88QB8K 8ʰX8n_8hj8nXr8|}8d8N08n88ST8J8 8:8Ot8z 8c 8ʴ!8+8 88B8=(M8r@T8c\8RXg 8ʸt828 88A|8n89 88+l8&888j8T&8'/8<86J 8xS88@a8=pk 8|v8P|8X8>48 8ˀ8:$84L88l8>8gx8F8D8" 8*8 9 8H8 T8Pc8Tl80v88%$ 8̀8%8\8D08888X8Tx 8̈8d8&X88-8, @8DU8kX[8! e8u8x88x088?0888u88 8 88 8H'8_x/8>,:8XD8-Q8`Y8+l8^t8  8L8_8h8( 8848 8P8S888T 828 ,8 &84T38(=8D8R 8XZ8aHa8th8Lr8R}8 8x88@88|8Y$888A8%8P 8h 8p" 8(8O/858 <8ThB8LH8^N8MDX8[_ 8f8Xm8 88,8^(88 8 8P88P858n8 88b 8@ 8 8z< $8 0 8D @ 8H F8$ Q8 a84 q 8 w 8 ~8 8 8 8 8 8 8 8 8 8 8 8 8 8 +8 78  C8  R8  d8 p8 z8 8 8 8 8 8Ɉ 8 8 8H 8@ 8Ɍ 8 8 %8 78 D8Ȁ U8 _8 n8 8 8' 8' 8,` 85 86 8? 8B 8F 8I 8Q 8RX 8S 8S 8T 8Tx 8T 8^( 8^ !8_x *8_ 28` :8aH A8b H8c Q8g W8kX ^8n h8nX q8n z8n 8n 8q@ 8r@ 8t 8u 8x0 8( 8 8 8 8 8X 8 _getsecs_rpc_fromaddr_open_dvma_mapin_gateip.rem_adler32.urem_sendudp_getprop_netif_put_nfs_getrootfh.div_devopen_socktodesc_obp_close_bp_getfile_inflate_codes_new_bp_server_addr_strtab_inflate_codes_free.umul.udiv_hostname_getchar_xdr_string_encode_inflate_trees_bits_nfs_readdir_in_cksum_pgofset_hostnamelen__udiv_arpwhohas_strcmp_net_close_inflate_trees_dynamic_inet_addr_strlen_inflate_set_dictionary_ether_sprintf_readudp_inflateSetDictionary_nfs_open_inet_ntoa_inflate_sprintf_netif_debug_freelist_netif_close_net_open_nfs_close__urem_printf_sendether_file_system_cd9660_close_inflate_trees_fixed_swapip_rpc_pmap_putcache___ashrdi3_nfs_readdata_domainname_xdr_string_decode_ufs_readdir_putchar_inflate_copyright_arp_reply_zcfree_strncpy_netdev_sock_nfs_lookupfh_rpc_xid_nfs_readlink_nfs_read_strtablen_ip_convertaddr_obp_strategy_nfs_seekstart_nfs_root_node_nfs_mount_cd9660_write_inflateSyncPoint_prom0_iclose_nfs_stat_twiddle_rarp_getipaddress_hz_getdevtype_rootip_net_mountroot_rpc_pmap_list_prom_ioctl_inflate_codes_zcalloc_rpc_port_obp_xmit_ufs_read_promvec_ufs_seek_obp_recv_strerror_prom0_close_file_system_nfs_inflate_flush_arp_num_closeall_bootfile_vprintf_ufs_stat_prom0_strategy_prom_getether_xdr_inaddr_decode_inflate_blocks_free__div_ufs_open_nfs_stat_types_inflateEnd_netmask_inflateReset__rtt_rpc_call_inflate_blocks_sync_point_file_system_ufs__rem_dvma_init_dvma_free_prom_boothow_prom_si_getpropstring_prom_bootdevice_memset_nfs_write_rootpath_cd9660_open_olseek_xdr_inaddr_encode_memcpy_get_crc_table_nameip_oclose_inflate_mask_bp_whoami_cputyp_cd9660_stat_pgshift_rpc_pmap_num_memcmp_prom0_iopen_inflate_fast_panic_cd9660_read_netif_open_prom_open_cd9660_seek_peekchar_etext_donottwiddle_ifname_oopen_bzero_getticks_readether_prom_init_inflateInit2__inflateSync_ndevs_loadfile_dvma_mapout_read_inflate_blocks_reset_arp_list_rpc_pmap_getcache_ufs_write_prom0_recv_errno_sockets_esym_intoa_nbpg_nfsys_exit_main_free_sendrecv_lseek_debug_close_inflate_blocks_new_domainnamelen_crc32_alloc_edata_cngetc_fbuf_end_dvma_alloc_bcea_gets___main_netif_get_version_oread_prom_bootfile_file_system_cd9660_inflateInit__prom0_xmit_bp_server_port_dbuf_ufs_close_inflate_blocks_cd9660_readdir_myip_files_devswsrt0.oboot.ogcc2_compiled.___gnu_compiled_cconf.ogcc2_compiled.___gnu_compiled_cdvma.ogcc2_compiled.___gnu_compiled_cnet.ogcVT220 in vt100 mode with DEC function key labeling:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:k5@:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :tc=vt220: vt220-nam|v200-nam|VT220 in vt100 mode with no auto margins:\ :am@:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt200-js|vt220-js|dec vt200 series with jump scroll:\ :am:\ :co#80:\ :al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:dc=\E[P:dl=\E[M:dm=:do=^J:ed=:\ :ei=\E[4l:ho=\E[H:im=\E[4h:\ :is=\E[61"p\E[H\E[?3l\E[?4l\E[?1l\E[?5l\E[?6l\E[?7h\E[?8h\E[?25h\E>\E[m:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:kb=\177:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :nw=^M\ED:r1=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:rc=\E8:\ :rf=/usr/share/tabset/vt100:sc=\E7:se=5\E[27m:sf=\ED:\ :so=5\E[7m:sr=\EM:ta=^I:ue=\E[24m:up=\E[A:us=\E[4m: vt320nam|v320n|DEC VT320 in vt100 emul. mode with NO AUTO WRAP mode:\ :am@:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7l\E[?8h:tc=vt220: vt320|vt300|dec vt320 7 bit terminal:\ :am:es:hs:mi:ms:xn:\ :co#80:li#24:ws#80:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :K1=\EOw:K2=\EOu:K3=\EOy:K4=\EOq:K5=\EOs:LE=\E[%dD:\ :RI=\E[%dC:UP=\E[%dA:ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:\ :ce=\E[K:cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:\ :cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:ec=\E[%dX:\ :ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\EOB:ke=\E[?1l\E>:kh=\E[1~:kl=\EOD:kr=\EOC:\ :ks=\E[?1h\E=:ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m:\ :mr=\E[7m:nd=\E[C:nw=\EE:rc=\E8:\ :rs=\E>\E[?3l\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\E[H\E[K:ue=\E[m:up=\E[A:us=\E[4m:ve=\E[?25h:\ :vi=\E[?25l: vt320-nam|vt300-nam|dec vt320 7 bit terminal with no am to make SAS happy:\ :am@:\ :is=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3l\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w|vt300-w|dec vt320 wide 7 bit terminal:\ :co#132:ws#132:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[5?l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320: vt320-w-nam|vt300-w-nam|dec vt320 wide 7 bit terminal with no am:\ :am@:\ :is=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :rs=\E>\E[?3h\E[?4l\E[5?l\E[?7l\E[?8h\E[1;24r\E[24;1H:\ :tc=vt320-w: vt340|dec-vt340|vt330|dec-vt330|dec vt340 graphics terminal with 24 line page:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=\E[L:as=^N:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt300:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=200\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt400|vt400-24|dec-vt400|dec vt400 24x80 column autowrap:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:ae=^O:\ :al=\E[L:as=^N:cd=10\E[J:ce=4\E[K:cl=10\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:ic=\E[@:im=\E[4h:\ :is=\E<\E F\E>\E[?1h\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=\177:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E<\E[?3l\E[!p\E[?7h:rc=\E8:\ :rf=/usr/share/tabset/vt300:sc=\E7:se=\E[27m:sf=\ED:\ :so=\E[7m:sr=\EM:st=\EH:ta=^I:ts=\E[2$~\E[1$}\E[1;%dH:\ :ue=\E[24m:up=\E[A:us=\E[4m:vb=200\E[?5h\E[?5l:\ :ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt420|DEC VT420:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:ke=\E>:kl=\E[D:kr=\E[C:ks=\E=:ku=\E[A:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt420pc|DEC VT420 w/PC keyboard:\ :@7=\E[4~:F1=\E[23~:F2=\E[24~:F3=\E[11;2~:F4=\E[12;2~:\ :F5=\E[13;2~:F6=\E[14;2~:F7=\E[15;2~:F8=\E[17;2~:\ :F9=\E[18;2~:FA=\E[19;2~:FB=\E[20;2~:FC=\E[21;2~:\ :FD=\E[23;2~:FE=\E[24;2~:FF=\E[23~:FG=\E[24~:FH=\E[25~:\ :FI=\E[26~:FJ=\E[28~:FK=\E[29~:FL=\E[31~:FM=\E[32~:\ :FN=\E[33~:FO=\E[34~:FP=\E[35~:FQ=\E[36~:FR=\E[23;2~:\ :FS=\E[24;2~:FT=\E[25;2~:FU=\E[26;2~:FV=\E[28;2~:\ :FW=\E[29;2~:FX=\E[31;2~:FY=\E[32;2~:FZ=\E[33;2~:\ :Fa=\E[34;2~:Fb=\E[35;2~:Fc=\E[36;2~:\ :S6=USR_TERM\:vt420pcdos\::k1=\E[11~:k2=\E[12~:\ :k3=\E[13~:k4=\E[14~:k5=\E[15~:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:k;=\E[21~:kD=\177:kh=\E[H:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :tc=vt420: vt420pcdos|DEC VT420 w/PC for DOS Merge:\ :li#25:\ :S1=%?%p1%{19}%=%t\E\023\021%e%p1%{32}%<%t\E%p1%c%e%p1%{127}%=%t\E\177%e%p1%c%;:\ :S4=\E[?1;2r\E[34h:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:S6@:\ :me=\E[m:sa@:tc=vt420pc: vt420f|DEC VT420 with VT kbd; VT400 mode; F1-F5 used as Fkeys:\ :F1=\E[23~:F2=\E[24~:F3=\E[25~:F4=\E[26~:F5=\E[28~:\ :F6=\E[29~:F7=\E[31~:F8=\E[32~:F9=\E[33~:FA=\E[34~:\ :k1=\E[11~:k2=\E[12~:k3=\E[13~:k4=\E[14~:k5=\E[15~:\ :k6=\E[17~:k7=\E[18~:k8=\E[19~:k9=\E[20~:k;=\E[21~:\ :kD=\177:kh=\E[H:l1=\EOP:l2=\EOQ:l3=\EOR:l4=\EOS:tc=vt420: vt510|DEC VT510:\ :tc=vt420: vt510pc|DEC VT510 w/PC keyboard:\ :tc=vt420pc: vt510pcdos|DEC VT510 w/PC for DOS Merge:\ :tc=vt420pcdos: vt520|DEC VT520:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt525|DEC VT525:\ :am:mi:xn:xo:\ :co#80:li#24:vt#3:\ :*6=\E[4~:@0=\E[1~:RA=\E[?7l:\ :S5=\E[?0;0r\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :i2=\E[?67h\E[64;1"p:if=/usr/share/tabset/vt300:\ :im=\E[4h:is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:\ :k9=\E[21~:k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:\ :kb=\177:kd=\E[B:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:\ :..px=\EP1;1|%?%{16}%p1%>%t%{0}%e%{21}%p1%>%t%{1}%e%{25}%p1%>%t%{2}%e%{27}%p1%>%t%{3}%e%{30}%p1%>%t%{4}%e%{5}%;%p1%+%d/%p2%s\E\\:\ :r3=\E[?67h\E[64;1"p:rc=\E8:rf=/usr/share/tabset/vt300:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[m:sf=\ED:so=\E[7m:sr=\EM:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: sun-il|Sun Microsystems console with working insert-line:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:md@:me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:ue@:\ :up=\E[A:us@: sun-cgsix|sun-ss5|Sun SparcStation 5 console:\ :AL@:al@:tc=sun-il: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :tc=sun-il: sun-s|Sun Microsystems Workstation window with status line:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun: sun-e-s|sun-s-e|Sun Microsystems Workstation with status hacked for emacs:\ :hs:\ :ds=\E]l\E\\:fs=\E\\:ts=\E]l:tc=sun-e: sun-48|Sun 48-line window:\ :co#80:li#48:tc=sun: sun-34|Sun 34-line window:\ :co#80:li#34:tc=sun: sun-24|Sun 24-line window:\ :co#80:li#24:tc=sun: sun-17|Sun 17-line window:\ :co#80:li#17:tc=sun: sun-12|Sun 12-line window:\ :co#80:li#12:tc=sun: sun-1|Sun 1-line window for sysline:\ :es:hs:\ :co#80:li#1:\ :ds=^L:fs=\E[K:ts=^M:tc=sun: sun-e|sun-nic|sune|Sun Microsystems Workstation without insert character:\ :ei@:ic@:im@:tc=sun: sun-c|sun-cmd|Sun Microsystems Workstation console with scrollable history:\ :li#35:\ :te=\E[>4h:ti=\E[>4l:tc=sun: vt320-k3|MS-Kermit 3.00's vt320 emulation:\ :am:es:hs:km:mi:ms:xn:\ :co#80:it#8:li#49:pb#9600:vt#3:\ :AL=\E[%dL:CC=\E:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RI=\E[%dC:SR=\E[%dL:UP=\E[%dA:ae=\E(B:al=\E[L:\ :as=\E(0:bl=^G:cd=\E[J:ce=\E[K:cl=\E[H\E[J:cm=\E[%i%d;%dH:\ :cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:dl=\E[M:do=^J:\ :ds=\E[0$~:ec=\E[%dX:ei=\E[4l:fs=\E[0$}:ho=\E[H:im=\E[4h:\ :is=\E>\E F\E[?1l\E[?7h\E[r\E[2$~:k0=\E[21~:k1=\EOP:\ :k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:k8=\E[19~:\ :k9=\E[20~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=^H:kd=\EOB:\ :ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:ku=\EOA:le=^H:\ :mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M^J:rc=\E8:\ :sc=\E7:se=\E[27m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[1$}\r\E[K:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l\E[?5h\E[?5l\E[?5h\E[?5l:ve=\E[?25h:\ :vi=\E[?25l: vt320-k311|dec vt320 series as defined by kermit 3.11:\ :am:es:hs:mi:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :AL=\E[%dL:DC=\E[%dP:DL=\E[%dM:DO=\E[%dB:IC=\E[%d@:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:al=3\E[L:as=^N:bl=^G:cd=\E[J:ce=\E[K:cl=\E[;H\E[2J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:dc=\E[P:\ :dl=\E[M:do=^J:ds=\E[2$~\r\E[1$}\E[K\E[$}:ei=\E[4l:\ :fs=\E[$}:ho=\E[H:im=\E[4h:\ :is=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h\E[1;24r\E[24;1H:\ :k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:k6=\E[17~:k7=\E[18~:\ :k8=\E[19~:k9=\E[20~:kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:\ :kr=\EOC:ks=\E[?1h\E=:ku=\EOA:l1=pf1:l2=pf2:l3=pf3:l4=pf4:\ :le=^H:mb=\E[5m:md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nw=^M\ED:\ :r1=\E[?3l:rc=\E8:rf=/usr/share/tabset/vt100:sc=\E7:\ :se=\E[27m:sf=\ED:so=\E[7m:sr=\EM:st=\EH:ta=^I:\ :ts=\E[2$~\E[1$}\E[1;%dH:ue=\E[24m:up=\E[A:us=\E[4m:\ :vb=\E[?5h\E[?5l:ve=\E[?25h:vi=\E[?25l:vs=\E[?25h: vt50|dec vt50:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cr=^M:do=^J:le=^H:nd=\EC:\ :sf=^J:ta=^I:up=\EA: vt50h|dec vt50h:\ :bs:\ :co#80:li#12:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=^M:do=^J:\ :le=^H:nd=\EC:sf=^J:sr=\EI:ta=^I:up=\EA: vt61|vt-61|vt61.5|dec vt61:\ :co#80:li#24:\ :bl=^G:cd=\EJ:ce=\EK:cl=\EH\EJ:cm=\EY%+ %+ :cr=\r:do=^J:\ :kd=\EB:kl=\ED:kr=\EC:ku=\EA:le=^H:nd=\EC:sf=\n:sr=\EI:ta=^I:\ :up=\EA: 8, L** ?Г:`  L $ 8  '8H8@8 .' '$.' $ '  +/+$J  *>'$L ? 8, L** ?Г:`  L $ 8  '8H8@8 .'$.?&i?h$?Ѐ  , * $?РJ@`?Ѐ '$ $?&U?T?M  , * $?РJ?Ѐ '$ $2A'8 9'8H8@k2$/ - @$J l2( '$$ 8`@.@/@   ''8 @ `.@*  : `.@:  6q  -/+`k ? g   G  "  8`.@''ȴ?`".@''ȴ?@&L I"؁  -/+! @&K ! ,#`!#\7@ƚ0 g G00?@$ g g E e e f'0@' , @ ,`  O7 @  O7`  " O7 C  -@/+  8`.@ :`:  `.@ " @ 8`.@ 2`.@ "   '' 8 @ `.@  `.@  8`.@a '  q x8`.@!   @! "$/+@!   'x'|x 8 @ `.@  `.@ / !!  ''X'\X  8 @ `.@  `.@   2 /+ '?`S "  7F!ب  4`,  `4 0 , 806 03,  @!o `0, e  ` `0, , 4`  ` 4  ,'@  ' ? @/@ /+ ''O+ `' '`4O+" . 3Ib $$` '耢 ': ? b$$# $OpenBSD: disktab,v 1.19 2001/09/21 05:43:42 deraadt Exp $ # # @(#)disktab 5.5 (Berkeley) 2/27/91 # # Disk geometry and partition layout tables. # Key: # ty type of disk # ns #sectors/track # nt #tracks/cylinder # nc #cylinders/disk # rm rpm, 3600 default # se sector size, 512 default # sf supports bad144-style bad sector forwarding # so partition offsets in sectors # p[a-p] partition sizes in sectors # b[a-p] partition block sizes in bytes # f[a-p] partition fragment sizes in bytes # miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#96:\ :ts=3500:\ :pa#12288:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#12288:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#4:nc#544:\ :pa#4352:oa#0:ta=4.2BSD:ba#4352:fa#1024: \ :pc#4352:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: # test if not having an 'a' works? fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900'@'&J   '$% ?ȅ)  P?䀢 IIb* @`$J% ȑȍB'`0-@ȍ…&' Z?ȉ"J x#ā) 0 @6T?J ȑ DDB?ȅ'`0.Ȱ …&' 8?ȅƁ)} 0`@4?Ȑ* b@ $J% B Ȁ@B'`0.Ȱ ?J D-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZXI", "P #    J` Bȁ  1-@ Ȁ@ȍB'`0 H.Ȱ  ?ȉ"#B  ?ȅ$%H` 0?N 92?-@ . J BJ? HD`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 4 y p L̀ 2'?@2 '   ''  *`p  "@ `  ` "```@h b耢`  ݒ  Ԕ 쀥L  Ɣ x  1Pɤ8 1-@`Ĥ``'܀'  Ը* @     Ԁ   ' 'Ԑ  `Ԣ 01G  %a` L` ̀ `9+ 4`f.& ``L`̀ `  4`2N.`"K.``:  9E. `9` 9., ;..@   # ` 0.@  ɒ 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ސ ܐڐ2. 0-@` .T"\2"@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  +dd30စ(#$OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $Jt$TJ"Ć`       $((()(*(+ (,!(-"(.#(/"tJx J `"` "` "`"x` .㿘` ` ` 2 @@ V "b?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @ a` ``&@$`$`$@$`` "`*@@ `@"@$`$@.@` @ @@@<$@ 2` `` `,` $u` ` @ `@"@$`$@`" $&`b   `  ` @ j "@  `@ ` `@ @ @ K@@@$@ +0@ `,` 0   @ 1`@"@$`$@2`@Ɛ   `" $&` ` ? @4` 㿘V"4`2 @& 2   +?"  0` @@"& 0@u & 0 &   ?6 &  6   2 @   &  &   &  㿐  C & & (&@&@  5  C  & 6 & &#V"b & &  &@ xV  2  6 8T  &&@ `  &<  ؐ`?`&$&@( "&@$ L ( (6 Ѐ@"$㿀. * "* @Đ  * ?  ? # T##? P? ?    ( 0 8 @ H?88888 8(80888@8H8PX㿘V"4`K@QK!    R X 2 &  ?2 2 """""""0"4"D"H㿘@K  " `  ` "@` 2`} $㿘6@Ɛ"5VV "" "b4㿘T @j  P > B< P ?Đ*@4 㿘 ! V  @6  ?Ē* 6 V @R㿘T   @#?  2  ?Đ*@4   4 < P㿘@V $ Dć@㿐 @ f  ??#\  ǔ@   @ V $ Dć@$ Dć@㿘 2 6@7"   V@  "bܰ?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘K!  ? T` "??`X2$OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $㿘@ x? `}'7",*` € G  @耢 ~?|z d W  7  @耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @R ? ܀ ?V "b ? ܖؘ @> ??܁<P\Dܔܠ (<HT`lx݄ݐ|܈ܬܸݜ$„ Dć@/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin㿘 @lU  NV`2JV   < ; <"7b@f <9    1 ",  ?`#8 *` € ... . .. db( tmp ...N:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N Elite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163:  (z C}BP> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x 㿘@T@-!@ 3"@`L@ 3!313%3/+3)3-'3 5@a(@ $ aH@{"H@ M"H 2%aH@r @ L 2@b !h8@a@@gBad format %d+%d+[%d+%d]=0x%x boot: short read x@ ;%?@ ?# @!2?3܀a"0?@ ?# @!2?%܀a""?@ ?# @! 2?܀a "?@ ?# @ 2 ܀`@"0@"?@ ?# @!  a ܤ` ܐ@;܀?@@ ?# @! a "?@ a?# @!"  @ .@`@ 2.@"@@ k@@ 䀤 .@?`耣 C.@ .`".`.`@`@耢@F#2@ c|@ٔ  < c|.@ .` .` .`c|  ?`@Ĕ2'@"@m`? ? @3"@a"@,c 3 3! b1  Ā 0@K",? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1?@,#(1?dvma_mapout㿘 #@(1@#p1㿘@ " ْ㿘 @㿘1#` @- "`3 !h@/ # $#㿘1c耢 ? "c-@}`boot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s 㿐'-@j?73"Ȣ!' @@@ )32 @b0-!X12`#@ 23#!' @n@#'@  3 3!h 2 3!p㿘3p` 231"p#"`"`"`"` "`"`" @`  "ah? 3 h ?3p 㿘  ; < 㿘 - D@@H   @="&  ?  promprom0㿘,#`3@3`  $  32 `"H3""@JJ`  -2*@3"@@ (*`J@ @ *`  2`3"!HJ  *@J` )*@` 3`""@``*J@ -& @33 *:  c` d a !J@ s !J@  !$!#a @ #!J@  @Can't open device `%s' Can't open network device `%s' 㿘@ ,#`  @aܔP$` $`%33  `( $ 3aH€  !a\$` $`$@ H@Z!02H@ $`&` 2!22,c @ "P H@@!0",c @,cԐ @ - "` #-`  $$ 㿘#3``   ``*  ``   '@`2`0`,6 * '@ 㿘  ʒ& `& $& (   €͒ " '@ 㿘 ` @ 3  `( ( @0@ 㿘   2  @! $ ?2`$ *㿘3 ` `0`4 㿘3 ` `?`8 ? xmit: not a network device 㿘  ,`@|!?K@ S`?㿘 ,5`€>㿐3 `` (`P      O/O O /O㿘㿐3  `      O ? X/O O /O㿐3 /  0T@㿘  㿘3 `t€㿘@-@D㿐3`     X  p@%x mac-address drop swap 6 cmoveX,#` #32  ` 2   Њ@+`  "".@ .` .` .` .` .``` `€0 `@`|@ielefdxyxdstsddevice_typeblocknetworkbyte㿘3 ` !-`@@Xa@a ' b@  @b    H` HN@J@2J`N` " 2 node %x property %s length %d > %d 㿘3 ` € 0#@ 㿘2 @ޖ ??" ,Invalid controller number prom_iopen: "%s" error=%d 㿘)2! ?N  @ 3"aa$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` @ΐ#+  " * @F $`0 "$`4 " @D$` @ 2!&  %! @# 㿘#2a  @ 4 "$a & 4$aprom_mapin: length=%dprom_mapin: invalid maptype %d㿘,#*`@ -!@|! --         !@e` `,#@ ,#8 <?*   آ&@  ` ,#@㿘?(2,13\& H L` T ` X P d l$ p  t @2 .@2.1㿐``@ 0@ `@`@[ @ * @S   @@ x ` *  d,  0 2 0 0@" x @s*  @`?``"? 6"?%` 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @!0$@r     d ,  0 2 0 2 %@` ,`@L@Ԑ,`& 㿐   e<`P @@ܔ 4`0*:  8  2`0 @8e<`0e<eD `L  Ȁ)n 2; @`0$  " @   `d  *  0 @$ $  $&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @l  " *@B<@@` ڐ2 ``@Ӑ 㻀@@ Ц @ &`@9@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  '` L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@+ W(  2LL@@ $H  E;@%( 8@"@ 0 K䰒 *@`  d*  0` @O / ' 'ܒ L@  @   0@ @@ Ё㿘 &     . @ "  @0  .  "  @z0 @w@t а 㿐 @j@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d p k3"1a"'А $  $ $ ''X@ג 2W?-a0??"a04` $@!#`"#@ #\ @  !2 @Ő#<?#3"$bD@"$*`4bD' @2 6` @##?2'ܢ ܔ"""2b0@ ?3"2b@w  ?2@b ? ?  P2"2b0''@H 2C?@!@? 2:?-a02?"a06 $"&#`a#@b#\ @'   3 H"ah''@( 2?@J 2?#'@ ? ?㿘`&"@  &@  㿘`&@   ? & @ Ԕ.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` CD001㿐@ ( ( @V`  -``( (  !@ R     2` * @h * *` * +  *+`  h  @ (g 8@ @`-`  ` ΀ǰ    *` *   *  M `N JL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` * ƒ  @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐 R@ N`@4 @H``@C@2 *@ `  @ ,  ( )􀢨$ 2@` ' 8'" w@ '@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0 㿘c  ,  ". /.".+."&  "!".. 0  ? 0 @͠L *L0} 0z 0pؒ  @ S@ 8 'pt@ ( ,  $ #`a#\b` @' ? 3 H "ah؀`3@   "!h?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ $` 8 t@  $`   h #`ab`$#\ @ ? 3!h x 0  &,& &&& D& &(&$@ 㺈 ` ($a b ????#\#`  @ ? 3!h `  dh@ d .@  ?nfsread: short packet, %d < %ld 0  '  $  $  (  ,     $$L#`a $b (#\  @b ,? L `" H3"!h?@T@ B0  @ y3 H"ah?㿘@ -3 "ah!02"!06 & 2 ?  " $?!$ "  ?nfs_open: must mount first. 㷈2##` @ :" N  m `/2N N /" N a  0 ] @ x  <$N O  N  /  .ɔ A.0 0〢 2;@ @  $+  (@;@O`/  @ x@ x  @ x N  &`  @x x@s x㿘  "& @i x&  nfs_read: hit EOF unexpectantly㿘' #3!3%@ {   ݖ? ah2  !䀢 @ P  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0( 4 2`:2` <"` @"`D :`0 callrpc: error = %d 㿐\@?<6   '?'?@?2x '?` '?`@"x"?'?Đ #`#` #`#`#\ #`a $  p@X? 3` @``2"@#3 H"ah?recvrpc: reject, astat=%d, errno=%d 㿘!3$!h@ 2#x@ 2?`2 ?`` $!h H@’ ??"@?23P3( 2  2 2 *?3!P #!P!P3("#!P" " " getport: %s㾐a"@3 o'?(' "p #\#` ""   6   p'0 #3!ah@f!Ȓ@Q H$ah?bad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %d㿘`W1!(*` €10"1-"1*"1'#1$#1!#01#@1#X1#p1#1#1#1 #1  12!` @8D8D8E8E8D8D8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8E8D8E8E8E8E8E8E8E8E8D8E8E8E8D\8Dh8Dt8D8D8Drarp: bad socket. %d No response for RARP request Ӑ @B"J?  .@  7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 ``4 `4 #\ D .@q @"? 32b b2  b @ 0- ? @ -??"aȰ $`㿘- P@ 5㿐@3!"!h  5@2?@ 2?`(2?`&2?` 2 ? `@  ??sendudp: bad write (%d != %d)x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` -!؀    2`'" 'ܐ@_ܖ@( @?!@Qreadudp: huge packet, udp len %ld x@ް zހ( (  t?@͒o?2m?<@ 2f? 2b?6` <`\@u 2X? &T?``  2L?` &@  "@4  ` 2=?` 5` %@"0? ,  $ $ ' '`'''4 @8  ?$$ $ $ $ $$ $ $ $ ` ??sendrecv: short write! (%d < %d)㿘\   )3 <+`%!h(?@ @a @,`4 2 !h   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘2!,@  .  @ 0,@@ "@  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*`? @ . Ȓ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3`  +` ??㿘   @,   -aP@%  "` ?` ?72-8 :  0 *@ `  *@`*@`2*!耢" @ ` ?  2   㿘2b'H'L'P'T 'X @"b@H@ exit㿘 `㿘3"Р , @` @ , 㿘@@V㿘@~ 㿘 < " ? 2  @13 D&!h@[  $ !h `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘-!  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 81.1.4㿘@\?.`,@ P2". `"  P @ՐȐ?@/ 8 `@v &`D&@a&`@0 @`@ P@Ő?㿘 3 "ah?3"Г. @ 2. " @ D@y@v P@㿘2".  8?? ?2$  ?$8$ L "88 @P  "@"$ $$$$ @' 43!h`$<" $& @$$$<S < D!3$!h@ $!h $<D$@ #$8 H@є" $H H ?$88 @=$$  @ $H8 2  < 2  2L H@" $H&㾘 3 3"Г- @2@9"-  `L @?2+$`)'$`" ` 3f c3b @F ` 42$`@   @ ?L @`D P @Ȑ?@ 8$@$`D$`@.` 4@ 1@ /@ f )`' a !ڒ: @3  Yd 4 `0 Y"ah??- ? * `:```? -a "a"    -?"  耢@ @   @ *0   @ *`(㿘3. "Ѐ @  @  3 $"ah2  " @      @ $3"!h`3 "!h?㿘3. "Д@ @  3 "  3  Y :@B: Y"ah? ?   ` 㿐3"а @  `  ` 3 D"ah$@$`$` ' 83@`` / "`J -`)$@&$`  @  2" € ` `  `" ` @3"!h$@?㿐3. "Ѐ @@  3 ,"ah" @% * 2`      3 "ah B< ' 3 "ah&?2( 㿘!2#'L'P'T'X$"@L"*㿘'H'L'P'T'X#@ H㿘#@8N@`N@`%` N@`|`"*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls8d8eh8e8fl8fl8fl8fl8fl8fl8fl8d8fl8fl8e8f48fl8fl8ex8fl8f8fl8fl8fH0123456789abcdef㿈"@ǒ @,@  ?L?|/-\㿘-!` 2" cpJ@ #" arpwhohas: overflowed arp_list! arp: no response for %s-"X@ -!@  'h@@C`@ ` X  $X#ƒ  . 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hax4 j4 h!$@#\ .? h!'l#l ` `4` X4`  $X4`㿘-P2(㿐H3-"!h(2*?@ 2&?`(2"?`&2?`  @??-"X-*@ *`@ `V  ??㿘@ /`(+`&'` # `:   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿘 ?`2"`0"`"`   "` @ߔ 㿘 ? ` $ 2`0 " $@ $  (€ $ 㿘"M?N 12I?8 D?2 @? &  & & ( $ 2  & $   (  )& "  `"   "`  ( ?"  `   "( *@  "` ?㿘 unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check㿘 "@?  "<? 7` ?? ` .#*` € %  $ $  @  " `$  "b` 2    "b " `  $ $    $`*   &@ݒb`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" "b $ " @?   " F"" s @u `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  "b $  " " ??8{D8{8|`8|8}8}T8}8}8~T8~8~8H88ԝ㿘    "#? ? @s 0  ? & 06 * ?$@ @  "@ 㿘 A?`2@0;  "@"` 20?  -"`  @`#@  ?( "$$$ "` $$ "@?㿘 " ?   ?  @m㿘?6  ` W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@##񀦠,`     㿘" <&? 8`$`(€  2 ( @G (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeath 0 4@`  "? ,"` +$#*` €Ш?  *`` 4  `&  `-`0  `4 $@&إ4@ Ð@9耢 & & & @&``$  &`&@& 4?  &4!&!p&`4& & @&``$  &`&@& 4ڔ??  *`` ?#4* @! &!&`& & @&``$  &`&@& 4?`&  m p  `& & @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@E 0 4 "@ ,? ," ` 0 ( @ "?"`2 & & @&``$  &`&@& 4Y 8I "@`%%@ &     &?  *``  ?, & 4   ! !&!&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @  #?  *``   *@ *`"  & 2  4     #* *`"  &  &   $ @ ?2 & `(`$€  && & @&``$  &`&@& 4 &&  4   ! @  -!"ha @,  a?  *`@ ,   *`    $@ * "  & T4    @  E?  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4+?  ( ? + "@ &  4   ! @     $4  `#\#`&    !`''#d@Sܠ ?2& `$`(€ && & @&``$  &`&@& 4@؀ 2& & & @&``$  &`&@& 4Δ?`$`(€ && & @&``$  &`&@& 4@   @G 0 4@`  "? ,"   c&&& 4@X 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@8h88\8<8,88888P㿘* `( `$€ (`(`$€ $`(`$€㿘 (Ք (@& 0& 4`?㿘 (    * * " " "invalid literal/length codeinvalid distance code㿘 0 4 @`  "? ,"@` '!@*` €)` '& & @&``%@&@&`& 4 ` ``@0` 0 4@ `  "@? ,": $@ ` `$` $`$@` -`  *   -bh+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@%$@ &`& & @&``%  &`&@& 4?` -`b  *   -"h+`  ` ` `$`$ $` $`$@4 ` -`Q  *   -bh+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`%$@ 8&`& & @&``%  &`&@& 4O?` -`   *   -"h+`  `  $` $ $@4 `  (  ` ,"  *"$@27  ,  0 ( @ "?"2% & 4@C 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,  (`? $`$@2D `  ,  0 ( @ "?"22 ` & 4@ 0 4 "@ ,? ,"  0 ( @ "?"2 ` & & @&``%  &`&@& 4 (i$@ & 4?`?@ 4 0 0 4@& & @&``%  &`&@& 4r $@& & @&``%  &`&@& 4b & & @&``%  &`&@& 4T?& & @&``%  &`&@& 4F& & @&``%  &`&@& 48& & @&``%  &`&@& 4*& & @&``%  &`&@& 4& @&``%  &`&@& 4& & @&``%  &`&@& 4?@888p8888h888x8㿘`(`$€invalid distance codeinvalid literal/length code㿘04@`  , -h. ((```(@( @ @'"h` &@6 . &@`` 6@(``` (' @@"h` &@V6` (@ &@(`@ `. &@'.6, * @(!?/ (?/ y?/ /H D  D  D  D  0 4 0 0 0 l 0 ` 0  0 ˈ ˀsparcsparc ̰x ̼ 4 ̸ x Ӹ Ҙ \(ddpcc@bDDD մ \(ddpcc@bDDD ܰ ؤ ܨ\@0hDDDDDDh  ܰ ؤ_Xgg$ff4eDDgt  ܰ ؤ _0gg$ff4ei`Dgt  ؤ 0 ]X0DDDDDiDD P 4 ؤ d^xgg$ff4ei`h ( ؤ`0xgg$ff4ei`Dh  l ؤ ap0gg$ff4ei`Dgt  3 3 3 3` 3` 3` 3` 3D 3t 3( ߸3( ߠ3( ߈3( ߀3( p3 p3 P3 @3 03 (3 3 3 3          x p ` H (     ((DHD\ \XĘ0 @ (ޭޭ `  P  | X$lP @ TP `  #P(  *P( x *PP p #PP h *P( `    <D C C BP BX X Y W W X ^ ^ W W ^ q q p p p p p p p p px ph pX pH p0 p < 0 0 h ` P 8 ` `  `  ` x p ` H @ 0  `   ` ` ` x p X ` @ ` 0   ` ` ` ` ` x ` X x @ 8 ( ` X (      p ` ` h X  H 0 (  @ @ H 0 (  @ @ `  ` x p! h ` X h ` P @ 8 ` ( `   ` ( ` ( ` ` ` ` ` ` ` p ` X ` @ ` ( `  `  `A ` ` p ` X ` @ ` 0  `  `  `  `  `  `@  `@ h ` X P `H H @ `@ H 8 `@  0 (@  `   `  `  ` x h P `  8 `  `  `    x ` h P ` h 8 0 h  `  `  `   x h P H 8   ` 8  ` `  ` ` ` ` p ` h X ` P H ` @ 0 ` (  `   ` X `  `  `  `  `  x ` p ` ` X H ` @ X $ D  h ɨ   h    K < 8    0  ( \ 8 8 8 8 8 8 8 8 8 8 8 8 p X P @ (  @             x   `  P @  P 0  P           EEEE P  xT !8  < , AP Bd @ H Bd @T R S( RXh Uh V@ U \ \ ]D u u v,  (  Pl $ @ \ H < 0 d | ( h  P X œ@+ + + +   ɠ ƀ d$ ֐ l ϼ p`ppppp p@0pP 0p`$ H $ @ x   ܤ ߜ l ߈  P 0 (08pp p@ p p p $ \ h  (`L/0-(57-0H{}8yXpyA8pp 3 pp  3<PPP 3ӈp  3@`@@ 3 pppHpPH 3lp@`@@ 3Ը`` 3  3P@@@x 3՜P  3  34  3ր<  3 < 3  3d 3װ 3 3H 3ؔ 3 <  3,  3x  3  3  3\ @  3ڨ@  @ 3PPP 3@  3ی0H@  3  3$ 3p  3ܼPPP 3PPPPP 3T pp((p  3ݠHP @P 3@@h 380 @ 3ބ @@@  3@  @ 3 p  3h  3ߴ0 @ 3 3L p  3 @@ 3 PP  30 `  3|p @ 3 pp 30PP 3`p 3pp 3 @@@ 3Dppp 3pxp 3 p p  3( p 0 @ 3t @@  3 3 @  @ 3Xp  3px 3 P 3<HHHpHHH 3pp 3HHHHHHH 3  3l 3pp 3 3Pp p 38` 3 34 3 3 3pp 3d 3pp 3 3Hppp 3  3p 3,PPP  3x 3PP PP 3PP  3\ @@ 3p@@@@@@@p 3@@  3@pp 3 P 3 3$0 3ppxx 3 3pp 3Txx 3pp 30H@@@@@@ 38pxp 3 3 ` p 30` 3h 3` p 3 3L 3pp 3 30xx 3| 3p`p 3@@@@@H0 3`h 3PP  3P 3DP P 3hp 3 @ 3(  3t  3   3 H 3XPPPPPP 3 3  3< pp  30H@@@@ 3PP 3 PP  3l  3pppp 3P 3Ppp 3`p 3(PP( 34 3x 3pp 3p 3d`` 3  3` @ 3H` ` 3` 3 3,xh((((( 3x p  30 4 ` p 4\pp 4P(P 4@@H88h 4@@@H8$H 4` p88h 4 @p 4$0p 4p`p 4 Pp 4h P 4TP P 4 P p 4<P 48pp0 40 4` 4 P 4hP 40p p 4`p p 4L Pp p 4Pp p 4HHHHHH 40h 4|0pp 4`pp 4 Ppp 4`hpp 4Ppp 4P P 4 Dxp 4 0p 4 `p 4 ( Pp 4 tPp 4 `PP  4  4 X` 4 0pxx 4 `pxx 4 < Ppxx 4 hpxx 4 Ppxx 4 P pxx 4 l(xx 4 pp0 40pp 4P`pp 4 Ppp 4Ppp 440` p 40` p 4 P` p 4P` p 4d xp 4h 40pp 4H`pp 4 Ppp 4hpp 4,Ppp 4x  4xp 40h 4\`h 4 Ph 4Ph 4@`hp 4 4Php 4$ 3$3p3Ӽ33T3Ԡ3383Մ333h3ִ33L3ט3303|333`3٬33D3ڐ33(3t33 3X3ܤ33<3݈33 3l3޸33P3ߜ3343333d333H333,3x333\333@333$3p333T33383333h333L33303|333`333D333(3t33 3X333<333 3l333P33343333d333H333,3x333\333@333$3p333T33383333h333L33303|333`334D444(4t44 4X444<444 4l444P44444444d444H444 ,4 x4 4 4 \4 4 4 @4 4 4 $4 p4 4 4 T4 4 484444h444L44404|444`444D444(4t44 4X 4)?? 4)U@*U@*U@*U@*U@*U@ 4*`DDD|DDD 4*|@@x@@@ 4+@8D@@@D8  @ 4+@@@@@@| 4, #aaq: 4, 4-DddTLLD 4-pDDD(( 4- 4.P 4. 4/0 4/ 40 40 40 41` 41 42@ 42 43  43 44 44pxx 44pp 45P?111` 45@ 0`@ 460 000>|? ?1 46 47 47 47 48`000` 3ff 48?ff`f>``f`? 49@8`DDE9  2 2 a 49>wc`aaa?` 4:   4: 4;0  0 4;pf`vvf` 4; 400000000 4>6? 4>?a@ 0  4?` @````@``@? 4? !? 4@@ ?1```@```0 4@ 00`gop``````p@? 4A ?`@@ 4A000  000 4B ``````p?```< 4Bp   4B    4CP`xx` 4C 4D0`88` 4D9  4E?0```g ollg`0? 4E ? @@`@` 4E````a`````````` 4F`` `````` 0 @ 4Fa``````````````````@a 4G@0@0@000?00000 0  4G0@0@000?000000x 4H ` ````a`` `0`` 4H`````````````````````` 4I 4Ip80 4Iacflxx|ngca`p 4JPx00000000000 0  4Jp`pppY`Y`Y`M`N`N`D`D` 4K0p` p x X L F G C A@@@`0 4K ````````````` @0@ 4L00`0`0`07000000x 4L `````````````0@8@# 4La````|ngca`p 4M`0`` ` p<@`@`` 4MF  4N@p` ` ` ` ` ` ` ` ` ` p@? 4N`@000  4O f f f v w@3@7@;; 4Op` 0@8   @` 4Pp` 0@  4Pp?   ? 4P 4QP``00  4Q|| || 4R01` 4R 4S 4S0009 4S ```gop````````p`xO 4T`1 ````p@0 4T`````1 ````````p9`p 4U@0``````0` 4U   4V  1```1?`? `@ @ ? 4V0p00790000000y 4W 4Wp 08 4W````acf|x|ngc 4XP 4Xnf`f`f`f`f`f`f`p 4Y0'y0000000y 4Y ````````p@8 4Zq``````````@p```` 4Z  ````````p`8```` 4Zs48000000x 4[`00@8 0? 4[  @ 4\@y00000009` 4\p` 0@0@  4] pf f f 7@;@;@ 4]p@8  4^` 0@0@  xp 4^p`A8 p` 4^ 4_P 4_8    8 4`0 >`6gC 4`UPUPUPUPUPUPUPUPUPUPUP 4a 4a 4a 4b` 4b 4c@ 4c 4d 4d 4e 4ep 4e 4fP 4f 4g0 4g 4h 4h 4h 4i` 4i 4j@ 4j 4k 4k 4l 4lp 4l 4mP 4m 4n0 4n 4o 4o 4o7%dlhx90 4p` 000>|? ?1 4p` w@;008.@` 4q@p` 0@ ?? 4q 4r `0 8 1`p`8A@a 4r 4s @/@YYX X YY/@ @ 4sp1?? 4s @3 ` 4tP```` 4t 4u0 @?@YY_[ [ Y9 @ 4u?? 4v#aaq: 4v 4v  4w` 4w 4x@y00000009>`0000` 4x>~~~> 4y  4y  4z 4zp 008? 4zf3 "D 4{P88 `?@ 2dG 4{0pp0 0`013`2``A 4|08|L  `L};@ 2dG 4| 000@9 4} ? @@`@` 4} ? @@`@` 4} ? @@`@` 4~` 3 ? @@`@` 4~ ? @@`@` 4@ ? @@`@` 4  @'&@>&FFF 4 ` `````` 0 @  40@0@000?00000 0  40@0@000?00000 0  4p0@0@000?00000 0  40@0@000?00000 0  4P 4 40 4 4a````````````````@a 4 3p` p x X L F G C A@@@`0 4 ````````````` @0@ 4` ````````````` @0@ 4 ````````````` @0@ 4@ 3 ````````````` @0@ 4 ````````````` @0@ 4 ``00`` 4`!!c`c`f`l`l`x`8@0@8o 4p` ` ` ` ` ` ` ` ` ` p@? 4pp` ` ` ` ` ` ` ` ` ` p@? 4p` ` ` ` ` ` ` ` ` ` p@? 4Pp` ` ` ` ` ` ` ` ` ` p@? 4p` 0@  40x00?00`0`0`0`0?00x 41136663104`6`w 40009 40009 40009 4` 30009 40009 4@0009 46@&``?fffg`? 4 1 ````p@0  40``````0` 40``````0` 4p0``````0` 40``````0` 4P 4 40 4 401 ``````p@8 4 3'y0000000y 4 ````````p@8 4` ````````p@8 4 ````````p@8 4@ 3 ````````p@8 4 ````````p@8 4  4!c`f`f`l`x@8 4y00000009` 4py00000009` 4y00000009` 4Py00000009` 4` 0@0@  xp 40````oq``````````@p```` 4` 0@0@  xp 4 4) 4*H 4* 4+( 4+ 4, 4,x 4, 4-X 4- 4.8 4. 4/ 4/ 4/ 40h 40 41H 41 42( 42 43 43x 43 44X 44 458 45 46 46 46 47h 47 48H 48 49( 49 4: 4:x 4: 4;X 4; 4<8 4< 4= 4= 4= 4>h 4> 4?H 4? 4@( 4@ 4A 4Ax 4A 4BX 4B 4C8 4C 4D 4D 4D 4Eh 4E 4FH 4F 4G( 4G 4H 4Hx 4H 4IX 4I 4J8 4J 4K 4K 4K 4Lh 4L 4MH 4M 4N( 4N 4O 4Ox 4O 4PX 4P 4Q8 4Q 4R 4R 4R 4Sh 4S 4TH 4T 4U( 4U 4V 4Vx 4V 4WX 4W 4X8 4X 4Y 4Y 4Y 4Zh 4Z 4[H 4[ 4\( 4\ 4] 4]x 4] 4^X 4^ 4_8 4_ 4` 4` 4` 4ah 4a 4bH 4b 4c( 4c 4d 4dx 4d 4eX 4e 4f8 4f 4g 4g 4g 4hh 4h 4iH 4i 4j( 4j 4k 4kx 4k 4lX 4l 4m8 4m 4n 4n 4n 4oh 4o 4pH 4p 4q( 4q 4r 4rx 4r 4sX 4s 4t8 4t 4u 4u 4u 4vh 4v 4wH 4w 4x( 4x 4y 4yx 4y 4zX 4z 4{8 4{ 4| 4| 4| 4}h 4} 4~H 4~ 4( 4 4 4x 4 4X 4 48 4 4 4 4 4h 4 4H 4 4( 4 4 4x 4 4X 4 48 4 4 4 4 4h 4 4H 4 4( 4 4 4x 4 4X 4 48 4 4 4 4 4h 4 4H 4 4( 4 4 4x 4 4X 4 48 4 4 4 4 4h 1234567890-=` qwertyuiop[]asdfghjkl;'\ zxcvbnm,./ !@#$%^&*()_+~ QWERTYUIOP{}ASDFGHJKL:"| ZXCVBNM<>?   13457890=   ;'  ,. AEIOUaeiouy ^AEIOUaeiou ~ANOano Cc AEIOUYaeiouy `AEIOUaeiou !!""+-,,-,-:Aa|/u0Xx12434<<>>??A"*E^`~ôC,/OD-E"^`ȴI"^`̴L-N~O"/X^`~մP!|ROSOTHU"^`ٴY-\\^*-.0123_Ooa"*^`e~c,/od-e"^`i"^`l-n~o"/^`x~p!|rososthu"^`xxy"-||rd0property length0=>4OhO`OX OP +8OH+PO@, d  h   P XEDADHB\BG  # $ * / @p $ % < 9D 9$ 92,23`411 X Ĵ P h `\ D֤0h׌ltxTlxlll d0 d`l|,lll  h pXxL ll%& &0('  h l # $ .h . / l  Xxx\l lll 0   dl8@ l h   lllllll ƀ   dllEDADFFB\lllllllllll $ % &X & 9Dl P X œll X Ĵ ` ʐ Plllll   ܤll l ϼ  lpllllllllllllllllllllllllllll h  XxXxl\L2,23304lll  P 0lllllllhip`rurlll~   (w 444trap8888x8h8X8@808 88444444777777777p7`7P7@707 776446644666644444444444444444444444444444444444444444444444444444444444444444444444444444444444466x6h6X6H686(665544444444444444444444455555545hޭ@ @ @ @ ????4  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.1RAMDISK#77 @(#)OpenBSD 3.1 (RAMDISK) #77: Wed Apr 17 15:00:30 MDT 2002 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/RAMDISK