ELF@43u4 (`@@3C6 3P zHP tHP pHP lH_HyHP `HP THP ZHP THP PHP LHP HHP DHP @HP HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P HP ? HP @ |HP A xHP B tHP C pHP D lHP E hHP F dHP G `HP H \HP I XHP J THP K PHP L LHP M HHP N DHP O @HP P HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P+H;8;;;;; ;(;0H )@`  >+H!  >+H;8!7 >+t0+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >+H 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->+H %)>+ %"+/> ->+H+cP> #ܒ`"##t@> ";x ;"`;" @?=@: Ҋ@@2 @ 0P -@ @ @"P/> P->+H %)>+ %"+/> ->+H+cP> #ܒ`"##t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @>t x ``-`؁ @> tx ρ )>!4@! P->+H %)>+ %"+/> ->+H+cP> #ܒ`"##t@;x;;>!<!@ ;`#h#l;;;;@qN``htx ;`#h#l;;;;@p#``htxn )>)"@)>)#( P -@ @ @"P/> P->+H %)>+ %"+/> ->+H+cP ;`@;h#t;x;;;;;`@m;`htx( />->+H+cPۜP -@ @ @"P/> P->+H %)>+ %"+/> ->+H+cP ;`@;h#t;x;;;`;;@q;`htx၌ -?P -@-P -@ @ @"/>/> />6PP->+H %)>+ %"/>/> />P;x> #`"#@;,/,;@ ;`,)>+!X;h %)> ߨ" #pH  p@  "`@ x  +?P`-@-?P- %0P -@ @ @"/>/> />6PP->+H %)>+ %"/>/> />P;x> #`"#@;,/,;@ ;`,)>+!X;h %)> ߨ"#pH  p@  "`@  @@A `x' P -@ @ @"/>/> />6PP->+H %)>+ %"/>/> />P> #`"#?P * * ;`@;h09P -@ @ @"/>/> />6PP->+H %)>+ %"/>/> />P> #`"#?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@<̐`h ?P `*  P -@ @ @"/>/> />6PP->+H %)>+ %"/>/> />P> #`"#?p " ?P "  ;`@;h@@`h ?p " q @/>  @̀->+H $)>+ %->+H+cP->+ ZP @ H ,@`#>+`H$` (08 @̀=)>+ t0+0;"+2+0 `# @ 05-" % >&u 8 >0-@0=`"-@-@0 `# @ 05-"Y  ->+H%- +cP ;`@;h #t;x;`;;;;@k;`htx ->+H& 0Ȧ! H,@` !`hpxX (08@HP @̀H,@`%>+H $!>+ H`8 (0 @̀@ @̀  H ,@`#>+`H$` (08@̀02??@ @̀='>+t0/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#>+`H $`!>+ H`8 (0@̀ ->+  @uP->+H"/> 4͐  ! H,@` !X (08@HP @̀>+༒ `?* `"" * `@">+ے  * `@&* *  ֊@* "``(  +`c+X +X  c  mt@ >   >  @@   >  @@ #>%>  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%b@>+" L *>+" p!`>+" tH(  /  ># \==>*H >+" x> #> `@w"@!> B$!H``> B-"a  !>%#!>'!$ $ >%# 2> " > " > "!> "!@>#"">#"">#"#D>#"#l>$""$>$""L>$"">$"">)"#>)"#0>+"!x@,<@JEd#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP    "%>+> >+"  ">+>@ >+  H>&b4#  H>&bP# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * >+ >@ *>+ H>&#@" >+H" >+H"   >+H4``6 >`H >+  !H!`>"聈 @a2> B!`"!> #`"# > B >+> B!ᜁ`2$j0>'@א >'@Ԑ >'@ѐ +switch rqswitch wchanswitch SRUN> B >+H: H> B" (o!ᜁ`j> L > K:">*"2J "2 J    "2 J  J " > Ba+  @ #@"   *@ * lH1 > B""( `!ᜀ"I"j > B"`""j ` *@  ( !H> B!` (08 2㿠@J>+`L` Ъ@@>`€"Т@: H" H*/  h:`>   >+H>'8" " " ?" ?> >+H>'D" " > >+H>'8" " > >+H>'8" " > ؀ >+H>'8" "" > >+H>'D" 2" > >+H>'8" 2" > >+H>'8" *" >+H>'c8" `2 `2`2" >+H>'c8" `2*`22`2"" @>'cD" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*>+`H>)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >* "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a>+` """"""""""""""""@2?# * 2  `c  @ `> L? @ 3 >+! c@  Њb@&""""  > cĔ@ @> Ba ``44: " longjmp botch@" `&"`㿠>+@."X6 0P||׼\0ڼ<tڔڔڔL<```$    2     2 㿘 H>Ac@"Ȁ 2"Ԑ  @a &""Ԁ 2"Ȑ  @aؔ &""Ȁ >"Ԁ 2">@ 0D >0> @ 0<"4* ">"@ " @oA  `.  . "*"@ *`"  *  , @o0*  . . `&  @."" 6 f6 j> `h& |& t& @I >+!*"@ @*`㿘 ` @!>0"!>  @Ô!  ."`  "! > @!  ."   !"` W>>+"*`     `  "` &"  "` &"   "    &". .    .     `   `   `   `  " @N! `   `   `   `  "  `  㿘 `@>!8@" >0"!>  @!g  ."`  㿐)>0" >"!P@!>0" 2"> >#ah#\ L  @  $"" 2  & & &  @o" ""?07 ."6" "`, @ Ȥ  "%   $ , "`, @ϐ ,`  " `"  "`, @``,`,   2 ٦@ې!&"&"  "  :    : `!`*"***@`  .""!>  @!  ."`  0."@㿐`   ,  #>0b  >`/!`I`J@\ ."`  2"`А"@ >+ @m#>+a! @m# @`" 2 b!>  @2"\  ."`            + " @mN ,`"* "@mF* &`"    2 "  " 2 "􀌠"?"  "          ` "n`I" T`/`@&"&"'    `  @2 "  ` "  `  " >0"!>  @"s  ."`  >0"!>  @"v  ."`    "`@@`/>0"!>  A@o"{ A ."`  A0  " "    `  ` .`,`@`,`I`*`J *`@  `..`." r 2q &"&"'    `  @2 "  ` "  `  !>0"!>  @ "  ."   `!" @6".""! > @"  ."`   "!>  @"  ."`   " "@  `@0H @d !>0" >@!"!>  C@"Ɛ C ."`  C0+`!" @6".">0"!>  F@"ʐ F ."`  F0>0"!>  B@"̐ B ."`  B㿘H /d * % > #@&` H 0㿘> B!  `@? H / * % > @#H 0` L@l>A`a@`  &`  㿘   '>0 >@/! >  @" @% *    @,``  Ô4$  @]  2@l$ > L <$H /d * %  $"` $  $ ,`` " H 0n 2$ M  $  $ @ $  $ D  /  $ @ $ < $$ D, HH /d4$* %$`$ `"%`  $ b  @NH 02  @ " @Ӑ @   @ʐ 㿘!>0" >@}""!  `@ "`@ ΐ` ""  " >@c"(@ #贆2  㿘/>0 "">@P"H"`" >@"```` `*     ` @  ` "`  @  !H /d* % ,     Ȑ &> L$  @\”   H 0@@k$  < $  "` $$ , " > L $   "$  `      `  H 0s@:,`I  2 H 0d@ * *@ 2  @  *@ 22 >@1" , , * " ,`JH 0 `    , @``& ` @``"`& `@"@` ?$` & 0 "@>`"@]`@`2`㿘``/  *  >0"  >@G"@j  .`/  * ,`,``  4   #&`@&`<&`D&` &` $,     Ԕ   2, @ , $  @2 0 &@ " & &  &``  &` " 㿘` *  ,     +>0b > ,@ڐ"@~ِ``H (2  , `>*`4 "2@˒  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ ([0Q$ ( b `$  (`" ,>@#( ,`2>> 4@#8@#H@7 @2  ," &  ."/ , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@\Z  `@Q%㿘`  `*  ` 2,``  ,`  2  >>>#X@ɖ2`I*"`I `J*`  "">#@ ?*`  ?&` @``"`& @`"㿘!>0" >@#"!>  @$  ."   "  # 㿘``>0"&"""@@k# @€ "` * ,` 6   @€ , &  % `   @€ , @ € "ܠ 6 " @€ , & "ܐ&"!>0"  >` > > "@ " """ܠ : >"> @@t ("ܠ *">@l 0"܁㿘!>0" > 8@`"  6 >@>@U ( &@>@N 0  `@ " 2   `   & 㿘b   bb  b* *@> H@ `!>0[ ? `.   @, `      `` `    ,bݰ `.@  > @`!>0,b$` ````+`b`@g . "* b@g * & b  ` 2 b b 2 b􀎠"?b  b `  `  `    !>0" > ؒ @%X"!>  @%X` ,b`   bbĐ @ ` @" > ؒ @r%Z"!>  @j%Z` ,b`   bbĐ @` ,b4b< $bD>$b" > ؒ @N%c"! > @F%c` ,b`   bbĒ`@ " > ؒ @1%g"!>  @)%g` ,b`   bbĒ`@ 4b,b 㿘+>0b >"@ "܀ 2">! @ 0b" >!H@ "&"ܐ ."b >" @@!" b!>  @%  ."`  >"ܐ!"@ @ 0"܀` > ؒ @̔%b!>  @Ĕ%  ."`  ""Đ 6"Ē`A0.""2""Ԙ    `  ( `         `  `?`bb!>  @%Ő  ."`  0">" @!@n " &"  > P>  "  *  `"K>+"*` b">@J!" 6  @Pn ">!@> &" ! " $D" ( ."b">"@)!"€ @"| b"M!2">` "`@ b">@ "0b! > @%  ."`  8   ,     +         I  ` J*  ",J" `?*`,J,I *`R"`>` "H`@ʒ " ."  ,  "`     `   `  -">` "p`@  ,b">@""b"> "@ "b">@"  $" ." !$ b">@x""$<"$Db">@m"<&"D&"b"> @a"" `  " `Fb"> ` `@P#" ` N!>0 `,"  , ," "   ``|!@O` >@2# "  , ,b > ؒ @#&^b!Z>  T&^d @dV  @dP!- @*`@*`" "@dE ,`"* "@d=* &`,`"* "@d3* ,@O >#0@" 21  "@6 ",   ,  ,b > ؒ @Д&{b!>  &{@  ."`  ""Đ @`."6"Đ ," ."  `+ "` @c ,`"* "@cݑ* &`"    2 "  " 2 ""?"  "          ">#P@g "  2L,  @, +@ " @c ,`"* "@c* &`"    2 "  ``" 2 ""?"  "             ,@N= >@#h!>0b"">@#@N. >@#!>0" > ؒ @&"!>  @&  ."`  ""Đ @a`" 2>"`2 >#Ȕ S""  > @Ȓ b6"  @"Đ P@ b > ؒ @&b!>  @&  ."`  ""Đ @` > ؒ @&b!>  @&  ."`  ""Đ @` ."6""Ā >0"!>  @u&ΐ  ."`  >0"!>  @d&  ."`  " ."&"܁㿐!>0" >"Đ @L"" @" "=""!>  @=&  ."   6")&"Ѐ ">" >"Ɛ @'&"!>  @&  ."`  ""Đ @"."@ 6"Đ  @ &"Ѐ 2""Ě "ƒ    * 6"6"6"€&"@"""Д ƀ""""r  " """     "ȑ* *@"Ȑ *`"Ȥ*` "*  "* " &"  ,  +@ "j @a ,`"* "@a* &`"    2 "  ``" 2 ""?"  "          ]"Ȕ     "ȑ* *@"Ȥ*`"*  "* I&"" >  @Z'!  "Ȑ 9*@ >  @K'*   I"* J"* (&"Д  "."*@   *    , , *@   "Ȑ  *@ *@  "."*@"&"" 2""̐">0"!>  @'k  ."`  0W"@8  '"̔"П@  `   `  @2 "  ` "  `  !>0"!>  @Ô't  ."`  "! > @'u  ."`    @x>0" >"@! `@ 2   € . @€ " ` .  @€ .  @€  . `$`" @ 2! &"!>0" > !x  @_  <  -& < @€  "! > @J'  ."   } " > @9!(^   >!@@Œ  0@Y  @( @€  "! > @'  ."   J "  2  "`,  @"-""  ." ">" "!`@" @€   "! > @ޔ'  ."    " ` ." @ "C  `@?2  > @!  ` @ 2  2* " "& "`2"" >" ! #\ @  2 > "  ?D#\@ B>"X@ " " > ؒ @v(?"!>  @n(?  ."`  ""Đ @` > ؒ @Z(A"!>  @R(A  ."`  ""Đ @`."6" ` !>06"" > "x @6 ` @€  "!>  @'(I  ."`  "!>  D@(P  D."`  D"?`q>+#*`  "`, `*    2  2 4  8 * "@`"  "`  "@ @Rʒ  2" ">@I >@Ɛ"  "*  `."  , " 2>"@  >@"ѐ>@"@tM  d"`,g& "`q>+#*` > @# "  >@#8>@#Xb""   € >#p@o  ?  € >@c# ? ` "6"ƀ 6"6".">0" >@L#@tK $ " & &  $  $ & " `."> @/#8TH   $"" "" >  #"#\@ ; ."#>0b > @ ` """ ."b!>  @)  ."`   " " "" 2"" ."" >  @ܐ  ˰ 0ː ` 2B>2>@d P ` * `+>+#p*` >0"!>  @)=  ."`  ! `2 " I 2">d h >_ ` #>0b > ؒ @@)Lb!>  @)L  ."`  ""Đ @`@."6"  F ", , " ." I !>0" > ؒ!@e)T"!>  @])T  ."`  ""Đ @<a" > ؒ @H)V"!>  @@)V  ."`  ""Đ @`!>0" > ؒ!@*)Y"!>  @")Y  ."`  ""Đ @a."6"Đ w&"" " " @€  i @€  `>`   #`#\@ !>0"!>  @)y  ."`  " > ؒ @ڔ)z"!>  @Ҕ)z  ."`  ""Ē`@ 6".">0"!>  @)~  ."`  !" !"䀠*  >` #\#`2 `@ !&"< &"D."w&" !( `@ >0"! > @)  ."   췐 " X  `."> ! @i  "܀>!@_ ""ܐ ?,H""Ԑ ?#>0b @> !@M > ! " $D" ( ."!@9 &"b!>  @0)ʐ  ."`  0>" @"  " 2>2">@"( #>0  4b| @ >Ȑ#@"!>0! >#@>#@>0" @>@"@&"!>0" @" >@"X /" " 2""!>  @є)  ."`  " .""! > @)  ."`  $ >" 2 "> "p @ """@ ߀ ."`?   " @  b&"> /"@@ @€  b!>  @{*  ."`  " X/@ &"&"`'"" @ `   `  @2 "  ` "  `  b!>  @7*"  ."`  b! > @'*%  ."`    @ @/b!>  @ *)  ."`    &"!>0" @>"@#"!>  @*/  ."   ""@8 " '" @*&" @>@Ր# " 2"b!>  @ɔ*8 ."   ""@8 "' " @ &" >$     `  @2 "  ` "  `  !>0"!>  @*E  ."`  "! >`   @o*O   ."   `   @O b @>@T#0" ."b!>  @I*U  ."   &"@= bA+  ."ې% @"@Zj 2В@@@ '"@  ? `@ 2 @p@@$  㿘` 'А @&`&`  @;" !'!>0" > ؒ @*"!>  @*  ."`  ""Ē`@ 6"."А"@@ #@Z'>+a >+!釐'@Z #`@o0 lp  `` *``@D   € ` @ >#h>#x ">#\ ##`#d" #h"#l"#p"#t" #x D#|@ HH /d4 * % @  >@} m 0!>@v  $,h   " @D>@` `  `*  $ H 0㿘> L =H /d * %  ̠   "'`@6 2  2 4  8* $@`"  "`  "@ @M   ֠ @H 0>+!*"@  H@nϓ*`㿘 @€  . @€ " ` .  @€ .  @€  . `$`" @ 2! &">0" > !x  @ 㿘@  H >E! >F>E?Ԡ 0a("& & & 6 h& 0@r@"! 8&!! @!  @ @"  >@ @@@" >@ " >        &!&!@ @!>!@"- h@v!>!@p x>5>F  @^z &!>@ ! *&"! *`&"*  * &"&" &"㿘H o*@ g@ H 0h h! 77!!* !!+ !*!@  77ސ 0@7!&""&" @!07&"U&"?* !"! 70J7?* !7" ! 6! ":!"@!0 , //7Ԑ 77֒П@ ! f!  " , !"@!00 /7̐7/7Βȟ ! f㿘!  㿘!   d!`"!@!! l"!  !, 2!4  Ӑ d!  a" !€ !"?!€ !! !B h6 f @ ;6 h@z 0!> @n !`@㿈!€  ?Q !  !  @   & (  & > @:!0  > @2! `& ! $> @%! `&  ͐ "" @ 2  >!@   a>!@ ]  >!0@ T ,?@"*` ?퀢%I@   @’   = @ 9   0 $ $ $ ` ',쀢  @i   쀤@    쀢 ( ' $ 8 $ ! %$@ج쀤 2 |   &  \ `& | @<@- 0! :/77 !" ", !  h"&""o V"`@ ;<6 h @>!P@k  @>!p@b 0@Ah!`>@!@P @  &  >! @@   &   & ``  "   &   & ! " " ?&" "  , " ! `" h 0@&"" "6 f 㿘>b @Δ  X`& X㿐 8 $@ @ ",@, *    `2LH /f * ' T > Bb*`@ ?2@   @   "# 8@  <"`< < 8"`8> ` $@| $  ( $ 0 , @I 4 $ 0 ?4 > _#4@|H 0R H /f * ' T > Bb*`@ ?2@   @.   "# 8@  <"`< < 8"`8> ` $@{ɐ $  ( $ 0 , @IM 4 $ 0 ?4 > _#4@{H 0 2b ;   <" <  6 60 /77   H "    $  8$'6 8,@   > 8d6 8 "(@    & & $  ?& 2 ,$㿘H /f * '  0@   H 00\a2@a1@5a @a@"8G 0!5@70 !6@3 0<8 48  @8 0.@  288 ?#48 2 @0@ @| 4@  !Ā !@  H 0㿘㿘 8!:<6`6`6`6@!d' @\  +?      @;n # 222< 22*@  * @6@ 2  א 8 = 6 8 8<"6 86@6`6`6`㿐!']@㿐!'S㿐!'@UĐ㿘> h >@ "`0) $  4 %> >0l"t ""t"h@"  @F ؠ@U ؕ,`l" >b$ @  @ `@ 㿘`@^`>0"`&`&`X@p`0 ? > 0h 6 > l* " Ȁ" đ2 㿘?2  > "h6 6 > "l*      @3  Ȁ "  а .  ? 0 2 > l(   Ё 㿘>G>#T" @I㿘>G>#T" @I 㿘 D? 2`  2 > * bl@`Ȁ 6  23 <`& $"` $ E@cА 0A T <* & @`Ā   0@"0" 8`  0   Hf @  H` @" & @ <& @ 0 (& 4& 0H /d * % @ױH 0? 2  @2> "l*`   m@T "@Ve e@ 0r "@V  k eg@gf@ e ``Ȁ _@_ 6!V R`O  @O F e g@B? 2  `@?`4 # @ `* * >GcT@O,`Ȁ '& $    `ʔ   `Ȁ    0  @`@n 㽘'> Ԑ@T%!@T!" "$ ($ 0`đ2 $ ,$ 4$ 8 d$ 8>b @S  4 > b@S  ,. (4 H2`  $ <4 J$ X$ $   aW4 $$ , @mȐ? 2`  ?6  +  *4  >GcT@N  㿘`><!8@0   & & &   㿘@=`# @@ :$   ` $ $ @$ İ$ $ 㿘 "> @`Ԙ Q̀ >0 $$ T$ $ <* $ @Ā   0@"    " @8  0   H:  H:  @"$ @  0$ 4($ 0H /d * % @EH 0́<=\=4=H= ===>4<???@?@@@?@@@@@@@?@@@@@@@@@@@@@@@?pEEEEFFEF 㿘 \ @  *@F>0 ` "? ᒐ  h ? 2: \ 2  3  X* \  * \`* h>0  b?,  \g  h 렄? \ `*   $ \ h @2 h \ `*@&㿘 \ E >0 ` "? :  h ? 29& 2  2  X .   \`* h>0  b?,  \  h 렄? \ `*   $& h @2 h&㿘  Ȥ >K$@ft`D`8 8  *, $L"@  d  6 :&%L& * \ * `* h* t  h* `@㿘 \ *@໐! \ * `a*@ d"*@ t @㿘    `@@  @R  @?㿘 `" @   & %P 2   \  ``*x%P &%P@, `@㿘H /d4* %  >@~#0  ` > #( @~   &  2   $L * *`@"  @H 0㿘    `d>@|~#PH /d`* %`   >  #x@}ђ ~  >@|_#     Ȗ`8+ $ `?#  4`  `# #   #  $# # #  Đ $ 2$$H @    >@|(#БH 0㿘 2 >@|# 2 >@|   @ " >@| 0 ,  $,, 22  `"  #` `>  "  $,   >@}K P$,$ & &  $L *`*  &"  >  x@}6  $, 2& >@{Đ  $L *`* @" @e% $ Đ& `@8g$& 㿘  ` @ " >@{ "$H>@{ &$H  *"  *     ̒  $L@ - ,   Ȗ 8   Ȁ    `@0& @l "-   x> @|Ȑ  %P 3`, $L"@&    &  `& &%L&%P&%T&%X``0  >!@| !$, &%L& & &%P&%T&%X   $  & <&%P 9b !3&%P@2  >!@@|| &  "  "    @& € "   `" @   >+!@N# @d @I "H 㿐 " h>@zܐ!h )>0 @"`>u  h ɀ @2l  X   >! `   *@"  >!ؒ @| 0.  \ *@"F  h "  \`>!@{  \>0* h* t h b? (  h ֠? >" @{ޒ U 2  > "8 d* X  />"P @{ǒ > ,* $L@0> &  &  &  & @&%L&%P&%T&%X `*  ` $*@   `" @  0*!@{  0#"x@{    \ & *@ݿ   q &%L&%P@ d * h* t  h* ?& 㿘`  `d*`\*``*H /f * ' `X *@`` *@`\ $`\݁ `\? @ y `\ @ 2 `\  *@o`\ "```\*``*H 0֐T *`h*H 0` * `X*@`\*H `\ * B`h @'a?9 `h @?  `\*@, `h @2`\`d *@`\ *`` *`h*`t `h*0`\ *` ```` $*@ 㿘   d * \%L ` %p:" ?& %h&%p  h @ @ >0 ` "?   h  ?   2   2 l " %P 2   \  ``*ܽ%P  `&%P&  2@ \`$ X%P 2   \  ``*ܤ%P  `&%P)& = ` `%p*  &%p%h `  (:%h`27%h`%h .`$  \%h 2 \%i @"$%h \* h>0  b? g  h Ǡ? 2 \ *@h%h` 9>I"*` ]%P  %X \  ``*>%P \5%X "9 H \`   B %  =%  &  8& %j   >"@yߒ %P>"@yْ %P 2 %P \  ``* %P \ &%P @ 4( %P ` &  \  ``*%P &%P \* h>0  b?   h ܠ? 2 \ *@ޤ㿘 d   * \ @  *@%L` %d%\@z"%P%T &%P&%T%P%T  *  &%P&%T` 2&%X>I"*`  2 >(# :     2  .%\       .%\ >#H@y=  .%\ >#x@y5  %]J&%d @M>0"e  h @ ?  2> \ @2   28 \2 %d%P 2 %d \ *@F %d&%d X>0  * \*7  h ?  2 \ *@ `4 h%P p` \ *@`"㿐   d*  /  *`// ///    S @` $ , %P ` &  \  ``*%P &%P 㿘 ` @`><# d*@4  j   `>0b* @ >#@x} 0[2   @># 4` ` \  h  h 2  ; >#@xW $ "  d & d @) `*  x  |    @ " $ $ %P ` $  \  ``*c%P  $%P㿐 d  *@    >& @x  㿘 2 >@v 02>@v P m  h @ @>@w p $,X` @>0` "?   D> -  d h ? h 2   >I#8,  -/+'0#> @w %P ` &  \  ``*%P &%P> @w `&%L`") l   @ "   &  @ t `" l%P    \  ``*ٱ%P &%P l >!@wi %P    \  ``*ٚ%P &%P`^`` >`& !0@wL `ǐ``  `>!X @w; &  $(`2>0 h bj  h @" \? >!x@w  \ * ` * d`* h* t  h*  &%L&%X& & & & &%P&%TUUVdVV㾘> Ja k "a@L> E 2 `8 @`Ho o)> J a ?*a ` `, @O @   ,  , ,> D( @ <`C B8 ,$8(H 0# a a *a"a @ a*a @ B8*@ a*@>+!*` *> D"@ !@^V*`> J 㿘> J`a> D a "a*a @  a*a @ *@ a*@ B 8 @ 㿘j> J !> D !`"!*! `  ! @ *! `  * ! * !` ! `"!*! ` D ! @ *! ` (* ! * ! ! `"! `*! +  ! `@ `*!  * ! * ! ; ! `"!*! ` +  ! `@ *! `  * ! * 㿘%> D 0!> E > D>T!a@]> D>R !@]b> J8  @ @" $  $`> D""@I"> I$@I 8 > J * ``> JI  $? 0     㿐> D! À > J.  8@ . @ `  􀢠O@` `" # & & 4 4 :?  :?#: : ::2>0>0"b" :  &  0 > Dx`B j:x$`$`$@2 2 Ho o>0b> J 8`@:<>0@  #b > D> D" pB: pH 00<"" " " " `+` B ; ` b`B  ;@. !! @  @8@B B; <@  > E    > D" @\ɐ!H 0㿐> D@\!#> Dbh`B :hHo 0o'` '`H 0  > E  `  " @2 c* #  +`g  c᜘ *`  *1 # **  c*`  (     >!ȓ*` ?3 # ?Ă`b @B J!@ @-b Ho o>0>0"> J   8@ <"" `2|` &H 0 0 )> E`Z @HaH/` / @Hf2`,"@$$H 0@H@Gߒ X耤@/ //@ //  // />$ 7 $ > @G > D" .`@ C : `  `@8? 2  @`e>R *` ^ !> E  V #> D X> I``C :X> $!  @T A  2 @8> D`B :?#J.`,`:`&ՌՊ?c ?, ,` " ?# ,  0   ?#@J ` 2`㿘`` 0 > E  > J @Gaİ R`   >0> J"`8>0> I0"`8> E"` JȀ2  2 H  <" @ H> I02  02 H  ?  2  2`{  2`v @8*`2 ?# @J  ]?` , * 2`  * , 2 ?#??@> E  ` @"  2 c* #  +`g  c᜘ *`  *1 # **  c*`  (     >!ȓ*` ?3 # ?Ģ` ?` 2`? 2   > J"!㿘 "@$ "@ "c 8""@"G  @"u   "@"   b~@b}@ 0Ho o> E &H 0o!:@?A 2h Ho o> E `  "`"`H 0Q!:@?# 2J Ho o> E" H 0;!:@?  24 > E  ?- #Ho o> J"!H 0!:@>  Ho o> D"@Ej"H 0     `  ``\ ("  `X8 `@ "8 @"" h ?` @@ ''` ' '` '& ` @W`   `X < @?  @9 Y 2ذ `T@{.  @ @ !   @ @`     @p T @O   @[ @` `&T'` '`N@ =`?'؀`Բ`'Ѐ  ("$ , X$ ,  ' $ , : @Z U> Ja` ' "` X " ,@ç ,  :@> 9 H   ,*w yu'  ! n7T A 2  `? ZԀN@ ."` 5 N! @uN! q@ ,@!  @' T* ' ,('耢 1$ , @'T* 'ܰ$ 0 0@`2 'ܒ@Iא U' ,̐$ , ,j܀%$ 0 ,耢 A:@:@ @ :` @  H $$ ,䀢  ( '$ , "`@`@@ǏЀq o?@$ 0䀢 > Ja` "` Ѐ  ,$ (") 0@¶ @ܔ 0 @ `X@ –@ `@0= / ,@   '@0-  @‹@А&@ `X@ @ @}  @ڒ &`@@ 㿐  `@L, `?@ @O '` H @ & '㿘>+!> J 9 @G<> J> J"a" 㿘> B!> J!> J6` @ a* @ "  @2 @2  `@ > J0 2  㿘> J a3`  > J a* @@> B`!` 2@` 2@ `2``2"`&& " 4 @1    2   " "㿘 >6 !    D >"P@D$  @' x @  㿘 >6!    D >"p@(ǐ@ " @Y$  @4 :&  㿐  '  6`x6``@     `.  :􀦠< H 26  @`x!6`x @2 `x @6`x  2 `x 6`x  2 `x 6`x  2 `x 6`x  @2 `x 6`x  * @&`|  * @&` `x&`!m6`x&`| @+㿐'􀦠 `@   `*  : 􀦠' H 2! `` =@  @  @`p  ```d&`p&`t @`h  `p`t&`h&`l  `p@ `p`t&`h&`l&``&`d @㿘 gl '    &`&@H đ*` * " * " `  @@* @, : $ @@ d@@? * @,`,`* :`* $ @?"?, * * "@*`@*`" 0*  ``d ,:`*`" *  * $&@&`   * ( Д  㿐 ?/  /  /  / ߒ / ے  //~   ( *  (` (rlrhrrxrrxrxrxr$rxrxrxrxrxrxrxr0rxrxrxrxrxrxrxrxrxrxrxrxrxrxrxrTsss`sshssssssssssssssssssssssssssssp (@2 x  *   (@*  |  *   (@*    (@2`"`㿘>@l"@5 㿘  `(`$G`0`2 `,6  /,@ ` >"Ȫ ` ! >[#*`   $@ `$@   @F> T"> T "8  >@l"`, `,ʔ   @`(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N >"Ȁ`  >\ (*`   > T"> T "8   ?>@lV"`, `(@2*``,2`@  ` ?`(&``$""@&`$2`$q`$&`$ `  ?&`㿐>`$b[ N !   !`a`  #\ `$ `@`(0`( `( 2@   (  *` (` ( `"`JC  `( x0"`㿘  (  2 "@@`h  @? h  @`` @ h l" `" d  -@ݒ`p.` 2  "@@6`h  @?f h  @*`` @ h l" `" d  @`p`@ h l" p" t` ?&` 㿘@S    ( ` (  `*` ( ` * (?  02?  0?@ * @(@@ `  `㿘 `? @`@&`!\` ` `*   (* "`  ` *  * * : :`` $ `*  (* "`㿘  2,   `  2% ` 2  >c @D 2   2` >c @D  >c0@D  `" =&`㿐 `!`' `!a`@ 2`  *`  *` *`L "\`!X  ` )&` `  "`L@L@2 L`L @2 €` 8 ` (`@`: `` .`+ ``# :` B8 2  + ?@   H``@ Ӱ. @P  2  €   2 ` '>0''ܔ^X6  !` x`!7'' '''ܐ !@J>0` #TIJ` ?'Đ;`$  7>0'6'''Ĕ') `>#@ "&a\@C     1&a\@C  2?"'>1'ܐ$ "?  *    ? * 㿐Lf ;) ;Z  А S, * @ ?Ѐ –.`@*`@ <$    ? ,"@ *"@  " . ; 0 ;   ??? 㿐`\    =. `.c  ;` .F6tXtttt > B!> K>  @waа  >> ##> K@o`h >@i&#08>>#c@Ԕ 0`h'@   ?"@͵@. 0> a""`쀢 2""@"`@ D@͙@ѐ   X p  <`@| @   @ o @&(&&$&&,@ d< "@d[ > c & @ZQ   `@ @@썒! @ِ0; @<@@2  @1  @- ! YŞ Z`@<($@ œ Y `@<$@ Lǟ p@% D0@ 㿀  '`< ''   'o @Ӻ j@҈ > K ha `@  @ V耢   ?@ K0c ?@m ('  7 А'(@? > HcȐ @A  2   " 4 :0 - ''&l '`X>cА@A~  " >cؐ@Av  " >c@An  "  ` 2   @' c @'? * b> ?   9@,Z!d@;R!d$`P a( P* @ *@ *@ $` "Ɛ ` `* * `  *` $aL ` `+  * `@ *@ @ $aP$`ȳ$a`?$`0`%0@V&a&`d` `< &`h&`<&`@$`$`$` " l %  ?aL`* ` @` O4 H $aXl l ?&l`0 "`0@!'l  $@` $aT $aTaT #!`W "` ` `*  *` * $aL  `*`  * *` $a`$aP0 %0$ @    @ @ܐ   耢   @?`@,Ӓ 9&a㿘@R($`D  (`,$`<$`0$`T@B*8$`@@@7 J>`HcȐ @@_  B > c 5? * b ,( (@9   8@9 *"@"@ !W<  @&&&.6&&&&.&@T6 `0 $`0@b 㿘6` @ a   ?" @= @ @,N 9`<*@$`<$a㿘!!(!T `?@I -㿘! D @ &`&` &`&` &`&`&` `Tf Z `b Z!La^ p&`8  㿐 `` &` x  &@H & F㿘 @ 㿈! &  > J# @t  & :@* @9 > 4 @(y "`$$$  @u "!2F'6@ @ F>#@`!  @ F> @e0ْ , ?@N  @߰@> H@e0 H @ @ " @v >  `@e@  F$  @̯$ 6@$\@^     @̥0 H    *`  * *` $T  *`  **`  $X  $\"`<T & "'  *  : '쀢 " @ ʔ "x@x< @>6!X2`  `-" <>_#*` @@ -0.> J"" 8@m > a $ " b" 8@̕@?$ 'X:  @ TL@`@ "`@ &  2@ "`\"`㿘!@`  `0`4&&   L``4@LL `@, `2- ` 2) `$2% `,2! `?2 `2 <`"  < >d(      㿘  `x` /  @`|`   `$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X: < `X .  < 2*   @($      $?'''''''''''@d耢 А$ < @*  $ <$ @`$ `X :< H <$ 㾈   , 6  @ 0  %  @@   @%@8 X @;`b   2 `; { ;  > #X > #X(* 5 ?;`#\#`@?.@ #*  +` x" `` "   X*@@ +`?#\#`x@Q?@-&@@%@8 H@:@   X:    `0 "`0@L   2j㿘 0"z@"       @@   㿘``* `  ? 6`#0`@* &#@#D`#H 4"@&#@?#H`?&#D&#H @:e#0 2>#8 㿘"" N" =`?  " !!? 2!@< ""!  # ! 2%.!   # ". "   ?  6"#(!>#  "  #(>#" 㿈`#P`  `  @'p'`  ,a,`,b,a,`$c0 $cD` 2 / @'\ $cD$cH $c@`bb `?,bc(8  b  4b ,bL!  ,b % 2 !TL! 2!T ,b   !``?#\! `b ,b!T 2c(c(b c(?`c c,8^c(  !T  ,bʐ & `` @'Œ cH'"@`" "c8@c8>`` c@@'"㿐    !T " V ? ?2@*@  @N  +  H   (`@ :  $@ @&A a  ` @'o @d 0@a`  `@" $` "@"  "@8@'O 㿘  @p @ȏ 㿘  @f @ȅ 㿘   @# 4㿘    ` @# 4㿘` \<? >@_  T P@2* T   T@ " T 0$ 4($ 0H /d * % @H 00,?2 T H@4 <$ @ T?2 H /d * % @H 0  >8` $ DH8*` @ 㿘>@`А  㿘  @#u 4 >d0( T     % $ "     㿘` `* @?2 "! @ "8! !0@ @ @@ @`㿘`&a`&a ` &a``  &a`&a$` 2a` a`H  `@ g >@^! @<a``@ >o@C``>o*`" ``&`* "`$ a$ a $ @ca $ $ $ ``@*`@#``* "@` &`*`" ` $ a$ a $ @Ea` $ $ $ ``@*`@``>o* "` &`*"@ ` @ "`` a "`"`"`"` "`@ǒ㿘`&a`&a `c  2 * &a``  &a`&a$``@ >o@͐``>o*`" ``&`* "`$ a$ a $ @a  $ $ $ ``@*`@``* "@` &`*`" ` $ a$ a $ @a`  $ $ $ a> `c\a *  " ``@ >o@``>o*`" ``&`*"   " " " " " " @F㿘`&a`&a ` &a``  &a`&a$``@*`@R``>o* "@` &`*`"  `` $ a$ a $ @pa  $ $ $ a'> `X`a *  " X``@ >o@!``>o*`" ``&`*"   " " " " " " X `a *  , &a@ݒ8㿘@5 2!@ $!< @SF2  @2  2  2    2  ,  ӄF2+  @2$  >1* 8>1  2  2    2   , * 㿘\   @& *@  &   @&"@@2   '@`'@  `'@)>  #X'" `8 G@ "! @* @M >o* "@  & *`"  $ `$ $ @o$ @$ $ @"A @* @+ >o* "@  & *`"  "$ `$ $ @J$  @* @  >o* "@  & *`"  $ `$ $ @-$ @$ $ #X@ @ @8 @  @ >o@ߐ >o*`"  `& *"  $" " " " @" " 'x  #\#`@#d#h#l @߿ 2`   D '''''@ؐ   <  `@@ ~ X < x `@@u! 2j`x  4 2``   w S  ,  @"  2D`= 'l 2'h .`* 2  'p " 'p#\plh  l@ p   @ "@&$&pl 'p`@Ƞ @` @@# p@M'x`  ` 3'/   6 2 a`H " ,`@  >@[! ,  @!a А?&a&a /, >1  2*#a >12   >1# &a4 . 0`?'>ᰐ @  (   >1# ,  : " >1#,  ` @ ``2,. 0, 8 ,  ??'''䀣 ) >j +  ``\ a#\`Ϛ쀢 @  a&a? &a &a&a&a&a, ͗, ? O> #\a@*@ 'O   @ $  @  d$&a@&aD$ *$ ,$ $$ &a8&a@&a$ @" @a@@" @5` Pa@aD`'g a8J  @! @! @`0T` "  `   2 >@Zv!  $ € `` "`@` & '` ''`  '> #X'`  ''''`  ''''@a<''' @@! @!    㿘,,   @ Aa : ,.. $.  @   @ % a   `@2 `@4`  `0 .2  * `@!< @!9 㿐` 4 a(?`? *a` &>b@8+  2( `  @8  @ L  2` ,  @ J@ 2`*@ @*L      J@ "` "` L %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` , ` ``@,`!@޴ @  ",`a( ">@YO"@ )a0 a(  &a(2` >6"d"`" (2 `, ?"`,`0?"`0`, "`@=`0` "` ?" a(  &a(@?   ?@:@7$  ? @/$@7$ ?@& $a(  > @$   >@X"8a0 b`@Z $&` @7 2"`a(  &a(`@@: @ 7 a(&a, a&a(`h2`a" d0 a-" " 4a(   &a( ?&a(a0@  ``@@ `  4@   @  ?  @ ?@/`㿘  >@X" , >>>"b@Xz `, " &  ?@* , " *  @ @В ?& 㿘  :    " @s   `  & @ ? && 㿐`,> #\` 2( ` 2$  "`  @}  2` A`c  ` #`` #\@  `@ 0 㿀` .> #X` c*&` #`  * #\` ?@͚? 2&  #`#\@ ` #d`` ` #h@b#l 2`2`   ` @  8  @4 @ 㿐`> cX`A`#*&```   * #``#\ ?@?  㿘<&a>&a> #\ 4 * &a ``@*```>o* "c` &`*"@ @ aa a" " "`a"`"`"` "`"```@*``` * "` &`*"@ a @ "`a a" "`"`"`"` "` 㿀> K"> B@B/"!@z>@Xؐ#8>@XՐ#@@F@[@@@@@z@T@1@"@@pU> S`$``"` "$` > L $a > S@ $`8@`8"`<"$`<> SD@ # @" D" > L" $`D$`@> K l  # l>1"bd  $`,$`>,`1,aa  >c<`p@@=>c`@@8> J#$`@%" `>1"@`'> J@$^ X2`  " 2 &2 $$$> L   " " " ($`$` ((?@; :>+! @ @< @4$!> #X  8+@ 8  P< K8 <`!$> >   @/`>+!  $`$a($` @!ϐ @;N@K@@>0!` !  $ @  2 H /f* '@L @@0H 0@7@(> K $`$@)>4#@0 >1#` @ > a>@V[ <%> a "<  €x x>@VJ $ @$ x @@($ > L > K  "> L"  "` ``> L""``" #"#`#`#`>r`$`$`#\   @ "><>@V 8> H @ ">r>@V  X>"xh @ ">r>@U p>"` @ ">r>@U >"H @ "><>@U >!ఒ @ >@Uې @@癐@*@> M @"`P>! @ '''''@\  `>>@W$!0@W!!80@h> K" d-> X> " c'#`#\Ԗ ?@c?  >@U!X >1"cGc> J#   -/ԀX@ِ s/ِڦ  * " $@  Y@0 $@ P ? ??'''@T蔒 >!@V 2> J>@V!>@UF!㿘> B@dž!㿘> B@S!㿘@P !:@# J@  '''''ܐ@ר ;@Ւ <    @@i , #> L`Ȁ > L> L Ā > L@8 `Ȁ  > L Ė@@Q > L" $`@ @$`Ȱ 2  $`@= @> L Ȥ  ` $ @&j$#?:c Ȕ@%c @7@7`'H /i * * > L`Ԓ`"'`" `'А"@@?''H 0 @a7Ж ̐"?' '?/!''>+!>+!@(" 7``` @( 7`0 `,@5 7`'` ,` '   "? l?' ; /@  #`#\#d#h#l  ( @ע @%$㿘@0a . c   6  `  # (.` 6 `.` @.`6 㿘> L  ̀   >s>#h@ #> L`Ā`"!> L`< 2 `X  ?@H O$` P >4\ |@0 dd@1`> L>"$`$a Ȁ`$> L`< 2 `X  ?@$ +$  P >4\ x@0 dd@  >$`$ Ȓa@S >+" @p >+!>4#> L!>`̔!ؒ (@5 #> L㿘 > > ""@"b> L Ԁ`> L>+!Ѐ ""@'0> L"a㿘> B!`)> L @` >+  >+!@;А 2 @(  >+  >+!@; > L@(ؒ > L Ԁ > L@0> L> L!>+`! "> > L`ؐ "" " > U㌀> U#" "㌘ > L`Д b?" ?/!"` #`> L` "?/!"` #`@< >+ L>  *` < 0 㿘H > L    ""@ H 0  А"@? - (c(c' >+, "@*`" * * >+a?@/  !1#@&n #>+a@/   #㿘  &- (c`(c& >+. "@*`" * * >+a?@/[  !%@&74 >+a@/H   #㿘 , (> L! `& ,`!"!> L Ԁ H /m * . > L!> > L>  "b@5"H 0㿘 , &> L! ߒ& ,`"!> LԀ H /m * . Ԗ > > "b@ "H 0㿘 @#> > B! , b @W.> b? S"b L!`B < > L`` 1"`> L`ܐ ,"`b? <"b > B> Ha > L ؒ`B < > L``  "`  > L В`B < Д "> L`` "`> " > "" d> La  ` $ d> b  "b@6Ӑ㿀>+>+!>+a> L> L'' 'Ԁ`' ' @0$ ܌@T݄ݰh޸TP㿐!>5 > L>!b0#\ 8  @H > L>#\!b8!@  @H > L"" :((6(  6 *  ? * "? @*`2,  㿐`@ 2 0   $ 0 @  0 ,?`$ 0@5 0  @@㿐`@  ` 9 ` 5>+!@ @. 2 0&)  $ 0@@  0 ,?`$ 0@4͐ 0 @>ː@">@PԐ"h@px@ @ q 2 0]  $ 0`` N>v ԓ*`   `  A  (> 0>+!@7@lܰ  22 0@ 0 ,?`$ 0@4| 0ːܐ@)%  &`  @ *@ @ ? *@ * :` ?* :  ` & ؒ 34 ` '  ̒@ 4   `'ؐ~ 2 0  `@' } ߒ~  ?4 '   0T 2  ( <& `wذ &T  ` ("`< "`@ "`D  @ 2!   &`   `v` PT  ` (Ӕ  2 0W W䀒@耢 6 薠 ` ? @ b  @ B ?W "%   h 0 d 0  ",`$,   ,`$,   @@֧CT =  (`}  26 0W W䀒@耢 6 薠 ` ? @ b  @ B ?W      @n @ 2  0`P   0 ,?`$ 0@3O 0㿘 . `"` `0 $`0` #@2 `0`,?`&`0@34`0< "   @ ?*@`  &` `0`,?`&`0@3"`0`> +   +@@"   ?2   3 * +@@"  4$ ` ' H@ @ 㿘.`"  @>`&  * ?2   2*`  * *#  `  * *"  @>@N"@g& 㿘 .` `2`09  $`0"  * @>`$  * ?2   2*`  * *#  `  * *"  @>@N"@2 H/$  H@@ @㿘@ D  8`5@ 2 0"  $ 0   0 ,?`$ 0@2\ 0  a:`@ 2'`E `㿘  @ 2 0"  $ 0T "`  -`   "& @, ( - 0 ,?`$ 0@2# 0㿘  >+ a@8@ @&: <` ! <`  , "@ ?2 ?2,  2  2 *  ?, ?2,   , ?8??O `-   <  , "@ ?2 ?2,   , ?|8?-  * @@6$<`+  ` +@@"  ?2 3 * +@@" @4$ @$$ &   㿘` "( @ o 1 2* .  ' @* "$@"@"&  @˒ '  :`: ` :`: @7 ',` @~,` ' @x :  : * @@"e$ :  : * @"X$@ :  :  $ $@ '@ '$$$$$ @I 㿐   2v{> L>+!@0  @;`&  *?2   2*`  * *#   ` * *" @>@L"@> n& >@Lܐ"x= `"> L @D!@! 8 $ , `" > L@ $@" "@ $ bb $b" "b$   `@* "@$  $ @ "@&@& 0 $ 0 㿘 > L @D!@!!@  @2$` $` @,>`( $ @ >1#^`X ` ``?4`&4`$$@$`$`$`$`$`H$` $` &0& 㿘 > L @D! X  " @ " @  `6 & X &&   @: `c*`@4`,` '@] & &`< :   '  &  &  @K, & ,  '@F & & ,` < < ,  ,   H?  @ "  R 2  `@ ?& H& L& T& P  @` ` #ݒ "`  `@ 㿘  &?* `F4 & @`" `0 "`0$@ @9`&    @ '  :  :  $   @  ' @ '  " @ " L@ L " T@  T "> L@ > L!@EY㿀 ` " ,`, " ,V 2 , (   ??77 @i @ , 0 0@/T& 0^  ? &  0?& 0T 6 0>@KW"` & ,> 0  @-  0 > /*  @2  (   ??77 @,    € `"  "` "@@  `> 0 "> L> 0@K"b> L"bܒ@DՐ!㿀` @ 2R 6 3 -(  ?7  ? 7?А*@2     7 27   2   @̘     @Ę 0? 0 "\ 㿘j   7 2R " y #@2r .`"@ >` @+ *@ ` "    +@  "   ?2   3 * +@@"  @4O& N . .`" >` @+`*@`"   * (   "   ?2   3`* `(@"  @4&  >&  * ?2   2*`  (*"   ( * "  >@J;"@2 &  㿘   @   H `@$ 㿐!>5 > L>"b#\   @A/ > L>#Ȓ @#\bД  @A% > M "`㿘`4 €`4(R`  >4"`8 "`  4(2  2  4 ("  㿘@E  > B' !  @2 ,!"  @F: "   & 4 6 ?Ȓ*  0 & & 6  & $   ( 42  2 㿀<@ ,    &  @  (  `  6 & (# @2  ,   ? .@  $ '77'''@   &  @ 㿐> M  ,  . 2` 2` >4`"> L"@AN @H && " (& H &$ H& `, ?"`,`0?"`0`,  @-`0 㿈`@ p T` "`00j $`0`  ؔ  2X`0&`` B`( ' ' * `Õ* B쀦#    o4 @A ` 04 $ `  `  ``?&` &` *`` `* "  &` &`   &``` @"&`0`,?`$`0@,`0㿘V` `   `  ` 8 >4 Г*` 2  "1`P@, 20  $0  $ @`HK*`L@ G 2V`T @>  : 2V`T @2/ `, @2 `T* @ " 2  2 *T :     2 2V`T @2 `   Q 2-`> L#@@1  2$  $ 4 $ 80,?`$0@+0`$ ,`  $ 0&`&`  @v@   -$ ,` $ 0`$ $Ho o 8` €   (  $ (@ɐH 0` " ` 8`@@3 "` (2`Ho o$ (H 0`  (Ho o  `$ (@H 0P (  B#@!'`' D?@/  H /i * * > L   @ В@ "?'@'?/!@''FH 0` ''   ` 0 ɀ` H/` /` 2"' 6`  #> $`ؐ!@)` H 0 Ҁ? # " `'`"$``@ ` "` $`   "@H 0@0{ (  ?   8` €   ( ?$ (`?$` b    ( ?$ (`?$`H 0 8`@ @nHo o " $  ($ ?$ ($ `?$`` $ `"$``H 0,, d Ho o }`"` $`"@H 0` ,A*%'@   㿘 ( H /f`* '`     @Y   $ H 0㿘 (@E `   :6`>`0&`@ 㿘`  H& ( L,@ @ @ 4`0 "`0 8 @ 4{> L#@?̒$`2  H& L P "?   T,@ @ @  8`@> L#@?$`2  P * T> L"@?& ( 㿘   ?& @)   ?& @Y6 @ 㿘  8` € "   (  & (@  2 8㿘 @`@ @S@ 2 8㿘 .``L@㿘 8 `P 2   @  @ʖ`P$`T `P2  %`T`H  ! (!  @ }, `H`L*`H$* @@l*``L "$`H@  $`H$`L `L* @@&&@& (㿘 8  LP2  T* @@2@2@@"@ ( " 8@> 8  > L 4`0 "`0 4> L#@>ْ㿘 H/` / ( " & >>>"b8@D#w & "" ( & ( "H 0  㿘 H/` / ( 2  >>>"b`@D#` "` "  "@ ( ?& (?"H 0 x`(D$($$@I &a <``  @@a 24 X <  "a` 32`@@ܒ @ 2z4a  I 2q @@ɬ  2j4 @.#\#` ` #d` #h#l@Β 2J)>1` #" &` @  >1" ,` €  2a(a(  8#`@ >1 >a$@8 a @@  a   $   먐` @m4@ j 04@ f @㽀> J, $,>1# @6@>1",`  @8"#`@>1@!> J''h# ? '''l@ '#h''''' '''Ȓ>1#d'''ؐ  (9> #,@  2>@C#    J@,@`J@`  @@  ? ` @  ?ؐ ?'` ߰  2  ?  ! ? @?@%@'P   2`  ?  ?" 0 @?@%@'/   !>4 ` ?`  H * "@ @ ` ` *  @ "  ?Ѐ@' 'А @>>  cX% `` 2 % % `` 2 % `` 2 % % Ȁ  >@C#@$ !̲    2 >@B# $ € `Ȣ`@` oĀ ^''>`$"  M=c  Gw@F @8 'S?,:c 4:@ @@, `$,$ H@&$,    @ ,*@$, , "l,@u f,! $,@."@ ($"` $ "`'쀢 A'쀤`  6耢 耢>@BQ#@r@䀢 Œ@y䀢  `H "`H 2 >62` "d"`"`(`, ?"`,`0?"`0`, "`@&`0``$, >$,@ "`@ "`, (#,H /i * * @+i$$$$ *@" " @"`"`H 0#,@!@ <  @7"# ,€ 2f (@ΐ B,(@:  ? @ $,*@U$,=؀  ?'ɐ @@ #,@@ ?,*@7$,@ | @˜>耢 "@Ғ @ϒ  @ʖ> #,@@’ ?@˒ @Ȓ?,*@$, 㿈`` ''2  2V !4,  *`* ` '&@'  .Ė쀢 7  @ ?' '  ? &`   쀢  ?  '   㿈`4`0" `8 -!>  @v?@v&`8> #X%><8 c H@ `8* '#`#\ @ "`0>@B: - h @ * 8@@ !> #X   В  * &!$@v`8 `8@  a* #`!$#\ @p > @B 8 㿘@@*` 㿘 4 'H> p>`@@` , "> S?> S @8"` , &!<& ,  H@$g& ,?&! @)&  ` 2!   @>!  `2"! ` "&`` `|2``x  @ @c` ` " &`@3 ` "&`@X&`&`! @  b . 1 8`" < <"`< < 8"@ ` "`   "> S &  "` "&  T`> K@$ d` d`L@K`,( 7&`,@ 2> KJ H6!8 !<!<`@  !<@``H & hC  ,@> K H ,  > K d H@`T 2 ,@#ΐ ,@@  ( (@ H  @R @# H ,@@@#@? > B@"a@& 㿘> S & 8 8"`<"& <@# 㿘> S`>`   @!> S 8`" < <"`< < 8"@@( ,     H@ , 1@#t H> S@> S㿐@ 2`!   &@`?" T    ,2 L@" ` 4  !   2y L`B ( "q L L 12L 1 ( 2h LL 1 E  4&``  !8'! 2o` `"  X!< H 2e X " `@  $ X@[ ( B ,@  @@#J  ` $ `@ 8 & `4!8 !<@n H @[08 2 L , 2 L( " L 4$ ,&``  !8*  '͐ 2w , 2` 2&>!  @!" "a T  H > Kd@2 L " ( L P P P L `T" L`T L P"`T`T" P" H㿘!<> S@8s"`@ ؐ `"  "`   "@ L`" P P"`P P L"@  @ ? `?  "` @ 0> R @8N! "> R@> R#@8D>4`?"`㿐#`#\    @7 㿐#`#\    @+ 㿐@` @ @ "  $@ ` `@   `@2@` 2#`#\   @ 㿐>+!'>4  \ ` 2> >@>  #@ D  :   p  >< t><@ 3? #><!8@ > R #@6 > M #> M ``@Qc $@k` > M  $, 1`$ ($ 4> S $  "` "$ $ $> S> S 4 @*` $ 8  8"`< 4 * "@ 4 * @$ < X@ϒ !!Q (>c< p@&ڔ> c@&Ք $ , $  , " ,% ,! , @ $ ,> R @5!Ȓ$  -   "` @ "@ $ @ ؐ $ $ $  ` "$ @ $ ` "`!      ,  , $ ," @ , $ , @ $ @ @ @"`D& @ @$ D@$ H , $ , T $ L T L"`P& T T$ P$ T `$ `@ @$ $   &  , @ߐ   >@  <>@ 6 `$!(>#`#\#\@i > M`` "`   @(" > M "   @"  "   @ "> M  "    @"H /m * . > L    "  "4!:, 1@H 0 > ?cX& ` "`` "` ` "` 4  " 4  ,Ȑ  @ؘ  , > 4 %%㿘@ 2 @  2 > S `" `4"  a  2` `2`4 㿈#`> K'T'X#\" "  @ ,"& ,!@=T2& 㿘  > B!`4> @=a> B!. 㿘  @G  2>@<#!@: $ $ $>4  "@" 㿘#>4 `" " @ @c ` 203d211|5$5؝㿘@ 'p?& & 6 & & &P  2 㿘 ?4  @@  'p  `>@;ː! `> >@;!H *@& `  &   !@!@2`>@;!x`>#P*`  +   @  2 M @  `&    *` @Փ:` & 逎 e  & 0`  &  >  >@;m!  *`:` & 6  ?* & & 0 @  ?& 0; >  >@;K! ?&   @2'   4#   2   &    `&    *` @q:` &   M *@&    & &   " >@;!   @  @٠ >@:"  6 0р  @ʠ   " 02 M @  `&    *` @:` & 逎   & 02 M   @ `&    *` @:` & 倎  *@&    & &   "q >@:!   @>> "(@:P ?6    * & ?& 0   > ?& 0@:g"h J@M0F >@:Y" @9   5 1 @    &    *` :`@ 5 24 M @     & &  6 0>"@:  @" 0@2  2  2   *@& @ 㿘 > @;a"   @> #V @;U  `>@;O#8㿈h` ` `5 3 `@0 . ba) ' d$ "  @@0@  @  @@@   @  , "@> Q*`!h@H /f * '  *   2^-> XX* @% `@ *  X>4: `L,@ @4 2> M>@9k#H 0 !X> M&: \* @2@X*` ?#@$2>@9N#(m"%   @7o"" 7o@2`"@# "`  "%  % * 2` >4!:` >>">#`#d#c:c@:~f&>#H C#>4`  &>͔   @K  > B!`" 2 &`` @9 `` > B! `  ?>#`>>#Pcc#\ @:6%?"    6 7o"" 7o  7o"@ 2#\ *&H 0㿘> M!X > Q!` > >4!.` >#@8cX & > Ma\: * R@@*" > Q* ah  * H /f * ' cX A>4h#`b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HP#*`  cX>4!.` > @8'* cX`>4 @~M* H 0067o"@   2  > P@9m>@8 h  4   7o""@`@ 7o6  2"" & "H 0>4`> & > `8: 4&"`㿐'>4> #X#> M!> QaXݠ!`%><> 8b#\  @|H>4"` 8@~#*`> M"a\`` \  " `"- `` -0`߰ ->4 > M"#> M`@    `> *@9`   ?.@> M؀(( "  @ 4> Q> QG"HE"4> Q> Q@">" $!4> Q> Q6#(4#`4> Q> Q/#-#Ѐ4 04> R> R  @4> R> R x  @4> R> R   ! 4> R> R!X! 8''@ 8\#>4c P>4'> TX   N %>4. @  @=@ ``  @ $c  . @c> @> Ȑ @8k    c*? X>4#J@ 2  _*@ >4X ؔ >4#@> XX((6*   . ,  @) ' @"!"" !$($    @(0㿘> B!`?  @H /d * %  `0  &`0>А  @ `0 `0 &`0H 0&`D&`4&`,&`p `@,  &`0`*2 @ &`T`&`<@&`H`<6@>@6 ؀$>@6   $, 2`H@xǐ`H  @xM `0&`4(&`0-@i@H /d * %   @- `0">`0 &`0H 0@`H@x'?$`0("`<`4 " `<`@@@>@5! $`>@5!@ @"  $`$@`;`` B# ?` '`@ ` s`&k@H /d * % `0?# @&`0 @"0 `0 @`0*@&`0@dH 0㿘> ` @-"L@  t!P#!& 㿘 \ @ڐ 0 @"> `>@5T!`"L@/ <@4" <㿐> S" > S" > S" > S!>+!`" `:`> S ) @!> S"`:> R ) @~!> S"cD:> R )@r > R"b!>5 > R>#\#a!@  @,- > S>#\"`a H  @,# > S>!|a#\ P  @, > S> a#\   @, > R>"a 0   @,#\> R>#\!Ța   @+ 㿘> R#> Rb @* @@! 2   +" 6>@4!Ȁ`""`"@   )  > @4! )  "" $""" > B2 H ᜀ2 4 > S> S @( "   4  8 2 4 > R> S @D( "     2  㿘 "! >@4P!! `  `>@4G" O@  4>@4?"P > Se  @,O > R @,H" $$ $ $ !      ,> Ba ?& ,  $` >@4"x!  $` @ "@$`$`> R> S#D@*  $@ " #D@* @"@$`$`"% @Y ! @U  @` D"`D D @"! ` 2&! @# &! ` & @` @"`D`$`& D 㿘 @` D"`D D @"! ` 2&! @ &!  㿘  `"`x""`x`"  "` "@ @? "@> R @-k"> S @-g㿘 H! @` ` 2 T` &`? &`@% T ! @" L` 2 L 1?  ` "`? "`@  L 2! 㿘  N 1 2 @`@Ԓ @ђ  @ 0 2N 1 4 " H4 "!  "㿘@`4@"  2!     `     &㿘@`4@"  " !   `         4&   "  " , ""    "  "㿘@`  R &R @:`   .  2& 㿘!  4  " I " 4 W  4 &㿘` @A  4"a  "5  2a . !  ` 2( `,@"a ! a    2`4`4 " ! `  @   㿘`@`   @ 2 / @" @" `@ @Ԓa: `@ @ʒa: 2 @"$ Y?V $ $ @ݰ $" `,!$`,㿘`@`2  @"  @ @a:  @ $" `,!$`,㿘`@`   @ 2 & @" @" `@ @ra: `@ @ha: 2$ $ @ $" `,!$`,㿘`@`2  @"  @ @Ea:  @c $" `,!$`,㿘`a:@2 2@  @K&``m,  22 `, !$`,R` `(@ :    *   ` @2@㿘> S @)}!|@w P &㿘@? "@> S@+!|㿘  ޔ P &㿘ՠє P &㿘`  &`!  ` @㿘 !:   !   @` ?"  ,2  &  㿘@  )  "`M "'`I   j 2:N!9 )` ! s . )  * )N!& @ 2N! ) > S  &`> S  )  `@2 N!&  2  ) )?&  㿘@    "`R "-`N   A`@D; ` !  1`  -``@. @ `"` > S  &`> S `  `@2  `@`  2 `` 㿘    `  4 &?Na6 .a !:  .a@" 㿈`  @@㿘`( `& .`  @ 4   @ 4  2   @(   !:z " x` ``  `"`@t & `>4` `` >4 #P #X>+!>+!: ? 4 >2  (>@4  ` @`>`2,  @! 4   @ >> "@"  >"@"  > #\8   @ @Ř  << 㿘@  *  `E  㿘H o4+@n   ȑH 0 @D@B 2 > L%%&&&& Ԁ4`>+!, @,`b2*@ *@ b 2`* @ *`B2*@ 8*@ { Д @ u@&Д @@ $6`.  .`@c3`+ +` b 2**@C3`+ +`&  @ R Д @ L@%А @ @)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@ ) Д @ #@&А @ Җ@&㿘@ `   M `  H` H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿐!> #x > S>5`#\>#Hb   @%u  $#x> S @&l#H  $ $ 㿘`? "`> S@(#Hgggh`h`h`h`h`h`gh`h`h`h`ggh`ggh`h`ggh`h`h`h`h`h`h`gg\ddd\d\\dddddddddddddd@ A ?2 ,!  9 ,2>p*`@(  "$ @ 0`@  @"    "  @   㿐>5`> T>#\ ,bВ!4  @$͘ 㿘> T @%Ð , $?!4 $!0 $"`$ $0 0㿘 $!0 @& $㿘 $a0? "a0> T& $@'I ,㿈@   $` ` `2`Y ` F,` '@ $ $  *@ 2$  2  $  "   $  `  @$ 2  , " ,  $  ,@"   $   2   $  `* $   2`   "@   $( H*`"2 ( "?`  ," , 4" , 2 ,2 , ,(" , ( "@  ( "  ( " ( " >4`2! 8 `" ! "!! !8 "!! "!H >4`*`  `(!"!``>4㿘!   $! * 8 >4*&!#`  " ! &! & $@ ! 2! $a $a$a$a ,*@& ,`P "$`P " H "`  "` "` ? "("?"H    "㿘 $?!b! $!$!@ &!>ؐ!( @L > 㿈 $! 2`!  $! ``!͔ +@ '  "  !  ! ?$!$! #@ !!`$!^   㿘`` , @+ 2`!  2` ` @      @㿘 $ > S L4 $,"2n `@24/ " !  2 (  !4 $@,"2@E  ` 1? @@24  㿘 I)  B  >   "  "   2 @@ @ 倦0|    "  "   @e㿘  n @ 㿘    , @F @ 㿐 ,  $* /!",$(!2($( .``< "`< ' !! &!`!* &!>4#` " $!&!$$(@㿘 ( ,>@*z"@ 侒@ >4#`.`  , h* ! !  !   N!  .! !      *@& 씊 *@&  쀣`  & 쀣 kN 1 gHo oN 1  $> BF! , O(K `"1 쀢?`2>! A 6!8*  H& `,   @02 ,h/` & `` * & "!  l  . 1" l * & 쀢 `@ Y0 >   "c0! 2 2.! @H 0㿘!  ,*@ * e  ?*  !*@ $  ,("! , ((26 $4!8H /m * .  ,@@" H>@)" @r@ H 0 ,("!!8 "!? !*@ 2! * $  $.  >4#`  = F  4`>#@*˔!+ ,(2!!   2 H2! H4!8`,  ʒ @(H /m* .@ r H 0n!2l!  2h! ,(2d!>@*#0_! $ 㿘 ,*   H. 1@ & ,㿐> B!  $>@)#@ ?*  8 # . a$ @a( @W0B>!@(#HHo oa  ?a#a`! #!a !  #!>4#` "#@!#!#@H 0 `< "`<a$"#a(' `  㿘 4> @(cX 4>#p@)' 㿘 ,!:  6!:>4& ,c`.`@  $@ "a$ "`㾈, a: ,!>4# ܰ />  ȒX ` *   @: @ ˰  D $`8$` >$`c@) '''''ܐ#@Д! 0P@ <  T?@*@2 @  ?h @ǐ@:(4:c!@(@\d@' @ $X'a$' a('$'(` *', Ė+'0 `+ + @E'4 H -( ('((  К 0 #\;`#h#l @D .`> ȑ* 0"#`(` * 4 #\#d#h#l @n  #`#\#d#h#l   @ @c @F "㿘  N㿘@ &&  & ` >"*` & &  > Bᜄ 2 " 4"    42  2 @*@   "  @ 㿘  >@'G#  `> B!`>@';#U Q` `?&?&8  "'@ "@ +  2@@ "@0# 2@@U @&@`@"$`$@@"B &>` 2㿘` 2`>@&ܐ#``4@>@&Ր#  2` &`&@  "    6 *  `?$ $```B >`&`㿘 >@&# 4< , $, < 췑,     @?*``@&?&㿘  젔  2&  `&  && " $  &" $ & $㿘 2 2@>@&\ ``"`& `@"@ 㿘`  @  2 0` "`&  " @ `퉒  2㿘  @  2&  & >5 & &""`"㿘>5@@2@`2>@% 0 ">5@ "` @"@J 㿘Ho o #>5`  €  `2 0 `€ `2 H 0<XtT8P@$@@8Tp,,\Phd@@@l0< 0D|㿘> T>#8!$ j > T>"!$ b > T>#X!$ Z X`    '`a: z` u @*Ȱ nȒ?`  > P*` >`  8 >#L>*#> "(>6 ">4 >f#|J -`   A` > T#8  ! 4`@gD    0%````#\`` @g5> T#8   ` ` 㿈`\   ' , 1 3 7? ?`:> x*` > `> hÐa> p> @>+x!>+q!>+j!> L7"> _4#> a1!/> _)!d!> T"'@Ș R P"`?6   `4 B  >$"> T"8@1! 3 0> T.""> T!@!! #  > T"#x!> T#|'@$#|W > L @| @͖ @Θ@> B"a     >6 d>6 h>6"\> D_"p>4#e ` [ V > ^  a@~  G> ^  a@" n   #\_> L > aD> Mธ @H @M?>+!>5 >4 @0 @!)!>4 @  耢``2 $  2 $ > #X* @$   >5 @x -㿘`\k ?` e>!d*` > :0> 4K E> >  c`* <> X >  " 1* > -#X @ />5 >@ @x  > ]#>5* `#@!+  > ]#Ȓ@+ -㿘  @     `&@\  M 㿘'P` @     `&@P9 㿘  @     `&@   㿐''` @     `&@ 㿐@#\㿐 #\@㿘\@E `  @@  `,  `% ` "&@@   ?*?@@@*&@  /㿘@   @     &@㿘  @ ` `&@o `㿘` @   ` &@N㿘@  > L"ܰ ` *`" *  (&@`!> L"&@"3  "&&@   `7  8   8&&@   ` `2n   > Sf > S J "G``->!*` `4 "@a   @`, "1`a   "+` l @`   @`  @`,"2`h@,!@ a@" cЦ0``2N`1 > S   $@ &  #& 㿘&@! ``  &`K  ` @F PN 1  1 8  &a(&a0&a4&a8aP@ &b,   &  , @cM@g&a( aP&a0 Ĕ &a4 &a8  &b, ?&  H "&b0 4&b0!  &b4!  6b8 , ?` `?`l&b<`x " #&b@`|&bD&b<` @ &b\!   2 `&b\ `bH>  @ `.bO`6bT&bP6bX6bVb`@ .b  @b.b    P>bX` `(    ߰ - ڰ  1? ԰ ,b@Ͱ @ɰ  9>   "#X =  ?c?'''''''' @c   n  e &?#X*  ,``*` 'l&~  v   ?''''''''ܬ @ch a "T#X  '#X "  ?''''''' @cM F L " `@:L 2` +~N ,@@&'',~<   & '``@   '~" @} 敒 㿘+> Tb  S )> ]# _#> ]c    (@m  '>5  q %>5 "> ]j > ]#Ȓ *"  * $#$$  c * )$ > (`> @   0@"@ 8: @: H: P"  T"$ X"( \", `"0 d"4 ܢ`8 >5 *?$%# !> ]#  >5  0 "  8: @: H: P"  T"$ X"( \", `"0 d"4 8b Ɣ  hhthh㿘#> c|>aD@!> #>a@@@.㿘> B!" H /m4* . "  "H 0  > >+> B"c0! @"Ⱂ@㿘> > L L`Ԁ* > L Ѐ > S>>> `Ȗ@6  a 1 ?` $   $ >5 T h 2 `I$ hH /m * . d h  d d* *  @ۑ* @$ h `$ d1@Ӓ($ `@  ! `1> B!" ! L 1 2 !  , 2` ! 2 @" ! @` ! @B,! 0 ! ,! H 0  2 1@> T@ʐ#>+!@ 㿘>  L*  *  `& ``&  @( "& ` ? & & `@㿘> B!aHo o>+! > > ^ > #DH 0 H 0  >L 1 >  >@!>  #> T#$ ,! $ l$ @ @ "@ ""$ p@`"  ,  ` $ ,(!@    l  @ʐ , 1 2     , 1`@ @y"`@ ! > T*#H 0 , d$ , {  $ ,) #`@ p` 2 $ 쀢`"   ,(!@ N "   $?! *  ? 㿘H/` / l N 1 @ ,@i ,$& ,H 0㿘> B!` >! @F>@ڐ!XHo o>+! > > ^ > #DH 0 H 000 >L 1 >  >@!h: #> T#,! $ l$ $ @ @ "@  "#   , 1$`@ @"`@ ! > T*#H 0H l8> T㈄ 2 `""`" lH 㿘Ho o> > T c#@7 > 1? >@L!p l2($ l"@`$`L 1 2@ ( ,` , , 1` $ @ > B> "c0"> K@"`@ 2 H 0㿘?㿘> B! ! ,! H /m * . @P  @`@." @H 0㿘> B !>@!x ! ,! H /m * . @,  D`@ " DH 0㿐> B!>5 >a@ @'> K " "@  А"@ А"??/!`$$<` (2   #bX      bX  @4  bX  @bX`B <bX$  " L 2 ,@f> ?$X`z"@⸁ > B*ᰒ" 㿘Ho oN 1`*`>  >@9! ,( !8  * @&  , `. 1@uH 0 ( ,A , & > K"0 > T! #@ > B> "c0"J! ( ` @8 *! > T > B> 0""㿘 ` $ @8& `! 1! .! 㿐 >! > T" > L`  0  >"@ "@! 0OH /i * * > L   "'`"@`'А"@@''#  #`> LК"?@ " # ?/!`"# > K⸘@ "⸔ # ?/!`"# H 0@ 㿈@  @"*`" * `*''y5 㿈 !: @  `y   #@''\㿐@   `  >+!'@ʐ"'`x p@x  #@'Р'@N  ` H /i * * > L   ''H 0 9 $ > >#H! , ?"  #" ` PH /i * * > L   ''ܑH 0 "@'ܒ" `'А"@@''"@'"'А"@''Ѐ ''Ԑ*`" * `*''xl  㿐@   @>@xZ   ``>+!xP 㿈 !: 2'@ x9  ` x0  @ "`r  ` >+a"a" 㿐 !: W@x   O>5*"@ *`" *  *  >+!*` * !@j @췒|. & H /i * * > U#> U"#"cH 0 ` !В"@@씐'"@@>'`wŔ   㿈@ O H  *  0   ya> L +` &'0''"`'" `'А"@@' ' * @`y0 H 0`wl 㿈@ 8q ` wW  2g`  &`  Z V@ 2Q @ J H /i4@* *@ +  @> L > L    В@ "?@''?/!@''. $ @[ x 0 @x@ *  x H 0 㿘퍒    & E& H /i * *   b? &   & ?/!& & > L `` 0`Ґ $ @ H 00H 00}x8   Є?  >+ &"  6  "@ @" "   "  "  " " "  `" Є@@" "   H(> L#h#lH h #` l #dЄ@#`#d`@d` h2   2 h l""  #H(> L#h#lH h #` l #dЄ@#`#d` ` h l##  "@ @   @4"@#> ]  > U*` `c > ]  " " " 㿘Ho o ``>@"X6> L>@"x @ `&  & @  "` "@& > ]# &&  "@"  H 0 H       "  "  H> L > U㐕(  > ]   ` ` " "` 2I> ]8  > ]   ` ` " "` 80> ]8   > ]   ` ` " "` 8> ]0(  > ]   ` ` " "`> ]@ 㿘Ho o> ]##@ #"`"@> L"@@4@4:` `> U*`#> W g #42`:` > Y g#> [*`#@@#@   ;` `> U*`#> W g#@3`;` > Y g#> [*`#@@ # 4@;  > U*`#> W g #3 ; > Y g#> [*`#@`"@# 4@;  > U*`#> W g #3 ; > Y g#> [*`#@"` ` H p@ Ho o##@\# H 0 㿘 !: @@> ] > ] > ] > ]#>5 "`"#  㿘   @%>5, >``@"V` >>@"V`@|"2  @ 2 `>`@" , >``"@a   " &   "& F & &  > 㿀''''耦` `   @ > ]#' +'!  * 2  ( $ *`: * @*``  2V  $  2V   2>5 , 耢 " > >`@#@#(㿘` `   @ > ]#3) % * 2  (  $ *`: * @*``  2`@`T@ @ $  2T 2㿀>0Ra'' ''''aV>,* * al  @  2V 6V㿘F @>"  !>5 0ƀ * @{ 㿘  >@l#p  @ 㿘?` .@H  0?.@甒 ` `0?.㿘      `  @` `* @"@V   V `  6 6 > ]c&```&``""`@2 >>#@` > ]#`@  > ]#""2 $V `@2 $V   6 V 2 $  6  $  逢2@㿈@ /`>@l# ه  2>@c#@zV`  && ( & V` V`@&  *`   V`@&   *` 2 0V`& @ :$@ (>@(  sÔ`s & $ *  , @$.`$.` ,   &@>  (> P> X@ , *`@@ sN $ * @  > `@& ,㿘  ?* 2   >@ؐ   @  € - `>h  @  ` >,`$2`>@ ؀`2`$>,!l2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> ]"#  "@@ `@* "@>!@ޒ @` @ 6`@ 2 ``@ *` "``@ @ٵ $`$@ 㿘`  ` `(  -   $`(`€ 2$`(㿘`  ` `(  -  ?$`(`€  2$`(㿘 $ !> ]>@!#"  2>@!P2  )  2">@!p" "# " "@" 㿘%> ]   $`"  $`"  " @ : `2 㿘> ]#` `$`   2`$㿘> ]# ``$```>0 [  o @! - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,?  & ,  `@˒ 㿘@췐 (&>@e!В@&> ]# & "@"  $2>"`$`@ @4 $"6"`$ $ @@:  $@** $2 `TT&# $  $2 $"`$ $2 $"`$ @@ * $2 `TT& $  $2 $ $"`$" $ (   @*`2 㿘 D? 2`  2 ?`a>@)a>!<>ɶ , : > 0!@>">"  <" T>"` >" <> T" : @ `' ` <`(@ `,` !>`8"(@v`8@ `,!>@h"@`,@> ] > ]> ]  ȝ㿘 > ]#Ȁ > ] # "   (@  2 ( 㿘 ! t @ , $ , 㿘 ,   (  z!&  "u  `& 2 >@M"P@d! @a"H /i * * > L  & P & TH 0 &> ]# &  "@" > ]> ]  ""㼁㿘 w  t `"  "`> ]"# "> ]> ]Ȓ ?"㼀 ">@" 0" 0H(> L" X" \H 㿈 0??& 0> (@@"H /i * * > L   ''H 0  X"@' \"@`'А"@@'' `b? d& ` & d?/!& `& d`& X & \ H 8@ >`CB> H> 8 @ 얂B> @0@ 㿘> B!  ӟ 㿘> B!  Ӗ H(  : @: 8: HH(> L" P" TH " `" dH +> c!?@ cĤ @4  `? 4 ` ,`* >@"ȑ,`* "* > ٦#)> B!  >cĐ"@`e! `e@ >cĐ#@! - 2@ >@#H  2@ >`  >@K#h>ؐ > cc> "cc"   c " 㿐!> #  > ]>#̚c#\   @ט  $#㿘> # "  @1   2 㿘@ \`>@# >#Ȓ@>@ `+ >@  `> @w X @㉐& ( 0& $`&   " " '  `" &   q 2&  & && & &  &  &   & b㿘 2 >@3 " `"`"@@  ` "`  "  m 㿘      @ 9"'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@@ @0 '` '` '@" ''`㿘 >@   > @ >@ !:  >! @>@ !`@ * (> @!>!@>@ !@ 2 >@"/      &  !>P ﴘ " @6 # ``(` @ 㿘\ `d>@ B"X2 >@ <"@ *  @ > @">"@>@ $#0&@ >#X@>@ #>@ # : >#@p>@  (@ &@>@d P ?         > @P>@   ` `* X`  S" O*C` `>- ?`@  "@ @   @?      8`  ? g f```"" ~ :`  ` "  M `?`*? ?=, `@  "@ @   @?     ? ` ?  `" `-" * ` `` ` `  &  !>P n "'&@@  #% 㿘  >@ ! @  @@&>!0@ \>@ !h:  @>!0@ N>@ ! 2B @i 2= b 2  2 `""`"@@ B` 2%@   4@ @  ,@ (  $` $` "  $@" "$`   @*@@>!@ >@ !"  "`@X  " ?& e 㿘  ' #`(   & ` ! >P  20  ꀎ` `"  "` !"@H /f  ` * ' `> ]#@T*`H 0  & 㿘 =` %  "` "@ " &  &"`H / * ' > ]@ѐ#̑H 0  "` "@ " &  "`    & 0H / * ' > ]@#̑H 0㿘 2>@ ΐ"> > "  @ /bH    > @ &"p 2 㿘`%`a> ^ "         @߲ a& & > ^> ^"`"> ^ഀ   ഐ > ^> ^  㿘> ^  Ho o   > ^H 0G # >`" ! 쫘 "  H 002 @H 0> ^` ?"`  `$  @&`$ ``     " 8㿘Ho o`> ^     > ^H 0  @g`đH 0 R` > ^> ^>5< "`8"` ^Ȁ2  2 H  <`` " ``@ 㿘> ^ > ^ @'? ? w? > ^ ? ?$?   }@"/ ~@w@;?0=@: v@'?05H/ /> ^` H6!"` "> ^  > ^     > ^" 㿘` 2 @ Ā2 @>@ :" 8@:>@ 3"&  @ 8" & @@``"`& `@ "@ &@" &&"&``@ d @2 4``"``"```"@H/ /> #@ǒH 0 4 ? `& 4 &  `"& ` "@& 㿐\ 2 >5 `     > #X$  $ $ $   kq$  ?`$ $ " ` ( `  ?@  >#@& & &  & & > ^ܒ? & \& H& 4& (& ,& 0& d& `& & & P& @& D& & & & & & & "܀ & L>@#@  & : @:&  @& d ? &    "?@ڒ&@& $ &@@3  & 8>>>#`cp@S!k@#&@k}> c& & & & & & & & & & & & h` 2>5 >cؒ (   `#\> > c#\ L  V >5&`L`& `""`& T  T& X "$ 㿘 T`" P X"`X X"` X T"@@   D`" >@ #Ŕ  ``"  "`>5" P "> `""`㿘 ܀ "& > \@ & ܁㿘> B! `"`D>@ڐ 8`D`H@>`\@ѐ X2!``܀ a`€`D`H@ a "S``` J`J` E>``@ @` 2R `@" `\>@  >@ @t  `d @`H/ /> #H 0   @` 2`D`2```  z$``$```\  鳘`h`D@~` $` 2`@>`\@V Ѐ 2 `\> @ >@K 7"" >`\!  @@` "`$   "@`@`D?`$`@$`D    `Ā 2?>@&!h$`    "$ `8@">`\@!` "`$`  "@$` $ ` "$` ` "$`  "$```@ `( $`@㿘 P`@ D 2  d \>@Q!>@!Ѐ @"`  2 *  l`  `  ``2` 27> \@ǐ!"&@  &` `"``# #  &` ?#   @` D ?& & @& D&  `  ?& `   Đ & ꆐ0` `2C 8  4  0 &  P  " A 0K` "`&  "@# #  "& H /i * * > L  #  # $H 0   ""&   "& ?@` "`&  "  # " & &  # & 㿘B㿘 8@iK@ :@   d @ @H/ /> #* H 0 ` `@ ,@  , `& & ,ʢ , 0@ `& 0 㿘 P` ? $> \@ؐ" d @2$ ` 2 *  l  & P 2 *  l"  P 2 * " l P 2 *  l&  & " & &  &&& &&& &$  Ĕ    & Ė@ & & #@  8 @ & @" " "& 7""   "&  4  @& 4& 㿘 @ (@7 @:   d @ @H/ /> #n H 0 ` 2 `@K  X  @  ( & 㿘` & ( 8@hH 8@ 8& ,& , @ (@㿘`  8@֐h0 8@ 8& 0& 0㿘 D@  & & & H& `&   8@Ḑh 8@ 8& 0& 0㿀 ܀ € ''  @5 H /i * * > L   ''H 0'   2# " ' $" `'А"@@''>5 T &  @ 8 (" T  4 ,@耢` 1 ` "`' "@  d @2 `"  "`  "@Ho o> #/H 0耤 2 㿘 H /f * ' > ` >5 L"`` "`R H 0㿘H &* @  H 0㿘@ *   :  l"  p"  c" `@*  ` \> "X  $ƀ d P>ƀ" (> ," 0ƀ 4 8> @" Dƀ H > #ƀ > #8  ƀ Ā 2` `>ƀ#p``#`` ƀ`$` "@7">#ƀ  2@`>  2 >ƀ#`>ƀ#؀` >ƀ# d >ƀ#/  + > ƀ > , ( 0 4ƀ 8 `">` `ƀ , ` @ >ƀ x $, @`2> 2 㿐 `T  P` @ "` d @`> @>`\` 0` 4 7"@`"`> @`> \ #\@>@3!(  `> @`> \#\!0@    Ц@`2 P "  " " " " $" (" " " " ," 0" 4" 8"`" ` "`㿘 @N` "`$  "㿘 2' , "  0 2$ 2 0 $ 0 @ < ( 6 1  , 8 $ ,$ 8  >>>#`cp@&B ?>>>#`cp@&C* "  2 " >>>#`cp@&F "$ 㿘  2< 8     23&  2 H /f * ' >   H 0 @703 @ L 4 & 4$ $  "  & &  8 & 8 ` `>>>#`cp@6&R*`$  @ " "@ >>>#`cp@'&U  "& 㿘 $"  (€ 㿘  q  @ 8?& 8   >>>#`cp@&B ?>>>#`cp@&C* $   `2 " >>>#`cp@&F  2 $ "&  $"  (€ ƀ  2 8`") 4?& 4` "`&  " "& H /f * ' >  H 0 2 㿘>x 㿘>~ 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' >5 LL  ' H 0   2!     0 0@܉ \   & \`㿘 P@€ 2.` ܀ €@€ H /f * ' @. H p@ 2@ 㿘 P €      `  ?& `ΐ T 2 `Ȑ  ?$ 㿘  T`X"`X& XT"@"T T"X "& ֐  &T  &  㿘6` H /f4 * ' >4>  @G`H p@㿘H / * ' >4@G H 0㿘><> 6`!8 @Ga0㿘><!8@G*X//*t//////*|*/**/+,+4+4+4+4+4+4+4+4+4'/////////+//////////,h/////-T//-/////////(++///+h+//+p/,,l,+/,/-X//-㿘>"8@ 㿘>bp@8 㿘#> ^`'H'L'P'T'X !H !!> !@$`>@S"@j>@M"@㿘>"@D>5 4> >"В㿘'L'P'T'XH/` /@L   @H 0> ^   @ 㿀  <@B >bؔ@1O   >L @4  L   > @+ 㿘'H'L'P'T'XH/ /H   @XH 0> ^   @H  㿘> ^ > "#$`  `> #$ ```@(  ```> c$""c$`- + ) (`> ^ #`> ^ * `  " `"@ &" `  ""` > #$  >5 @㿘> B!'H'L'P'T'X`,  a  ` `   @̘H ,"  ! "  ! 㿘  @? "@> R"㿘'L'P'T'X       @$    @L㿘'L'P'T'X  @L㿘!>5 'H'L'P'T'X$    @nH> ^ 2$ $ 㿘!>5 $   @Y > ^ 2$ $ 㿘'L'P'T'X  @DL.㿘!>5 $   @7> ^ 2$ $ . 㿐'P'T'X`?' @P*@?㿐` ?' @ *@?x  '`'܀'ܮ   ܀ "  .MM % ꀦ`M خ ''?/M`X>ǐ!*` ` ? ? M ? ?L  >b  >bX O>bNO `  ܀ "  .LAL 쀦` @L * :   @ 1` ܀"n  < ,*@ < ,L  ܀ "U .L ` L 4LW`  ܀ "4  >.K >FM 2QM M/K  ?F' 'B  +?/M`*  ?&5?4MЀ   ,* ?ФMЀ &#?"  ,* ?ФMЀ ' @M l2    ?/    ?    @?* : ?:    -`/  ?> :  @ ?" ?2    ?`` 2   @  ? ? ^  ?>b '  S x ?>#  @ "@$/@ϐ    ?00 2   @  ? ? # >#>" ' ?  2   @  ? ?   2 /' ?䀢"N' ", 4` 2, >>4`,  `4 0 - 402 0/- @3 `0- @u  ` `0-, 4`  ` 4  -'#0@? '?`Ь/ /&*``  2   "`  ܀ "  ._<` ` ܀ " .'J$  `  0܀ "  0.6` ܀ "u .'"`  0܀ "^  0."(`  0܀"F  0.2 M܀ "2  .퀦` ="9` ܀   .Ĕ#M`2&㿘` @@`% 2   H /m * . `"` " @"`y"H 0 㿘   @ &@   @ԝ * 2`      $  , & ,>  "c0㿐 , ,* ` @ $&@   @y * 2`@   @` Y   @7Y  P99999G@HDHDHDHDHDHDHDHDHDHDHDHDHDHDHDHDHDHDHDHDGTGhG|GGGHDGHDHDHDGHDHDHDHDGHDHHHDH0W\\\\\\\\\\\\\\\\\\\\X@XYYhYZ\[,\\\[8\\\\[T\[h[\\>,al%   al >+(#P >5>5 ? ༆ #>5R4"R#`$al  $`*` (>,l2 >5 $>5 `>5༄ ༝㿘!>5 İ  >5 Ȁ@2  >Z @@{> PS$  ē,`:` `q$ Ā`Q >5>5>5Ԁ@"> ^8`( "Ё㿘> ^!>``]@1>5 >5`Ԑ !> ^!8@ZS@ В@& Ё>5>5Ԁ > ^8 ( >5" "Ё㿘` >5 " >4 >  >> p0> h0 x㿘. > . @>,*`!l@ >`ݐ V `*`>͐  >V А h0 >̐ 0>Ȑ 0>Đ 㿘>5.  > @ >5 @>5> 0u *> @ >0!@ #@ *`>0!*`>0 >   0Z >  $. > 0Q@>,*`!l@>!>!T? >w!  Tr!(T | T?>T   4>>_!0>Z!@'>+* R ?  T>+#*`  >G!HA@T?`>=!P㿘N -    N 02% N x  X2       ɠ  [ƒ  *`:   Ѐ  ? &@         `K*  Є 8K +`8 ( (* 8І `Ѐ`  K K "  "  " K"!?22 㿘N?  J@    `)>5, :  4-`>+#,: @n@,:  @@Ր "*  :`@ -`: ? &@?㿐 >h!`@a#> _>b!ha8@4 (La8L "  "  " L  > &@C!p >㿘>5 #>5. r>`>/!@yx>)!, :  y Y n N>, :  y Yѐ cސ>,.  * l `      l  " l $ `$ >+,`R ? `R ?,   >ِ!0 X ->+,`R ?"> T>+*`# `WT?>!M   , @O %  >!>`>!ސ0R` >0>!0I!@ 4C>. ̑<>!@x>!, :  y Y n N>, :  y Y'+ c8`!>0& !*`>@!` &?* (`>0&?a* @>R!<:L 㿘>5 7 . @>,!l*`@R` "   "  >4 > 2` 2` >'">#!. 7:  >" >Ӑ d>"(0>5 >0>"80!  >& ?>0a* @>"X0 㿘>5 7 . @>,!l*`@R` "   "  > " >2` 2` ΐ">ʐ!. ޑ:  >" >z e>"0>5 >0>"0!  >& ?>0a* @>"0 㿘>"#>5`n ,@@n@ 4 #>5>#  >#>5`ؑ* @ ?* : `*H*`>͐! >l#B>>g#@=>>b#h8>>]#3>>X#.>>S#)>>N $>>I 8>>D `>>? >>: >>5  >>0!>>+!H>(!`ؑ,@J `؁㿘#>5 $`đ, : U >5>0 a ? ?$`ā㿘#>5  $`Đ#,   >!h>5 ? >+?$`ā㿘/>5ย ->5@ R%Ī >,al@ >+`*#R ?>`  #R. : @/`2@a @$Y.:`e sd >!p >!pb ,`: :`# R?Ǥย`@`$?%ā㿐L?  L     2 LL "  "  " +>5,`:  4->+#,: @F- :  @ӭ "* `:`@ -: ?2L>H!0    >N s04!p㿘/ ?  c >5" >,!l a!>0 !l@ 2R`$`@h 2J`$.: `` `@R  `2:`$@R.: @23`$R  2-`$ .!>0,:` d e c >!p f>!p`$`$ `$/ : `$˓:``$!l  !>0! 6G,>0!/  @  8!.:  3!,:` d">5 e c >5#> f">5>  a@!>5  @!  E@!   * ő: !!:`! >0,:  c>5?"`ā㿐NN    2 NN "  "  " N >R!0  >.`.: \:0B!p㿐?' >#> _7!a8@  (La8L "  "  " L ? 2'L>5 􀢀 *> 1>, al* `@`@\  .`:  a>! ' ? q   f  Q>!p >hА@ȋ $>5 ->5  >А"0,.:  >,>ǐ" 0#al    al @Ν  al`@ " al  $ al >"P0>"p a\̀?* @>,!l*`@ $S>"77ڒ iF̀?: aG.D: -`A: ?^̀̑.* $>,!lS $̴?%>,*` * l S $>,` 6>0>, .R   2 `>,>0a 6>0!.R   2 a>0l %`%? l`@ `@b 2R ``R 4 $l l>,al $? al@ 2 $`@8 2 $R`  2 $R`4 $al al>,al % al@ͨ 2 $`@ 2 $R`  2 $R` 2`2`  $al al * : 㿐N  N "  " NN    2 >5ء-`J ?@^2 `@ǔ "`ؠJ `NN "  "  " ?  M Z >S"U >5*`  ?* : `*F*`>͐! N >:"<  >>52" N >(#* 5  >W`` `>>5" ># N i   >Wo cN &6 h dڰ  Ѱ ܖ >WK dN >#@   ? e r   >W" eN >#( S  * ő:   f>W fFWx ܰ 0tN W>O 0m$ qR?0hN \ 0aА^ N  ;>N .!>+$!  *`:   2 NN "  " N   !"  t!>+!!  >+!!>#` !p >5,>`?c ",>#>#  ># 㿘S>#>#> ^ @Ē ( >I ">>#    N - 㿐@  " `  `0 "`0`#\`@  pВ '?'''' ' ذ  耢 ?  #' '\"0,?`&00㿐@ ɒ " `  `0 "`0`#\`@  8  / $    @  '''''NŒ /`'   '  `    耢 ?  #2$ $\"` 0,?`&0ә0㿐@ T " `  `0 "`0`#\`@  p '''''''쀧 '!  ذ 耢 ?  #   '\"0,?`&0E0㿐@  " `  `0 "`0`#\`@  8/   $  O  G   '''''M 5`'   '  `$    耢 ?  #  m $\"`? 0,?`&0Ȑ0 @    2`0b b> ` @ ?* ` @  * #X,2  ð  0 $ 0   Ĕ x `Mu 2 0 @æ   `$@ b|"9@"{"YT k b}b~2d @ 't    ?4    b~tc@ 't  @  ?4    b}tO'tT    ( "`<  "`@  ?"`D   2! 5  't   `vt) 2  (  <!$@ `w@ $@  2  0`Lߔ 0 ,?`$ 0 0`J 㾰@ 82 - - @,  @-  ','0''' '(8@ݒ Xx'(','0?' ` (L 2,` ,L 2,` 0L~ 2},` 4Lt  2s,ؐ m H /i * * > L   @ В@ "?'@'?/!@''H 0, ,%> _d @(%,@k 28, 24,` P $+,Ho o,`@d H 0,%,> _>!`!| H 0 ",,? ?%,  #" (``" `K 2``K 2` ` K 2(8@ Q 㿘`  2 *   6< 4* )@-, 2 04  $ 0 >5!X-     4`*  `-  & 0 ,?`$ 0Ц 0O` " ?@Ѭ  &ʑ4  @'  㿘@ 4 "&@ " &@ l> _!`@2&@` 6`㿘 3  > _ad  "ad> _6 d!` "&Ho ol> _!`@2 ,J1  0Ր 0 @ ?",H 0㿘 @ @`76` 2 0 .6` $ 0  >5!p,V`@@>5 ad @  @ `` @  6`>5 0 ,?`$ 0 0" IJ`&p>+ a` `  ,   @J˔ @ `2`@  >#@* "**%@ *"@ *`@ *`?Ѐ h H /i * * > L А  @ В@ "?'Ѐ@'?/!@''ԑH 0, ,/> _d @$,J 23,ж $+,Ho o,`@d H 0,$,> _>!`!ͼ H 0 ",,? ?$,  #" @J: 2@ 㿈!> _ !l b@o ]@j G 2 >52 a|" "`(& 2.2 2 " " (&$`@$ @`, ?"`,`0?"`0`, "`0`, ?"`,`0?"`0`,  `0 h @ `@㿘><!8@1 & >ސ >   "㿘&  4& & && & D& @@|& H 8  4& 0& (& ,& $@ے #& <㿘(  $ D> !    D!" D !$ D x H M$ H  $ $ " $$ $ > T  ?$ DtM D ~b$ D |$ Di $ # D> $ D(! ̼ 2B H D$ D> ! ̯   D!" D !$ D 2* H" D" D  " @ 8 @ 8    "  D ~b$ D |$ D 2 H@{ $ H?  $ H D  ?$ D  !T@8   D  ?$ D " ! D @ ?$ D~  D   <#@   A 㿘 ( @   D "Q  ##> _ah 4   8  2    > c><" "c!8 @/ ah@$ `$ $ $$ $ah  2& H D$ D> !    D!" D !$ D  D ~b$ D |$ D͆ H $ H" @$ `u@ t D!$ D> ! ˘   D!" D !$ D 2 H "@@(  D ~b$ D |$ DM~@ "@ @4   2, D@    " >B 0$ 2 D   $ $@"$ >. `  $>% x D ~b$ D |$ D 2A H6 D  ?$ D  3 # D @ ?$ D~  D   <#@   " DA  D> $ D! 8 2 H D 2   " H D "I   H?  $ H D  ?$ D̻   D  ?$ D̮    " 2@zt ,  D @ ?$ D   D   <#@     }@  ( ~@ @ 0@ @ 0D D    << "㿘 (`  @``"# D3  /  +  D '0"$  D 2   " !  D @& D 2  "  D    D @$ D 㿘`(@; `6`  &`@   @  C B?@_>`0>`8 $&` (*`" *  * &` ,&`  0*`" *  * &`$ 4&`( 8*`" *  * &`,` &` ` &`㿘 (@ $ (㿘 e D @ ?& DT  D   <#@   " H  H˳ D> & D     H  @ "   D @ ?$ D'  D   <#@ ’  " D  D`˅$ D$ @   (> > _ah?"ah> c><" "c!8 @- > _!lI`4(R`  @2 >5"`8 "` " >5 "`8"`   4(R `@ ` "`22  2  4(@" D2  " D`  2     4(@`" `D" @  2 "    ` "   㿐>5`> _>#\!l` L   㿘 (   @"% 㿘 (   @ j 㿘c  (J "7cE2I  "~ ""}2=  ##26  ! >3 E    x" ` x = 3 3 3 x1  L # < # @ $# D <  "  2  " i r   @^   ` @   @㿘 (H /``* !`  ``"I H0[" 0X L \@   V 2  8 CH 0G  |"@  "@@ 4  @         8  H 0# t   6   @ H 0 _ l x 6 xH 0 㿘 (@ `06` `  @ 㿘 (  @D$ (㿘H /e * & `p &`l &`p`@ `p =&`pH 0 㿘> c$""c$@  & x | ` 6 @? "@> R |9"& p& | 㿘`l *`q@`(" `H /e4* &@ @ ~H 0a > _#`DB:#` &`D> _#`$B:#`&`$> _# ?`B :# 7` @ . 22X @"  `x2` @2+`p" `!@ ! "!@!  ( 퀌@`@"`p@<`p @h 2?h2`@*@&`p!d=` 2  `` @ ^ @`p@ `p &`p ` `! @`*@&`@ @ ܒ``( "`@ `&`6 2  ` 2 `@ @   `x 2   `@q @ `x  `p) 2 " `p2 `n> ّ*` * " &`p*  €| d 0w 2i`  2X`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` "`p@`@ *`p2/  +`V``@` `"`p@Ґ`@ ` `p@ ` @ ``"6`@3`6``p>*@&`p 2C  ?d= b`@ `@  ?"`p@ ޒ@?  )> Ȓ @@ ͒@?   ` Ȑ @ @@+`p 2  d" @ X`p 2` d` `x @2v`p@ r`p``( # V``H 6d`p @w_`p@> [`p`@ Sa @ @ aK`p   2`ހd  6`@N`(@ w `p`ޒ`*`:  6``6``p@*@&`p /@5V`ܐ@ / 2`p `"`pV`ܐ" 8  $ `p @?  `p! 2`   ` `p* &`&`p@~㿘` 2 > _# `d``B ;# &`d`H@l ٰ? <  9 `5 `ܔ   "$ H /e * & >`H@!Ȅ> _c&`d > B;c&`dH 0`܀6`?  2?  > _# `d``B ;#  &`d @`H " 6`~  6`܀ 2`` 2 `` ? ` 2?0@`@"-`?`> *`   ' ! ^ ( ) \? "`> _c \`dB:c &`d@ Β`H =` @ > _V`܀ "2?> _# `d``B ;# &`d@ `H  >  ?`V`> *` 4 6`` " 6`  ?6`ܰ?0 `@: `{@  ]`z@/`^@, D  r g@"%! `@`e@ `@0`@ . !    є > T>5c!@ } ! |   ,` x ` !  ! "  @4`o@Z`^@ ` @`@?0͐`a@m`n@?0`s@"H "@_`@װ?0`w@ h@Ѱ?0 `b@" ~@   ] r@}@"?0`@e`@?0  g@w `e@n`v@U?0 `@y`@ {?0БH /e4* &  p p ?$pH 0^ H /e * & @x&H 0H H /e * & p$$pH 02 ` ` @ɐ) 3!> #$  " > p ( (> >!ؒ @ '''''@CB  @eh` !@e@gT @I $#$> c$""c$ @4 " 0A , h&A ڰ !  |@2  , 2 x !: ɰ x " #H /e * & p ;$pH 0 H /e4* &#@  @   H 00 @2@&  : Ѐ€ " pH 00sp2   2 $ࠐ ߐ"$p@d$$$($(  |   j @o  @"( ऒ ! @ ` $@;(@  @f @b@^ *@$$ऀh$ ( 7&  @  $ऐ@F H 0 >5# l  h  H / * & >5"8*`  €.€  h*` €H 00,hH 0Ȱ H /e4p* &p  @  * $p$@H 0  @   @   >5!  |@  , >5 h"8*`  € H /e4p* &p n> ّ*` * " $p*  €H 0_ !  `Y ` | "| O |`" ! @? "@> R|ا"!  @ "@!  $|! $x!  "  , 0' ,[!  |(  , $`2`     $x@` @   ?Dx Д  ?  㿘2  *@ *`> ْ"@ *` @H /e`* &` `"V 0@   @ p  ̒ 0 H  H 0   H 0 㿘6  * * > ِ" c* `@@V`? ?2  >5"`&`8>5"(`&`8&`> ّ*` * " * @ <H /e4* &   "`2`` "`H 0 㿘 >> ّ*` * " * @ <H /e * & @_$ H 0 `p@2    4    㿘 >> ّ*` * " * @ <H /e4* &   "`2`` "`H 0 㿘 >> ّ*` * " * @ < H& R 䀢@   㿘>5 >a@z  @" @ !  (    " 㿘 H /e+ * &$ @ H 2 p p - p2   @$ ̀  & p>5 H!@  H  p  2   @ ̀`H 0㿘 @ 㿘H /e`* &`  (`" @a ( `" p@[  p>*@& p6 @6 @A`>  n*  p* " ~& p* € H`@9 H H8 H 0㿘>5!ؒ =P 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @@ H 2  p`@@3& p @@ Ԁ €   p @& p㿘 >i!H /e * &  p @ & pH 0㿘 ̀`@ 㿘`D 06 㿘 p"` @` & pސ4 21  n> ّ*` * " & p*  €   & p  @2  | "   "   & p@` 㿘`" p p & p ` & p  @2  | "   "\ ܒ   x>5 >a@y     p@ *& & p  B!     H /e4* &@ H 0  | +,' x#       > T>5c!@?  H /ea* &a; >+!>j @    &1 p0x   )q   M >`W V [ U " p0O ( L ( p   @    H 0  H 0 # >5">5!!@Ø H 0"  2 #  #p ,#m) H 0G 2  d$2  x ݔ `<> T>5c!@ 2 2 a' !  a     d  @- 6 H /e4 * &   @H 0Ð 㿘>5  >b@w  p @% $" "  @ H 2  p & p @@ Ԁ €  p ?& p㿘V H /e`* &` > B!   H`Ȁ@$@"`> B! 쀢"  pH 0 >+a & p> H 7  HH 0 0` V   H /e4 p* & p*   @%  H 0  >5H 0 # !@ H 0݀`H 0> B!  | 2`, "` x @| 2{` 2v` 2r`  r   > T>5c!@K c  @2&` HbN d` 8  逤0? >Ȑ@˖ ?6 x 6? H  @: H60" H@6 > _$ ܚ@  d< C 6 8@& d $  @ H4 ` 2 4 `A&` H?H /e4 H* & H  H 00" pH 0` &` #>5 & p H!@ H 0`2`0 㿐` h  *@`{&`V`ހ &`ސ> > Ȱ  ?f> * @} w`` @"s`ސ@t n`ޑ*`:  @|0fH /e * & `p`@   V`ܤ``&`p&`6`ܐ@P @@ ` `p* *&`&`pH 0V``ܠ$  6`ܠ ?,%`ސ ? `>" ٨`ހ` `p 2 &`p \i@d``@_`ސ?6`ށ㿘`U R  O`㿐 @A@ H /e * &  (@ؒ @*@  @ǒ @@  p*@& pH 0 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^ޒ  @ ?֒㿘  p   x |  ג @2``@2@?㿘 @ 2`@: !4! & 6 6  (  h* h 4(  4@# 3* @*`@*`6 㿈3 >  L#>* , , $4 bH d@ d@ؕ | 2 x> bX`2`>bx  >b؁{6 ސ@z 2 @ L1>4"`   >">"ؒ b cЦ"? '?/!`''!>) "@#A '?/!`''!>"@{#*h>*` * " *  * $ d@h2 L1  1   @ 6 ށ W  1   `1?@ "G 3 ```*7 0`4  ?@ "( # `"`4` ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 heܐH 0 㿘 g "V , : @ ?> _( ( > _ 㿘&> _#( &  "@" > _> "a! 㿘> _c? "c>#`"  "`> _"#, "㿘  >!@!$ @C $ @? ( H$@; 㿘@[ @Y (@W H >㿘`   > _   -0   -0> _ # #> _#> _# f ?㿘 > & @`:   > & @ &  & & && &  㿘  " @z   >  " &  ,:`@l`  >& & ?H4(#    "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 5& " @@ &@&  &  4  & & H 0$@ H4(6`2     `- * a  #   8("8 `0    `H H4(@"'"`$     4   ""@ ""`4 "" H 㿘H /e * & @`@`2` ` 2&`>՛#0$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**/+@` `8@ + "@8*  "  ( @ ( (+@   @ * +@ @ *   +@ +@  &+@㿘`U H /e * & @>`5` 2/&>#H$  ."& " " 44  "  @@ &&@& & `@& H 0  > > > ㌀`   `@"  @" "  "@  8("8" > †   "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &   H 00+@  `@ؒ3@ 3< 38 H 00H 00B@?㿘,      `@W<?@W@Y) 0 㿘``,  a    `@W?@Wא@Y  0 㿘``,  a    `@W?@Wɐ@X 0 㿘`,a     a@q @  a    #`, @W?㿘 , !     @W? 㿘> L >6 >:" `>9"` "`# ` "```:` "`` 4* ``2`> `` > _ "` > _`  #0#> " > `c> `" >`# ٔ!> #>ctҔԒ ђ > L" "2  :  R  4 *R   > L ") "   2   : R  R 2  4R2  42 4 " 4 *R  㿘`> L)  "% *`2 *8     P2404*P *㿘> L   @: `  `4@*`  2 㿘> L >+  @: `( "  `4@*`(  2 >+!2`@  :`㿘> L >+  @: `$ "  `4@*`$  2 >+!@` 㿈'>+><!8#\ * @? > `%> _4"a>#\c!  ǹ >5#@#> `#\`$>cȘ  (Ǭ !>!Аȗ ȓ >5#< <w>+!I>+!E㿘> `> 6`! @`㿘> `!@ؒ㿘H /f4> L* '> L    @: `, "  `4@*`,  2 H 0> Bb` "`㿘@/㿘@g㿘@#   @ 0 㿘H /f * ' T > Bb*`@ ?2@   @   "# 8@  <"`< < 8"`8> ` $ɳ $  ( $ 0 , 7 4 $ 0 ?4 > _#4ɝH 0㿘 MH /f * ' V > Bb*`@ ?2@   @ʒ   "# 8@  <"`< < 8"`8> ` $e $  ( $ 0 ,  4 & 0 ?6 > _#4OH 0 㿘T @w 2  `#V @6   0  $  ?4  $& `&  " ?@& & 㿘@  㿘@ 㿐` `>#В4 `  2 `$@` 2 >##@:'@ $ #V @4   / $ @X沐" $$  "$ $   "8$   S '  $@$  $/ H /f * '    @4  8$ <$ 8& 8 8" ΐ 0  2lV 沐">΀   > `a   "a  > `a  "a 㿘`> Hg`> `a&@` 2 >X x@:2 >N " .& 쀦 㿘 2`  2& ! ` @@ *` &. `  @ & 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘  ` ! `` ` ^`  &@QV @  K$`  `#V @4`` .3  &  ?6 `$$```  ?$@*`> _#0* 8 `` $ . ` &@$`  " &  & Q`ـ `$@ E> `a  "a㿘`f  h ( h` h T`  $&@GV @0  A@ ` ;$`  `#V @ 4`` -  &  ?6  ` 8``  - ` &@$`  " &  & `〦 `$@ א!> `a  "a`&  (""@`2 "` 㿘X `U`"@`"q ` @8@`"j ` 24@"6``8 `$" ?ܐ?" 6  "   "@ & @`""`4@7  @{  2 " & "   "`  & ` " &`   @@ 2@"@ @ 2@@ "@&@㿘$@ }  @8 v " 2T@t (#V @6  ,Ő & @t  $"& & $  % `& Ɣ G&$B   2T ;@   " ?@&   "%   6 H /f * '    @6  8& <& 8$ 8 8" `  8$   $ $   $@ , $@&@㿘 & ` `> 8>R `` $ @ 0 $ @ϔ   @ɔ  2 㿘`> 0 `> *(&@` 2 > @:2 >!" @ & 뀦  㿘H /f * ' > _#4  !H 0  6 H /f * ' > Bb.``@  2@ H 0  & && 6 㿘H /f * ' > _#4  !H 0 #6 H /f * ' > Bb.``@  2@ H 0  $ & 6 && & & 㿘H /f * ' > ` $` !‰& $H 0 $ (  & 6 & 0& (& ,& <& 8㿘 >P!0Ӱ`  &@`  (   "     ( 2  8` `"   "` #@  & $& &    @@ `1` 8`"   $ 0  @ "  ?&`````    c & l"6T```8 ``$" ?ܐ?" `T4T`2T""` "`  `*5  "& 3        l 2$    *  "&     $ Q $&2&㿘&` T     I  쀦     ! `  cV 6   ) & @q $&  㿘` `0 o " 2 2  㿘_ o "@"   @ "  2 㿘㿘`   `2   2  㿘      )V 0 㿘˒ ``     2 "@& "@$ @` "  @㿐> `>!aX#\ Ȕ   㿘> B!֒ "Z +  2VT +O )H /` * ! > `!o @i $  $ $  $ $4`  2` 4 ` $ `   $ `` $ `@`$ $  @ 2  H 0&@  `@b4 H 0㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " ` H 00 `` 4`>6 d@>6>6 d>6 h@&4`4H 0 㿘>5 >a`@d       @ 5  @  |@> `!c㿘H /` * !     @  @X  2 @  @N   5  # 2 @͐ 2   "   !!"   >+!!>6*uV  x 6! "     `   @ `"  " >6!h6 zH 0㿘>5 >a@d`  `   @ 㿘H /`4 * !   >! ?(6   2  5 `  @ H 0㿘  , -H /`4 * !      2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐> B  !'H`  'P  P :   U ```   2`  `4 "`4  *`*@  |0& H 0Y 5 8H 0O H 0G H 0?  5 H /`4 * !  Ϥ  8 Ԁ 2 |  $2 | 92 | 9H 0 H ° ' | "  "@@ 4  `'     @  (   (H 0 @ =D< )@ '$ ! ! # ? 5 ?5  @p |H 0 PR H 0P$ P n qoP     $$w  쀤 4&`#   (P > ` & @4  $h4( $4 $P 2 6  " ?@$ߔ$ %@P `  G"` ```P` 2``  5 H /` * !  `   P@HH 0`   ?5  'P  PW ? 5 ?5  P   㿈 'H''X'`'&@ 2'X` @ ? !2``* z  ` @  @  G~`2yu2& $"  x    @  x `  @J L  6 x H /` * !  ``2n ` L@ :i ` \@ `@"c ` P8_ ` 2[ ` 2W `2  8 L " 8>2!  2H ``  6 8 ` 2= ` x "7  "1 2V ` 2   " 9 a 倊a #` x ? 6 x ?6 x x@Đ LH 0"{ xڰ `"  >>>!a̔" V `>Ґ" 'H   x H"@  L T" & L& T H0"@& TH "& `K&H /f * ' V> Bb*`@ ?2@    "#8@ <"`<<8"`8> `$K $($0,4&0 ?6> _& `#44H 0~ `     'n  L T" & L& T  0"@& T `" '  2'@'& `K&H /f * ' V> Bb*`@ ?2@  8  "#8@ <"`<<8"`8> `$Ӑ $($0,W4&0 ?6> _& `#4H 0 ` ' V }`!`2V& `" & h>>>!a0¹"V`'`!2a"2b   `  >>>!a0#& `& d& h  * 2  ( >ž"H ?6  H "8 "8!"@쀢 "@H 0,'H /` * ! 쀢`%& "` 2``" L  T" & L& T 0"@& T%& `L%H /f * ' V> Bb*`@ ?2@  I  "#8@ <"`<<8"`8> `$ $($0,h4&0 ?6> _& `#4͒H 0 ` ` >>>!a0#G&& h& `& d& h@  % "@&&  L"& L H `2 @"  & H  @P6 @N`J`@0" 0  ,@ L " ` x ? 6 x ?6 x xH 0 2     " 8 V     ѐ `  ```2#@Ɛ L`22  & `& d& h "& h "     @ @2쀢``   x ? 6 x ?6 x xH 0 x쀢 2X`" x@"@ x ? 6 x ?6 x xH 0㿘`  ``@`2      @ h L ,  @ 4 ,@ʐ0 4 ,H /f * ' @ , ? 4 , ?4 , ,Ȓ 0!h@ 0  4 ,$ $H 0   `@@㿘?#@'P  "Ϩ * `  @Pʰ¨ *"1`">` 87` *"3`@.` **` *   1`` *4 *Q`" ` 2 ``L#@4 6 `"| ` (x `  _6 *\6 "k ` (g ``$ "   0H &F  L |@^ > L 7@86&  P@80& \"? ` 8`9 >+!+>+#%a@c & !#a@`` 06 6 z `  ` ` @P `ﺐ㿘?#  " * `x@ v  G&` 4 "CV @">V "9V 0X"6V 0U"3V  ".V 0M ")V 0H  ", \    "& P4$  "  07 "`&  "V0- &`  ` "@V `(" V ` #"@ 8"@6 8`"2V zV >+! &` `@$@>+a"l`$ 2 *& 㿘 <  @  DҲ l`4R`(2(  >64>6D"`8 L>6T"`8 |H4 $( $"`" $ ,2 ,H  4(H4`p(`p  "`p2 `p`x2`xH `4( L"`   "  8` 2` 8 "`"`,  " \`0   4(H4`(`  "`2 ``2`H 4(``| `` 4" `   2`8"`82,`   , 0  `&  4(P2" P2@  2 㿘   ;  6 @ڒ @ @; L    6Ӓ 0 6@+ L   @! |㿘  6 `8 6 @ |@ L   㿘  6 h06 @ |@ L   㿘@ >5 >bX@[* T 4T 2*T 0 @ @S > `! 8 @6  6  6  `6  &  66 6 <& < &  &  &  &  @& @ D& D @ P@' `   @  @9o `@ L    6 6 㿘` >"h&` 0  6 0 2  6 2&``&`(``(&`,`"`" `   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6 @? |㿘 ` 6 @6 L   㿘 ,!  @6 , >6R .q 㿘 @4 , ,! >6 a   ,   ,  4 ,㿘}` `, ? 6`, ?6`, "  D < @`$w: 㿘 |@" @ L  \ 2  & \ 2 (&   8&  @* 7㿘`%>6   2* @ * @)2@   .`@&  & &  㿘@ڐ& & 㿘` "&  "@!0 @8㿘  @"  >>>"xbe" @% & 㿘`%`   a&& ` " `0@&   "& " & @` &@`  ?6`` 2`@㿘`6 ` R`  2 ` @`2R``   a&& ` "`0@& &` "& "@` &@`  ?6`` 2`@㿘@  >" "  ` "@  "@@ 4 4C    2@8 $` `t "$$@   a&&   " 0@&  2    a&&   "  0@&   "& " & &  㿘>#   ` `"   "@  "@@ 4 $#+   a&&  "0@&     a&&  " 0@&   "& " & &  㿘 `y ``  " @ 2R R V`@  2C@& ?A =9  8` 0$   "  0$  ?&0VV`@   ``  @ & ` @ &"& && `   a&& ` `0@&  ?6& >62#㿘 , "  >>>"xb(#&@4  2 "  >>>"xbH#+ "  >>>"xbX#, "  >>>"xbp#-  >>>"xbx#.㿘  Y W  " &&   &@  0"@& H /f * ' T > Bb*`@ ?2@   v   "# 8@  <"`< < 8"`8> ` $ $  ( $ 0 ,  4 $ 0 ?4 > _#4H 0`m 2  ># ( "$ $ "W& " &&    0"@& H /f * ' T > Bb*`@ ?2@      "# 8@  <"`< < 8"`8> ` $ $  ( $ 0 , ' 4 $ 0 ?4 > _#4H 0 " &  " "& & $   2 & &  "& 㿘 `"^ `& `  " && ` `0"@& H /f * ' T`> Bb*`@ ?2@ `  ` "#@`8@ `<"`<`<`8"`8> ``$- $``(`$`0`,``4`$`0 ?4`@> _#4H 0 2`   & & 㿘`  (>#"          2      & `$ $$ 㿈 k - 2` 2` >5!"``@y` imb0"`(`, ?"`,`0?"`0`, Ɛ`0&㿐 @@ ``@{    ( 0" 0`, `0㿐 @@ ` (`0?"`0`, `0㿈`  `n   @g@ H /`4(* !(     aT 2 2# 8 #  8 ` p 6!  T 2   8    >6 54 8 8 u4 8  ֐ 2>?#ؒ  k찒  $` 2 4 2$` $`( `("`,`("``"`$`, 6 0J쒄 p& rd  2` 2`>5!"` " (ڐ  `` 8'  `Ӕ    hl\0`, ?"`,`0?"`0`, Đ`0 H 00,?`$00㿐 @@' r`(  !!2``0?"`0`, d %`0` %`@X  2C  2=   !! 0" 0`, {`0ð $0?H /` * !     8  >6p 6!  "   84 8H 0  ?4 `0?"`0`, B`0 ??" x @`` @`` vj h '2  2 >5!"`"(iܰ 2K2 2 " "`('V谒 3` 2 ` L찒 )` ޔ  "`, ?"`,`0?"`0`, "֐`0`, ?"`,`0?"`0`,  ǐ`0 gϐkI'gȐkB'耢 "1쀢 +p`` ``'` @'''''И'@4؁8`}  &䀢$# ( *  | 䀢*g  `@@ '}Ւ h '@N԰ l    ''? '''' ` '  `@  6`"' + @  'Ԛ ( ̰ 耢 ?  #    &@' 0" 0`, `0Ѐ ;p` ה  "`0'`` `'` '`@''''И'@?؁8`  1䀢$. ( *  { `䀢 '* @'@  `' } h ''@{԰    ?' ?''' ` 'u  `@ Ԓ ( ̐    耢 ?  #  S$'`"Ѐ2 ' ''.Ȱ ;Ȁ &#  0`, ̀ !  ` :` &`@`` ?$  ` 2` && 0" 0`, `0Ѐ "7̀ 1㿐 @@ ` (`0?"`0`, ͐`0㿐 @@ ;`(' `  䝐 ``G    7 2`  7 `  `$  ( `` ߐ 0" 0`, `0㿈 @@r'찒 B`  `g  (' (`` 2` `쀢 " 8' M `F  0" 0`, D`0쀢 =㿈谒 ''@"  e_e\㿐 @@  :`  $  (  `  @ ` 8'`` `  0" 0`, ``0`,㿐 @@ʢ H`(  $ `0?"`0`, : 9Ɛ`06 9`  # 㫐  `  @ ` 8'`` `  0" 0`, `0ې㿐 @z@ I `(  @ 0" 0`, 9 -t`05 - `  2   7`  @ ` 2 - ` `J ` C  0" 0`, A`0㊐㿘8% "      2 $ 7 $  0$@ * 㿘aϐ 2R`    &&`0  "`0STT T8TPT|VpTTUhWpXWSSXX8ThXXXXX|㿘> B! `  X -`     B - ``2< `6.`>#  1 8@<-@s* @#    @@C    2  >6& E` \@{ V  2>>    T , |`"  &` T$ , ( L`"  &` L{$ (ڀ |  @ߒ Ѐ V < t> ä 8@   2  9 ``>6 `LD C`     7 @   "   >*  `L 2  `L `,`T`L " " &  `T", (`L " " &  `L"(`  W  @ 5Q  &@V  ? "?`L@&@?&  2 0> `a$  "a 0 &( 4&&&,& &$ 6&  "'&  &   "&   "&  &   X      &  M  & > ِԐ㿐 "V P  8V ">6 ">6 >>6 >6  { 0" 8 w  " 7@ 8& $@C- * "@*`@*`$ 4$ 0㿘  " " @g &  "  @ @6 6  2 :" y > `"  Ix @@x   ` @?? `N `@Ր,  'x'T'P't'|@P 2=` "d@7td@0@@) 0@Ր '`$ 8 !7@6dd`@6t 2`$ &  Ꮦ & @7  P` D`  a '''''K?  (0I* @X D< > &@@6 5`"1 =TV@@, )  $`  2` =  `沔 = $  $  ` $ $ $@@㿘V@V@  )`" V  >""   "   X @㿘 '& R`` 2  $  2 >< P2 $ & ` ?2`# $ 㿘R    㿘4 8   T$ B wc 㿐> B ?2 ,v  `T@'$@@`?2@IbE @& x ,  a@ `? `, @` ?<, ` (π`  @*`" @> `'`?"?"A ?% & v 㿐    ` ?#@2  @ 2 ,`   ?` "@` 8"   $ 0  @ "  ?&``f ݒ   ^ 7 @  ? $  & - ]?#' #@ "   ɔ > ``   "`  "`"     > `` ??"` ` ?"" 1㿘)> `! #> Lb > `%!  "b ?̐*@4  2 b 7> `  > `?Ȑ*4  " `"2  @" T  4  (>6  @2  >`b@Z  2 > `" b> L"ܒ &* t b  ` @2  @2  $@` 0 $ 0  $  2 @R` 2 ?`( "??` @bޒ ?`u &%!㿘 >c,@ 㿘 1 *R 2# ?#@2 2?2  @$@@`? 2R  ` R`  > `  2`2`㿘 > ` 0 & 0 ?& "bp 㿘   > `"  > `    > `", > `  > `",2 8>ِ  8> `bD?"bD 0@2 > #X > `  :@0 0" `"0> `c@" "c@> `cP" "cP ` "`#   "㿐> `>"L `#\ t  > `"   %> ""> `",*"%> > `4T  > `"c8)> 4 @+#8#8@44@X#8 > D!ܒ t@> B"!P,`c!?$ D$ $ H@$ p> #X`> #X~$ 8 8$ 0> #X > `  :@> `#0@  > `##0"@b> `"D> ``""D$ $  "` ""$ > `cHcH $cH" "cH$ 4`@t#8 2:: > `"c4> `"" @ > #X@ :@ !> ` $#<$#<#8` `#<: 4$#<#X`` : #< 4$#<㿘 @+  0"2' 0 & 0@4.> B! `, "`,'@㿘 @ `0"2``0 &`0@4> B! `, "`,``'" @ѐ 2 @ 0"0  "0@3 > B! `, "`,@ ޴@j㿐\#`'P'T#\PT 㿘 0 2 \ \ " \ X "  \ < @" \@PL ``< 2`X` ` `"`p`t "`t "`p 0?  0a $ 0H /d* % @E  \> B! `0 "`0 \`t "`tH 0 0@ $ 0@3w` @@u㿘 0 >  0 & 0H /d * % @H 0> B! `0 "`0> #  F> ٓ*"@  4*`  @0  0 & 0 0b& 0@7㿘 0`& 0@36㿘>5 >`@I  0  0`& 0@㿘>5 >`@H  0  0 & 0@㿘H /d * %  0  0 7& 0 0"@" 8 0 & 0 8$ p 0@; p > `"8`@ 0 " \ 0 ?& 0 \ " 8@t@ 8 > > `"D> ``""D$#X > `  :@> `#0@  > `##0"@b -& 0  0@> `" > #X > `  :@0 0 ` "0> `#@> `@ "#@> `#P> `@ "#P 0 "&  &  "` ""&  & "" 0!> `>",c ",& 0"> ` $",> `L  L> `#@> `c<?"L  H 0 0 @ 0*@& 0Ր㿘 @> `cT> ` c8* @ "  P2  \2 0@ 2 P 㿐 '@)> `#T '> `8* @ @w#T 8* @ > P26 \22H /d * %  0  0  & 0>Ԙ H p@ ˰ 0Z 0@,H 0 2 P >  @  @ &@" $@& & P& TH /d  0`0& 0QH 0Հ * % @H 0 `"`0 "`0z@!㿐 @ 0 "0> `HH "@H"`"H" @㿐> #\@ * @@( 8> Ȁ"& <:A 8 @| 0 "0> `HH "@H"`"H"  8 8$@ 8  H H @ @w" 8& 8`8""`8`8`< 4"`<`8 >    8 Œ  8(<& `"$  'H 0$& <`0 "`0H 0 H 8`H@v̔" 8""`8& 8" <`0 "`0& <㿘& H /d * % > `#P> `b> `J#D> `#@> `c<#> `> B!> a"@> `"H@> `#L>`"#L#L H 0`O 0> `" > ` "",> ",v H 0耢`' 0 $ 0 0 " \>!( @H 0 p " >!H?$ 0$ D$ P$ T$ X$ 4$ @$ <$ d$ `$ l$ h`"  "` "@&㿈> B!> `""H> `#P> `b %> L> `>#Dp  " %> L`?H /d4> `* %> `" ߢ Ȑ 0 $ 0H 0 0@H /dz * %s  0 2 p>!x @ 0@;> `"@    . 0 $ 0H /d * % > #X > ` 8> `  :#0P@  ##0"P$ > `b` $ `""` 0 ?$ 0,> `y> `#P> `c4q> ` "@'"'А"@''耢 \> `H /d * % > `" n> `K#P㿘H /d * %   d  0">H 0 0$ 0  ;$ 00  0(  4 " 㿘>5 >a@E/  0">! 0 p"& 0`> `"4`@ 0@  0@*  \& 0@ 0 @  0  X& 0€4 0 0 0 *@& 0㿘>6 2*@&  > a`D` "` * & T *  ? ?> `#X> a `@* @  2  T@2L 2@ ! 2 2 > a`D`  s"`2 > a`D` D"` 2  T `;&> a`D` "` `  "`   "@$ > a`l`$ `""`H   > a`D`  "` `D "`D `  "`   "@$ > a`l`$ `""` ?'&@ `"  "` > a" p  "@` "` "$ > all $ l "`  "`"ll$  㿘 $>6>! c>+!#> a`d  > a> ` #\@{ @`d $`d l N l ` "` "  "@ ` ` 2"  "@$ `$ `T $ $  T !$ , *O:$ > a`l` $ `""`  T.  > `#X> a`@* @@ $@" "@$ 㿐> a l" l"`!> a>+!> ` XԔ >5$ @`> `>#\#\a @   > ah"h" T> `X> a@(@ h@" @  2 @@:@h"h" T> al`7`"0`X""`*`"``"` `  > a p` ` ` > a@2 `@ "`> all"`l` ` "ll"` 2`x`2>"  A ` "0 +``   @   0> Ba$0``,  "`,  >6 " &`@`  &`&` ?`= @8@' @, ?$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\Y]  ; @3$T8i@d _@,+ V?Q$`4 `` : @*&` @ `*` 8 &` &`` 4' `#`#d#\ @S Z `0$`0$`T@`  > B! `, "`, `0">"8@,K``0" `0?# @$`0@`@,6`"` `<@x`P@&`㿐X L\` d>"PĒ  ; @~~<8@ y   0& T& 00m#\@h 0"a.  +j  $ $$ $  L< $ @& L3    `8`@@ `H@ >r"`0 &`0"  @q`0 5&`0`0` &`0&`T  *`"`$ @ i "Ȓ2  0  & 0& L& Xk +[4㿘`  k `0"\&`T\C`0># @c&`T&`X&`0㿘>5  >b@AI  0(2 4 L& L  H??@$  H@q; 8$ <`$ 8 0$ 4($ 0 8"& 8  ??$  8"6 H>א"$ @q" @q$ & <& Xk! + 0 0 0 *@& 0㿐 P \&`&`&`&` ` " X` 2  X <` ;`  T "` X@@^`L`?P' < `; `$@< @}J  @ `' @a` *`` @*v `  *j + <` @T < 0 (j +@&` < ; @}< @"  T@*  T? K&` T&`&` !&` &`&`?&`&`&`    @  &`&`&` T&` 㿘 X L >"?   2 ` 0͐  `0 *00   `0 2`<?͐`8@ܸ?Đ?/  + hҐ `<$`8>#$$$ `Lc$`0$`X`H @$`0@$`Lg  Ә  0 2 b   $ `8`T:  T@ >`P# T> P#@>u#` 0?a $ 0 0 $ 0H /d * %  \`t "`tH 0 p > `"0`" H@ H@o`<- `8@$`<$`8 8@"$ 8 "  O ``  `0 $`0$`L$`Xi{ +>?"!㿘`` "  *  h) +`  & @&  .` < ?`@  .`" `& 㿘> B!  2 ># @(.! >"& @ؒ  % 0%!(& @ " @  2< <@2 "@ y  @(2  @ >& @@ v 㿘. 㿘  $h   㿘    e  㿘   e P >68 8 `@" "  2    - -㿘 2& !> a   gv*  @vm*`" @2@>6"" @`>> 0>> @ * $  2㿘>6b* @ > a>' `     b* @"  㿘%>6  ,``,`    ,`Ǣ`,` >6a  a** *>8!> a" *!@*"@"㿘@?> a@ >6>6!a"! "a  @?`(PpL0p$h㿘W` Z  "@T @ B&M `` @2`?? DB?4> 289   (  7`/  f 8`< < $ $ 4 $ $ $ $$ (\ 4   0@@,@xg (0g ( 㿐V  $   (aa  @g (  #"% @     @2`lg ( `l>6`!P@ >6!H  @ @2`?*  @2 &  6 @ܐ 6 & & , ( ,& 0 ("$ (>6P ?    ,` 0"`0"( 0 ,"@& g9 (@- 2'  @:  `*`>'  `" "& V   R` @2   (g2~ V R 2f (s  @   @  " `B  & :@Ғ@Z V  R` @ ``"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  "  '&  "f (y   & "  B?:@'i`" "&  `B :@ 㿐  2B'0I; @?`B>' *`  ( "fi04     @ @K $"  ( "fO   B?: ' `B  : @I  㿘@( "  6`6` >@ ?2   ?2    @ b `B >` @?  4&`&`6` 㿐 '  R` 2`   @ 2V  㿘'` ` `@< "  `@4    ? 4 @2 "#   42  2     4   8  & '    @      4 2    ?  4 2i  c 4  @2 "U  @  ? @ 4 2I   C 4    @   424  @  ? ( 4> 2 > @ 4    > ?>  > - 㿘 `@2   ` @2 ``B > '&` `@ ( `@  (` B?> &`  c 8+ 8``B $ ,< $ $ $$ (`B?> &` & 㿘 $`0"`0& (0,"@"     $2,p,$ `$0` ">``2$>V ?"`>P! $>J!0`$ cb $` $`$`  "  "``d $@"$ `@ ? J? / ? "L /"? ""$, $  $ > a x$ `J /2S @Q``dN 0{ $ c  `'`  $  ?'''''''@#Kа   (R`d' M`$ # ?( `\`d $`*@@W$`J /@ @B`$`@/$ @`@ @d`c  $`   @@2  @#D  `$  >`cؒ @@$㿐$`$ ` ` `"$ $`@*@$` `$@!`'J /2$`'J /"`""@$$`<  J 2` 2$ $`  @$`'$` ! `􀢠/`+  @ `  /+ `2#@`$`"`$`X ?$" $J /2` 'J  /" "$$` $`*@$` J 2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @\@O`@ v > a x2@$$@>` "$`!"X$$@  "8`   >!X?@ ?X`< ?'`@!@`@ ;$` ` `X <  $@  `*@$`` ""@$` "@$$` J 2`  $`  @3 2<  €@? 2k`@ΐ$< 2 < "<`!ߐ<` @@  @@"$$` T$``@ > ` @2 @$`@`@? `* X < %"  X < "` `@ @l$2`@`  @!  `   @@@!v @@Z$㿘  @*& `@gJ 2>!p@">!@ "@@ ?>!XQ O  X < J@I @E  < 2  @">i!?  %  X <  `" X < 0@`@`2@Z  @      @@@  @D@א&@㿐>5`#\> a>!  a A > a> > a" "c"> a " "`> a!"!"`> a"!> a`"`" > a@ " 㿘``" `  ` @^ `  㿘  ^  㿘] 㿘> B!>6!``@sb 2`$`2  _!@n!>   ]Ζ   $ $ @ $ <$ $ `> `$` <*  $ <` @nb  /,   Yn &  㿘> #쀢 ">6 ! "  "  $ >!  $ 2  > a 2 @`h 2@ 쀢@2`d 㿐 >  !> c  # * & d`& h`4##?# @ `> a * @쀢 ' '0# `'4#Ɛ & dJ   *J8*` @ ???: H2 " X": " <" @" 8" 4" 0" ," (" $" D" " " " " 2 㿘> B> >+!#> a#ᬔa*` ####đH /d * % a > a!쀢`!> a ` #Ā "H 0 > a !@m a W$a 2 DH 0 >"&U  "  \>" @>"0` `"``" ` \"@ L ?$ LH 0  <  @g >"H@r>"XH /d4 t* % t  >"pH 0 $ @$ $ <$ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> a&@"  + &@$ <@  '@ѐ&@ 㿘<> B` !W @ݒ >` ?> J* a  !   @2< <@2 D `@7 逦      < "  ^  $ " " " $"" @h$@ @h@~& @ @@Β 8& 8& Y$<㿘@@ @! "& @>  z J  D 3` L ". DH /d4 P* % P    \`2  ` `> a "  \`" ` `"``> a"! ` \"@ L ?& LH 0  D` & D@= "  D? & D@ # 㿘 D 2 >`"& D㿘> B !>U# D 2 ?># @">J#8 & D@ 0P H >#H@>9#`H /d4 D* % D  >(" L "  P>"@>" `& L> a > a! < 2& \ & \ \"`` \""& ` \& `""H 0 @ 㿘> B !>#x D 2 ?>#@>ߐ# X& D H >#@>Ґ#ȑH /d4 D* % D  >" L "  P>"@>" `& L> a > a! < 2& \ & \ \"`` \""& ` \& `""H 0 `@Q @`L`P`D2`P`\"```` `> a ```\ "`\> a`\"`` `P"`P㿘 `` `X `d@ 㿘> B!@"2 ` @ 2* "  D H "#  < 2  D @ "` <?  @ > a"& 8    &`㿈>1''b('쀠`  㿘 D  & D @!"!>#& @`@@` ? @  ` ?@!@l @@q  >ː O D? J& D P > H /d4 D* % D  >" L "  P>"@z>" `& L> a > a! < 2& \ & \ \"`` \""& ` \& `""H 0   "> a @2 > 0@B \Œ & > a" & 8 O @ @?c > "& & @ & @y@㿘 D  @  㿘> B!@㿘 @! ">& @P  w~ 0+  X   <? 8[ D "W D@"@  `2"`2 @> X @("6  !   @2 < <@2     @2< <@2 " >֐ h2 @ @ 7# @ @ 7& @ \& &  D `:& < L 6H /d4 P* % P  > x> a쀢 \` `"``" ` \"쀢 & \ \"`` \"`"& `H 0 : ?> J(   2<@2"  㿐@?# *`@`@ * @ٔ @B `@?㿘 @(2 # D   @@   ` @2 < <@2  D  2 X > `<>6!ȓ*` `D>`H `P`@ />a@r`@ >a @r`@ >a(@r `@!>a8@r`@">a@@q`L >aH@q`@(>aX@qO >!hL` >>E!x0B!@㿐`->6!=  2$6 \#\`,-    `% ->6!q= >6 !   2$ r ( -㿐 > a! ` *` * " * Q&@$@&@J +> a@``쀤 @> a ` 0  ('`X >6!쀢 >!``d+   `$ N0'E`쀤> a$@&@     @" `" `  2``< <2`"`  㿘\`  <"z $`0`4 P $`4 < "l$ <`i d  @ 1Y@g`X\ U `\@$d_,`d" \` B d@$ g,  . 4 ` 2 > L ``. @2`` `$€@. 2  7 @"  $`0`4& P $`4 Yޒ 1㿘 `  Yђ 1㿘 ,` >5aT`   (Y $` ,`㿘@" < <& <! H " <!& < 㿘 B '> a     ϖ 2@6 >!2  쀤2  >'!Ȁ`>"!ת 㿘H o@>"> ^ > K  @n"@   >>" 0"0㿘> B! > K" @T  #  > #4+> D*`" *  aܑ* @? 5  0  @`"  0 &aܑH /d * % g 0 $ 0H 0s   ?>"8 aܠ? >"Hߐ' @㿘`  2 -> T"  >6n!İ㿐  -\#\ِ 㿘>5  >bP@.8  t   t L`$ L`s; " t㿘>5 >b`@.   t??& t>Ր"h L`  & Lt t㿘`IH /d * % >  `p .H 0@  H /d4`t* %`t  `p >"H 0@0H 0H /d * % `l ``P  ````P &````p` `0```P &``9 `P &-0 0  &0> r "`lH 00+60 &00 0 &0q΀``l` `p > "H 0 㿘H /d4 p* % p &  0   0 >" 0 $ 0H 0 \`0T0Ҡ`` >H 00ؐ   p  H 0>"0H 0㿘>5 >c@,ߐ `\ >#&`\ <? 8?  &`D l &` l`"`  l& l&` 㿘>5 >c @,  \2 >t#(!P#!@  `"  "`   "@& L`"& \p 2& \ "Lx`"||"`||x"@& \P`2L>L#8 "P`D \`"``"``> a" `\"@"\> aa`\"``""`㿘>5  \>cH@,^   0"@`t`)&`te `"  "`   "@!P#!& 㿘>5  \>c`@,3  !P#!@  `"  "`   "@&  0 2 L L`/ l p 2,@ $ L x` |"`| x | "  p <   >6!>6!2   :    >6!@b_ !@@ & @ "` $@& 㿘  > #p>6! ! @h    $  $  >6 @4"& $" (`" @ 㿘#>6aa $  @g  2 $ 2     $$a     4 $ 2 >6"!  <  㿘H /d4 D* % D  >:" L "  P>">/" `& L> a > a! < 2& \ & \ \"`` \""& ` \& `""H 0 㿘#>6!> a  gU##> `"$a>6@4>6> ؄ H4 L( L  x" | | | | x  L" L> ܓ*` " x  x |܆ " |H 㿘> B!> a"">6> ">6c)> L *  @ #"#"H /d@ * %9  @_  /H 0  @x @>H /d4* %  p  >6 < ">6>h#!o ǐH 0>6a ?"a >6> T># ( o >6㿘H/` /> a" > Tl#@q H 0>6!>62  :   >6!`""! 㿐> a!  /$  "`H> > cВ `" <#c>6!@> #̓22   : :` Ѐ  ##>6!2`@:  ####c c$ 㿘  "X>6!ސ > a ǒ  `< ?`$`< @    " `< @$`< ɐ 㿘 D 2X  @i 0" x`"||"`||x"@L ?"L @"H 㿘 ># ">R># x>6"\   :[ h` Z _ D '''''  S@`@?`@ 2`XG @ < @ @$ < l@  Z֒: "0,  `!4 &`  ) А0 @`@@(  0@  Z: "0  " `!  &`@  / `< ٰ @ p >60!@ec 2$2`x -  q  Q!@`ݒ!>    OĘ    >$ $   <* @ $ <@`] $  $ l` " < < `@$ < <>ߐ# $ <`  ~ @  $ <` `@ 2 <@B$ x <@@"&$` <@ $ < <@*@ $ <$ < <     I "$ $ g0A 24  $> a$`$ 쀢 2`""" @, @ < 2A   D ` /0 " +Rr 㿐 D 7   € "> S> ( `!> a` 2  $  2 `$ ``2`!> a xw$ x~P@ D'''''e . X`l   YO: "`<_0`<@ @ S O    `@㿘 < ?& <M  " <K < 2   @ " @    " <  > a  Q> a `N* "> a쀢@ "` 쀢@"@ ` ]"`  "   > a>B @ `N^Q  㿘%> a @+> a # "`<` 2` ?$`< @@`  @ "``< @$`<`쀤@> a P@ @'''''쓐   X `` `@`㽨@ @'''''y $ X  D  > <* $ D !:XY  a!','(`蝔!L@ @ 0L ( X  D L`0?"`0L`,  m`0 > <* $ D:X!  P)!'t'p`e!``@f?!-> a@@E > a e `5@.@,`D`` " `<@e!`<>* $:W  P!'t'p! a@`E쀤@> a` @( &&60& 㿐`@@  K (`0?"`0`, "l`0`@ ɔ <   `@@M @ $ `    ` €    @ $rP@ D '''''@3 `ɰ &`P !: W? 2@ D'''''@  "  /$  $ 㿘#   <   `@@ В @ 0@/ Т`4;F0  ` @`  @$$`@+ 0'`8 '8$`\ '\'<'d 0   ; 8@ Ғ   ?`\0={  ?4<0 &?"h g0H $`\4 2`4 02 4>6"d"`4(" (  ?7 ? 77   0 @Đ4 @ ;0`@ 4 24`@ @ 4  2`X  <  `<  @  4  ?@ A   @084<50@x 0&4`, ?"`,4`0?"`04`,  k`0 0 !:V1 & D@'''''/ ؐ@\  Xd'h' X$€& `] :U'T ``  @`b̰ \::X Ơ`@2  XՐ 2  FT` h "T'T`< ` -  !@  XdT`<  @ e XT @ w XdT@ ג T @ T@ ֒`  ?T@ y cXT@ 1 [X`T`H "`H\ `2`\ 2 \>6"d"`\`0T."`(  ?7` ? 77`  0T@  T\ @ Ŗఒ  TX7\;80-`@ \ 2T@ r X&\`, ?"`,\`0?"`0\`,  j`0 X7\;T ;`a:U %x@c   2  Ft`  t@ t `K ` !:T 2/0@5  2'ؐ 2   F` ,8 2, X P    <>*@`!'P`a:T o` j @ 't 'P'x'T'|诐P ]` ( `<``$ /`* `  7 '8    2  '' '  2d` @ dtd@   d@ Wvd0d`t@ @ Ktdѐ b Ȑ -P@ @'''''A : <   ` ''''/'ܰ & "`@ @ (  0 @ ` @ Ē@ ԰}  K$@$ 2:`  'P't'x'T'|P -` d@ ̒t`@R ` `K ` $ `8 !7@ dd`t@ xL} P@ `'''''笐 . @2`@ @    D @ IJĒ@   @ jāP@  '''''p (`@ @ QĀא0ig @   @ \  @ VĔ@ 8 @3T  2T L 2I  (`<  B ``? " `  ( 05 2 2   ` B)  `@ ے `` B`@ B < `2``   `<    >P`?@2 ` D $  ` $ @'''''ܰ 2$ ``*`` !``2`@`@b @ uÐ$ $ @ D'x'P't'T'|樐P `@`  !: R 2'`ڔ `@ 'x'P't'T'|惐P `@`  !: Rj 2'`ⵔ `P@ D'''''_ `@ b(@ '''''I ! <  `` `  ?''''''''@ а7`" &@ @'x'P't'T'|P 8`` @ `@9X < & `?a:`Q `@@Ò ?  *``'@0`@ @ G`  (@ڐ`@X < ' `?a:`Q `@@ ?  ``'@|@   0" 0`, f`0`?@- @ @'x'P't'T'|~P !` @`@`X <  馐` /7@:h0`?@6 @@ /  (@O`@l`X <  u` /7@ @ M  0" 0`, fq`0@ @'x'P't'T'|P G` @`@0X < 5 `?2`?"<:P 2>6!Ā <@@ ?Ð*@ <#`7`''@Ր@'P't'x'T'|佐P G` @`@ܔX < 5 `?2`?"<:P 2>6!Ā <@@[ ?Ð*@ <#`7`''@Sꁐ0@@ V  (@n`@X < 6 `?2`?"<:PD 2>6!Ā <@@  ?Ð*@ <#o`7`''@@E  0" 0`, ei`0M`  @2 '''B  D耢??'?2@?'@ @'h'@'d'D'l@ - P @`@`X <  + *" " * *   * *''''@@Ɛ `  @֐ '''  M耢??'?2@?'@@  ;   (@`@`X <  + *" " * *   * *''''@@@@  0" 0`, d`0@ @'x'P't'T'|HP +` @J`@g`<  @Ր @@  e`?@(0@G@ 7 2(&  @`@-`<  @ 22`? @ǐ@   0" 0`, d/`0㿐@@`  (`@`@ @ `0?"`0`, d`0@# `'''''⧐ 2< `,` '''h'l'┐h  @z_x`|<``< `  `<  " "? # @ @pĀ  @@h` @ @ @]Ĕ|@x@2@蹐`J`"E@!詐pF  "F ? @ `'t'x'P'T'|P /` "d@tdy0 t 7` '`$ !* ` 7@dd`@t `P@  '''''Ӑ 2`<   " `@      @  @Ĕ@Y@Ā0笐8`  @@ '` 2`( u''`< "` l' `''''''''`@   ?  @-'' @:  E`耢@#>6b`  Lb`@  )`耢@2`  @ "`  X`< "` ` )'  # (:` c `'"@& 0" 0`, b]`0 $ "`0$@ @'x'P't'T'|P " `@    Lג!:  `D `@(@ H㿘, 2R`    `0  "`0&㿈@ ,̒ "  2R  (`< 2` ?0 "0``#\㿈@ , "  2R  (`< 20  "0```?#\ْ㿈@ , "  2R  (`< 20  "0```?#\)㿈@ ,] "  2R  (`< 20  "0```?#\X,|,t,t,|,|,t,|,|,|0000(040@0L1,1,11111̝8`,`d$b ;  $`(i$`$ L$`( ` 2`-`'7@ ``@^`$ {#`@ǒ`$``@L `ݐ `h$`h }$`$a  D$`( ]`<  T -bP d` !@e D`d< = @? 8 @R 1d"< 2 @ @`@㻐  ?@P @  ` H &Ho㿘 X < " @ <` >J!*`    @ " @    @" @㿘` H?$ H@ߐ娐p`d hl`@P'\ '''?'쀦 '' '@@ذ %  " @ 㿘( @`@@ > <  * @Œ@$ @ C >@@ 㿘 ( `<   2   2  2  `X  <    @`@Ր@>@ @$B>@@ 㿘 (@8@L "K&@&` <?`>J!@*`   ( 0&  *2 @ 2 >`86`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H8`( <?`->J!\*` "@0@@ 8`$ " 3&"z@ T`@ %!@    @T`@  a@    " \ ` "`㿘  (@V 㿘a`@ @! @ @ݔ  "$ @>x  ]n  .@@2 @㿘  (mV 㿘 (@㿐>6" 8"''*` @㿈>6" 8"''''*` @㿀>6# 8#'''''*` @㿀>6#0 8#0'''''*` @㿀>6#\ 8#\'''''*` @㿀>6# 8#'''''*` @㿀>6# 8#'''''*` @㿀>6# 8#'''''*` @㿀>7  8 '''''*` @㿀>7 8 8 8'''''*` @㿀>7 d 8 d'''''*` @㿀>7  8 '''''*` @x>7  8 '''''''*` @؁㿀>7  8 ''''''*` @㿈>7! 8!'''*` @㿈>7!@ 8!@'''*` @㿀>7!l 8!l'''''*` @㿈>7! 8!''''*` @㿈>7! 8!''''*` @x>7" 8"'''''''*` @؁㿀>7"0 8"0'''''*` @㿈>7"` 8"`''''*` @㿀>7" 8"''''''*` @x>7" 8"'''''''*` @؁㿈>7" 8"''''*` @㿈>7# 8#'''*` @㿈>7#< 8#<'''*` @㿈>7#h 8#h'''*` @㿈>7# 8#''''*` @㿈>7# 8#''''*` @㿀>7# 8#''''''*` @㿐>8  8 ''*` @㿈>8 D 8 D''''*` @㿀>8 p 8 p''''''*` @㿈>8  8 '''*` @㿈>8  8 ''''*` @x>8  ' 8*`\''''''' @؁x>8!  8! '''''''*` @؁㿐 \>8aH'aH'8* @@㿐 \>8ap'ap'8* @@    㿘@  " >x#H @   㿘@}  >x{#X 㿘@s   >7  8*` @  㿘  \ " @Z  `0("`0H /d * % Q H 0  㿘 @ *@&   2 @+ >7  # 8*` @㿘@  "       㿘>yv#p  㿘>x#㿘 @! "& @>  ZD  @!  㿘  @ `,@ ` `   "`` @@` 㿘`  @2`,!" `4FT!: `4 2`,> T"? `,@ # CXCXCXBALCXCXCXCXOPOxOxOOO`OlOOx   㿐`X``  `<  <`>P *` >   ` ?2, ` -> T  , * > ْc"* `$@ j  , @? Ӕ  `D + S@N N , * "> ١* c $  @ $@```0.> # * > T" ` ?`  > ٓ,  4"@*`    , "> ْ`4* @`` x   >v# 2 > B!">v 2 <  >  > *` * " *   `0 6  (` '> `# *"> ّ*" `4* ` @`   `h@   `  ` " ``"ٳ' ( 2@J1 N L=@Kɐ*@ > @KE &@ 8   ?'#\#`ɇ ?c " @"@8 HNʓ䀦 "0v: ʋ 㿘    㿈    >v#  2 <> B!"<>v 0  > ː> *` * " *    ` 2 6 > ( c *"> ّ*" `4* ` @`   `h@   `  ` " ``" ( 2@Ia G "F> @J*@ =`@Jv %@@ 8 @  ֘ '?ȟ@%@8HN3@ɜZ쀥"uq @ 㿘  < `  `0>* * > ِ" c* `@    * @ *> ِ" `4* `@ @ > ِ" `4* ` @    @ u1 P㿘 `< 2 `> *` * " *    㿘 >  c `$ @*` * " *  `(   € 㿘 < IH /d4p* %p   0   0 >tސ ` 0 $ 0H 00۠` >x  p  H 0> 0H 0 㿘  p   F> `"0`"> ٟ@> ٓ, "@ 4 *` @  "    "     2" 㿘`  <`/ `U>! ` !   w`!  "   4 @!+4 * @*`> ْ"@*` -```  `  z`  4 @!4 > ٓ* "@4*` t# ``㿘 ?  ` > 2 ` uw  >P(   "      㿐       #\ A  㿘>sܐ P|PXPPPPPPdPLP|PpPPPP|㿘`>S#.`   ..  . . . ( .  $&`  &`& ` 2&`  7&` `&` `"@&` &`LB  `L;  " `"`"` 㿘 4  . 4 @ ’   " >sg!  " @@@ >sZ! "@  2&   "& 㿘. *  9d %> a $#> a@HW$b@@b    b " `㿘?> a2 b  .  > ab* @@2  @H+ `>9 А & @&  㿘?2  . > ab* @H /f4 * '   vH 0@ 㿘?2  > a. b* @  2`  @~ H /f4 * ' ?   $ 2/$ $> L +$ $)$ $ > $> L`?  #H!T  ? #H 00I     )$    6 "   " $  $  $ $ $ H 0 K# H /f   H 0 * '  $ $ $ H 0㿀?2  > a. b* @``2`5  `0 ` h ' @ (`8`  (  /H /` * !   H 0 "" 0" " " 0" " " ,㿘?2  . > abo* @@  5q@ "i@ "`"h@ f@rj@"` "@O s@t@"`8  w@n@>+  ~@" br@" "k@bp@" bu@}@"۰  bm@>+   v@bg@9 0 "l@x0"f@"` H /f * ' ` ``@H 0&` 2    8$` &$`@H /f * ' ;H 00|"z H /f4 `4* ' `4   @ x   ,`4H 00] "[ X ` "U  @0P@L!(>+!@D @$`  < :$` !` @M&` @NS>+a-&`,&`0(&&,`66#6@ $`8 ?$` $` $`<$`D  $`H   $`L`D ($`@ `@&㿘`  (@ 2L H /f * ' & (H 0-@b1,`  6`n #@ H /f * ' & (tH 07˒  7ǒ  㿘N@ .` ` @А ( `> a @    0.@ $@ > a" `"@ ` 7 @IÒ 23@ 8 2 1 2  @ 'H /f4 * ' @   H 0 @`2` 㿘 Л 㿘`2? ?2  @*` > a* @H /4`* '`   `6 "` ` " ` H 0 ? `$ > L "`$!`TH 0 ? 0 (> aR`("  >9ԆX"`8 "` a"(H4 X( X ` " X 2 H  <?0(> ab(" H4`(`  `6` H㿘   ,& , (@ >(!̐@E 2 ,㿘 2 >o!P Ϟ@㿘`! ` @`   ,& , (@F >X#@ 2 ,㿐    @ 4   ? $& 6 `2  0 r& 0& & & & R&  <   @` D HCx L T X& T(  " R <   @` D HC^ L T X& T(ђ  @D$$@" "" 2 $)&  > L` " ` & & & & $& RH&  <   @` D HC" Lǐ T X& T( 㿘  4` &   4[ & & &  㿘  " (5   " 5  " (5  ( "&5z &㿘  45  2> a>n!`"  "@"" """ "&""㿘> a" @"  7$>   @ 6( > c>T"@   `@ ,c "@2`  `> a"@ > a" ` ^   5!  2 & ,o|ooopom$qlq|q|q|q|pq|q|q|q|q|q|q|ppm,q|q|q|q|q|pplq|q|m4q|q|q|qoq|q|mtq|q|q|ppDq|q|mq|q|q|qoq|q|q|q|q|q|ppXq|q|nq|q|q|q@p,q|q|nlq|q|q|ppq|q|nq|q|q|q4q|q|q|q|q|q|q|pq|q|q|ooq|q|qLq|q|q|q|q|q|q|pq|q|q|q|q|q|q|qXq|q|q|q|q|q|q|pq|q|q|mnq|q|qdq|q|qtq|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|q|o D"@ @6   @ " @ * ( (,  ,   % "  " @  @ * ( (  * ( (  * ( (  "  "@ @6   "   2" "   * H  $?? `>Z h*`    `?2 w`  `H2 ؖ @ Y2 ` @ "@ @6  ` 2ذ A@ @ *  *` *    ` 2 r@ @ *`  @ 2 ` @ "@ @6}J {@  @ 2 ` @ "@ @6 @ b* ` ^  * Y@ * T@ * O"@ * J"@-  () '  *# !  2   "  (  *    2  "  * "  0   *2  "  β   @HP     * 2    3*`2   6(  6#  944    Ӕ*``?㿘!> #>`aT\@̐㿘>9'>9 "耢  6 4>9 >9 @6>9%>9@* @" *  1%@@쀢 " ˜4 2U $*   1@@ %>9 ˈ4 2A $>9 >9`* "@ > L>9 & > L @㿘 ؀  @L @F =@(   , ( 0Ӓ @?˒`(,`( , `0I>9 >9 =*` 4,  <4 , , >_" #<$`$`  `$``"``&  $`& $@& ؠ$`,  *@㿘 4%>9* @ &H /f * '  @  ` "`&   "&  4* "@H 0㿘H /f4> a* '> a"  @  H 0㿘H /f * '  ܐ@?: > L  ,`" @*`$@   2 ,H 0㿘>9 耢  > a""""` & &   0  & >i!p" "> a &  "` "`"& 㿘>9 耢  > a""""` & &   /  & >iĐ!" "& > ab` & `""`㿘 @     0@   @  *   @  *  㿘H /f * '  8>b>b>b , ;`(6 8& & & x > _"P,  >^ (`  > _@"S `"  "`> a""   "@`"`& "@   <`"@@"`@> b""@<"@ 0  2>9  4& ؓ*`"  0 > L  0  * @`" €  2 0H 0㿘> a" , "%  `  2  @ @D  8 "   "   " @C    2  2  㿘> a" " 8 "  "   `@2   `"   @@C̐    2  2 8 㿘      >9 耦> a>9 . 9@> a"`4` ",` 2#   @   @`* " @ A "   2``2` > a "     22  㿘  C ` "? `26 `2 @C@ "/``"'  @C6 2! # ``   @    @`  @  2㿘 ,`D ( `$`   `D` ?@n &`D"` &`D    $ >_#<㿘>5 >a@   8 x @6 8 "    2    `& & " & @א > _, "P >^`  ( > _㿘>5 >a@ɐ  8 x`@H6 8@ > _, "P >^`ܐ  ( > _㿘  & && 㿘H /f4> a* '> a"  T 6   6*` 4 6 `" @  2T 6H 0>+!Ph㿘> a" "  @@ 2    㿘0a@ a$@@ؒ԰ܐ 0Ͱ a@ M 8"aH a2@a1@:a@"Ja@"` a@"aI !F@" !J@aG@a@"(a@" D` a5@"x` 0 !6@"x a~@" @y` 0!K@"l r` |6z&x& <œ Ds:5< m 8  H /f * ' H 0 " 8 8 2 8H /f * ' H 0 8?bR!   +4 80%:4  $ D:4    2   -@ x@  > a" "f&@   @ `? ``   2 &@O > a"1`. @ ` Ʃ    " ؒ  2 ْ   2  ? ``2@   ؐ ~  2Ȣ@: Ķ "?@"&@㿘 ` ` & & "` ?& `   x`" ( 8`2 ( 2  & (a 6 8? & ( 8 > 6 8   8  a7ذ 㿀8 A A  r 2"8 4  @ B   8?$ 8 4 " 4 x "  0 4  @  0@ ) $ x 2 4I A " \`> L :; A9 @ " >! >!@g 2`# ! (8(沔 ̖ (w7 0` `  `  ` @Ť 8(K H沔   "A````"`8```$"  `?ܐ"   ?"  `` ?`$`$`  U `` `` $` `[ \W `7 O J  7f  /`@|```"`8```$"  `?ܐ"   ?"  ``  &` &`     $2Z 7     \ H /f * ' ऀ@&$t  7 2" $$ $࠰ "dਐ $" dH 00b $dl $l8$@H 00>㿘` @㿘 8` @ +h>9  ` @"`  2` `  @>  >9 @>ٔ  !"6 h & h `  & ` #  `  8!!\@>  , 2`"% 8 `0@ 56`0;> a( `"(G >+ L>  *` Ȓ > bŠ > b" |> a( "( , >+ L>  *` ŭ >9Ņ >9g" 8 `@?0[2`X @ S  ` O*@"@J "> ?& & & 8 $#@"   "   ?`&&   8  &/í ^, D0&H /f * '  @`/"0 & 2" "" "H 0>   >90 :*@ `*@`*@`> *#㿘!\      .!].!^.!_.!`.!\.!a>b!8  %& . =. >& @. < ؐ!\  =`H &!d ,  㿘!d`""`"@ ) 7!d2  ? > ȅ(2 ( 2    ? @  2 * 20G   * @ 㿘   "  ' /     >9! >9! ۔   ^.@.`.`  `.` .`  .` 㿈H o *@ g    H 00Y 耊 2 adH 0L  @<  2  @<  2      & H 0.  7'   H 0  7n  j  & & ad & ad "`&adad& ah &ahH 0 4㿈H o *@ g  J " adH 00> @<  2  @<  2  2  H 0$ ?  & H 0  `"  "`  "@( 7ah?&ahH 0 4㿘/? 'o  ,@6e!\ >> a""$bbڐ  !?>g>f`И  $ @4 8$ $ , <, >$*, =` ,  ??Ґ!\㾐` 2 ,>a" 8   ''' '&`4! @" T64c ` 3^ A T & T d` & d > bQ"0L /> b"H /f * '  @`"H 0. 7&` 2" "> a"(` ""( _ >+ L > *   L¹  L & L` ` & `H 0 ` "`T 2@  1@ @"  8 @" A2 8>g ""  /  /" @ "  " " " "" " 㿘  &y  2"`>`U"H"` "`"@ "`"& 㿘 `` ``㿘@ 2 & >"ha8 >`-"㿘 } `zx0!50 !6"&o `@l `e " @2@2Y &@& P&M& ` `&`&`&`&`€`   *  % ` .$` &2 02   ` *`$ "` '  &`  㿘 8   @  2  >"` 2 㿘 2 @2 $ & "@ &Ғ 뀦>9("  (@ 2` @ (  R`  ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @D  2  @>       2 `  @ ``>   @8@ @@   @  ` 㿘@V``  ` ` @"``V` 6` ``2 @ `    JJ@   ` p` 20j:   :  ",@8 ``V`4 `Q K``"` 쀊 `@ :@ `" ` T4. `2+ 0 @8  "       "   2  "  2  J    2 @2`  ` 8( :` 0 ?2"  "( * 㿘@`     JJ@ *J 5&&"  *`:  ` ` ``V`8`     $ $ &` &   2& & &  㿐-> a4 @ " @( > >  ` C`'> @<$?('> L? '> $@4 !>9>9b6"b> a",r ," 6"@@2$"*)> a",` @8t 2 V`T4  0#  K 4@2q`0 0",D` >b]y $ 0/   "  $  `*`:; `>9"*`J:`@2 $ $* @8`6   .  @ 2  :  @ ` *  㿘> ab0  "b0  #  >c]  @1  6 .  " & & & $㿐  `     2  8`<  퀦`,T :   h     2 2`$  ` , `$ 2$$ $ $`? . & 6` $ 4  @,  ?`8` `T 60 ,T: @& 2 U &2` *`V:@ :V@&$@&`P-`T`:  0J  & E$ :T`@2"2,V<`@&!4* "  ` >c \. Ӑ ߐ 2<`V@&$&㿘{ 4  @@6Δ" 2 `       2  `"T O > $T cP[А հ >cP[Ȑ 8  ? 2" T `8V @4,  V @2 > a & 2> a#b0""b02 > [cx   ` 8 2 & 2& & `  ```" >`2``"> "`c[g   bƔ  `2"`"`" S"    `2"`"`&`"3 V  "*#2## & ? " > ab0""b02>>cȔؘ[  t  "  " `2"`"`  # ` , , #㿘V  6   `2  "   V  6    @   2  "  㿘  t1     "+ @/ t&>  f, \ , 8$ $ *` 2` >  >k>k>i>h>m$`  cp8 D$$ $$$ $( 㿘> L ` !> a> a`(44"4``> a!> a"4`*`>cZz 0)   _ #> 〢 $`>Z: 0"4*@/O@ "4> `>   " " +  *+> a", >Z 8㿘  >9 7" >9$% "$    4 4 > L`` $`" "`$  㿘  :"``"  "` "@!B 㿘   l@@@@8X@`x@> L 㿀> L 'T'X'P'H'L H  @@2@ `" `@28  "  @4 2.  @4 2$沔 ?  L~   yఀ    2 La 0 ]ఀ  0 㿘 `  k -    \ -J`U.`>m#   M I "F 96C "> 9A0 ؐ8 1 8$ + 9 `€"  $ #K   2   2   9& >X H㿘> L  "  $* €  2 㿘m> _"P㿘` `@  `4  @ &`` 2   X > _"P*` 'H / * '  `3 `€ .> _ +bԀ`"' 4!" 8̒     @ߚ ' 8 $ 8  4"  ` 8 $ 8> _b`  "` ` @-l 4'Đ@ Z H 0㿘`  `@  `4  @ &X > _"P*` 'H / * !  `F `€ "A  2= `5' 4!1    @q "' 8 /$ 8 " 4"( @-  4 ' ' 0' @ "  4 ' D' 4 @ 0 8 $ 8  > _b`  "` `   @,ߒ 4'Đ@͔ H 0㿘 2 8>W X?-& 8 4 )  > a>W `b8? "b8> pY0@  @ސ D`" ` ?"`  ߒ ܒ 㿘 2 >Wx ?͒ 0& X >5  >’`@  i 3* @'  0 @2 @2S 2  D / 2 A`<" "4  4 * 24"l '''''' @``4> _"4> _ "4b  @ A  ``'@@`> _bԐ "bԀ $@+ 4''''ܒ@  -㿘       2 "   8 4?` & 8 `@2 D  D "  `@ K "`@+ 4''?Ȓ@V㿘 ,   `" ( ` 2  (Đ " (` & , ( 2  (  " (Y& ( ( 2& (    "  "   ,`" & (`    $ $ n& ( (`" 3 , ` & ,㿘H /` * ! `> _ bP* @ ð /`$ 2&` "  "T`(0=0`` 2 `    " `x>U G $`x  8 ?$ 8$`x`4`D ? $`4 > ab8 "b8&`8 } $`8 0x"w  2 4q  D >&`$ 0&` H &` ` &`$ 2`(5 ]`(  є  S 7@*Œ `$ $ 4$ `@Q`  B 7`  `@ `/  `  2  x "  ْ ֒    $ $ D  $ @ P`P  ($ |& 8 $ 8H 0㿘@ ?    ?    0 "  ?  @8  `(   K  2 & 6 q & x & 0o  x `8 ?"`8& x 4  Ԑ & x P 2   T" `T8& T 㿘@.@ @`.@ `     .@`@ *@ @)"X ' `0     2} 7 Ē " 8 D?@$ 8d 3b A L$ D@) 4 ' '''̒'T```   @͖ 8 ` $ 8`24`21 "- 8 D?!$ 8> Uǒ D    D` ?"` $ D $ @   &   @㿘#>9b( " > a>>> `8T#p""  >tb=R>+!=S $b(㿘>9"(   /   @)# && &  & > a<<`&  "`"<& "㿘3 `"  "`   "@` "`&  `"@ "  €  `    < (   ">?& U-!P  2  ` "`  " 㿘$ `"  "`   "@`"  "` "`  "@ ` ">?"`T!  2 㿘> L  .  2&  `"  "`   "@`"  "` "`  "@ ` ">?"`Tɐ!  2   r   7@(f $ $ $ $  $   "`  & $ $ $  "&  `  "`㿘> L H /`4> a* !> a"<`@ 1``"  "`   "@` "`$`  "@ "  €  `    h T ` ">?$`TY!` " ` @ & ``2`H 0>+!< TTT㿘`     & @'ے `( &   > _b?"b > _b`?"` > _b`?"`> _b` ?"` > _b`?"`H /``* !`  > B! 2  j )`=  :  ʒ H 003  > _b "b > _b` "` > _b`  "`>9> _b`  "` >9"<> _$ `"  @6 H 0P'L'T'X'P'H  '      _  2 ְ 7  2 >R"`K(' @'u  #  'm 7  %> B'a + 4&@' 4 'L@Ȕ`' ` 8K Ȁ "  8C Ѐ "   "9 7` @ *2 7@,ɒ` ", 7` '  ` Ea: " `>u *`  n   8 D$ 8Ȁ   ^  $ @FP`8?"`8"`H> _ bP* @2  / ̲ "ݸ ` "׸  8 $ 8 T  0 0 ' 0' ' H' 0 @`"'` ' D'`8 "' D '`46'ض @ؖ @  H  " 7’{ @  4$& P (~&  zȀ   m E "F "` `؀` Ȁ   "蘒g -&`D؀  2 ` Ȁ ``4` " ` `" `D " `D  `D` Ր?"` &`D`  '` &`@ $@m`P`D "   Ѐ 2&`H`P * &`P $ &`P - "& @& "Ґ @ > _" 4 Ԓ 1`26`Ā  >92"N @e   "@E   >9>9>9bL<,` 6`  `" `" @`" `" ` "  `" `"` " 㿘@%5  :  *$ ?  @ *㿘 J  @*@  &@T`ϐ  3`8 " $@@` @4@@ 2@T`   " $@@$ ` "` @d&ݲ    && 㿘    Lh  T Lh$ >O"s   `     z "0  & & & @$ ,`  @*@&@ ?   m@,  ,4, 㿘 &@   L  T L2 ,``  @*@&@ ?    ˔``,`)% $  &   "g  &  &&  & ,,4㿘> _" `: @ " " @>9bL " 22>9>9 bL<,`> _" @# 4   D` 4 <4 V 8 X$ >9"L$ >9>9 <,3 `> _" ` c  @# 4        @' `'`''ࠒ = 4 2` `$"``"`"`  >9 "( '0'' " 42`4`"` "`"` >9 bL 22>9>9bL<,`@    4`@F @#M 4 @  0' ' H''  D'@'8 "`'  ` "!`  P 4$  t ($  $ @`44 $ $ $ $ ` "`&`&``@# 4> a""i ``" 4@2] `X @'Ԓ }``E'` A<44 T8 D$ b $ ` 2=-`"@@ 2)`@ '`'` 'P`````  42` `"``$"`"``w` "`&```р '''2` x  f `a  @" '   ''''H /`4ؐ* !؀ %   0 `` > _"P.`  `@2`>y (bH `0HH 0  䀦@ '"  &  *` * " @  &㿘H /` * ! >+!>9$62> a"P`` \ @> L 8@d `2`H 0㿘>9`0 `L> L `" "!>  4>zc5>+!5`4` `@ `< `@!@8&`T0 "` `0"@ 02 `4` ?a&`4`4a&>9` H`@> L <`0,`@ 44``@&`\ < `P `T!@ `}@ yw&`T@" ` ``@ @m  > 8`@b ` <,`@ 4Z4  x  &`L>’bHL 0M> a> a"TX`#"T"X@!` $``4$&`4> abPbP $@bP" "bP$``  `D`H. &`\`@ ,`!\ Ȕ >9"܀  > a"$&`@> abX?"bX@`"``"``@"@&`L`4 ;&`4` "|@a 㿈 {ג  5  `%  % @! % >9  (4  4`(  4 4 , , ~ `z `v `r   // 㿘!>9 = "  ^// /   / / r/ `"`L @= 2  `2 `\>’bhKϐ {АZ ``0> L @( 8  2  8   ! 0C 8 2@  "$ {$ `\ 2 `\>Lؐ"> L &`\`\`"+ `4 ?&`4  > L @"  > L >9&`\ bؒ @  $ `D@`I!\  >9"`4`\` &`\&`4$  㿘>9"Ā WH /f * ' #>9bĀ b $b"`"`?"`H 0 > 2 >K"  }I  #b b   *   : }6 b h@@  b{ bĀ x`? `'غp  k> b! H2< `@2<!܀ H2< `@2<` `@  2``2 H\@%    >9`@%  !>'"!>'#@J 0 ܀!>'@#8~J ' @`? ~  z 0v  5 `@%G L4@!>'#p@eNJ_ 0Y@#>'"c!>'@N#7 JH  $\@" 0`" 0 #>'` @1@ J( 0"  `,  \ > L>9 b $\4 ?$4 `%  % z0A  f b @U   V 0   OK ؒG  (55= \9 (4  // 㿘 `2`8>I X $``0" `  2`*& `4 ?"`4 `   ښ 㿐>  L*L @ , $ 4 . 28 4? dd"80  "L`   !>' h@vIu   -㿘`H 4!\`>zc̐!&`&`㿘      *   h@@0yG㿘   /  >90) ' 0%"耢  >9" @#>9b䀢 > a\ @#  > ``  >  `\  $b> ,ǐ \y㿈 x  4  %  % @% >9 `   54`  4(  !\ 4 4 , , N J F   // 㿘%>9䀢  - >9#>9 "b$b??>+!>Ó2 >  \: *ʘ #"?䀢 $b>  ` >  \    3㿐Ȓ㿀  `/ `8 >HS 8>HM @c /7  '  '@     $@ `  (  @? @#  "" &, 2 4 ?c 4$ * @,  ,&          ߖ ,  , "32 4 ?c 4$ , 2 4 ?#@ 4$ ,   #     ?2 * @ 2e >H , ?# , 2 4 ?c 4$ *@     > a> d d㿘!>  d  @2  &    2  8 b      d""" $ d&  ?㿘!>  d"  "  2   A 8   d """ $ d  㿘>  d d  2   "_ 8㿈%> a'L'P'T'X'Hh   $h` h``w$$`0  ` : y" 2 ` $` "& & @  h`w"0q " & & `h``h0_ h0\  $  8 V `2Mw  vܐ0K"`"`8 @2D > b!'' ` ``t`<`'`'`/`2` 2@8 ?   }&`@#ڒ 2 &`> a""d `` ``t`<`'`'`2`0< 8 2 `v$ 0`" > b!'' ` ``t`<`'`'``2)@8 "@@ 2`?`>!*` `( "&`@# &`> a""d &` `` ``t`<`'`'`2`0 " 8 <` 8 2Z2V ?@> b!` > b` 2`<`> b`0& > b!` ` 2`<```t`vh``"qh@ 2``jh&`` "`` "` ` ^ \&`  "W U  " 8 O<` 8 2" `u"0@?@> b!` > b` 2`<`> b`0& > b!` ` 2`<```t`h``h@ 2``h&` `" `?` >!*`  &`@ ݐ㿘H /` * !   ?8 &   8 2& ?@  9& @" 2 & > a""d& H 0㿘    8 ?   8     @ 㿐#> abd QH /` * ! > b!$bd'' `4 `t`< '+  ? $   2    @L   @G  $  $bd ` `t`< ' ' 2 H 0H(> d2     2H@ yȒ  ;> ` ` @ $` $`$` 2* *2" ""` ` ?$` $`*, $ @ߞ4 4 ` `  $`$`   /'/  @ > abh`  "` >9> b`" `,`( " `<`2`, > b`"  `4`0 " `<`2`4 <  8  ?     * H"*  "   " * `` 8 2`*  㿘@   . ``:` `*`?&@ #: . 㿈 !@  !@ 00!@0  "Ű +@ > b!   2 < a@"'a@"< a a@qa@2 a0a#@ a!@j !@  aa%@` a      2 < H@2 < !@2  "o 1  > >CR 2a    j x@b x$ <> ba` <$ @`""`$  $ "& D T d $$ $ , d8   , T, U$ $ t8 5 > ab /"b   -  "    H ``<` ` 2`<`H 2`<` ` "   1 a@Ӑa@"88a @g0a@Wa@f00a"@"8  !@^a!@ 0Ґa#@ a%@0ʐ@ D8 9: T 45 T2 d , T FB   5 0    $ $    8  T   @p R$ 4$ h E    2 D   H@" 0  @K d0  h $ 48 "! 2 @9 T ߔ   28`"8@+ 8  !   T Ô  8Ւ 03ꡐ @  ` "`&  "@ <`" @ @"`@> b"" @ <"@ ?$     - 2 >A!!@ "!@"Ȱ -0!@2ð - @" 2  2  `  2  @  "  8  !@ 4t!@"  -0!@(t - @2 @ @3 / "'  // ai@  @0t @@ 2Z   !@      2 t  2  08 1!@2x D Dߒ8  T Tؒ0@N!8 h&& @E @ǔ  D DÒ8  T T d d aN㿘@㿀H /f * ' `D     a    H 00UH 0 &@’&@ ?0  ??&`,`4``,&`h&`4 &`,`,`d`4 &`(&`0 D&`$ 8  `0`42`,&`X`(2 &`8 @  &``U   @U 8 8 '@Đ㿘 X H> b! h` `h@ 2`<`  8  "`H`X 2`<`  `<`2`h됒    $ 㿘` 2` L 8  "`H`X> b!`h 4 @  h 2- <  8  " H X @2" <  2 <8 ` ` Y ` ?$`  8    L    $  2 h8 ` ` : ` ?$`?. ,`20`> a, ")`` "%`2H"X" 8>9" 0" (2  2`@ 2`8 xH /` * ! %> b` ` 2`<` `t  $@      $ 2   $  [&  6  2 @H 0S  && &  2<2 & ђ 6H 09 t & t "`t"t&  ` @// ' a1؀  `"  "`  "@ 6H 0  H 0xH /` * !  ? &  `"  "`  "@ / '  a2g 6H 0㿘&&   R & 6 >(0 *`0 *  * 2`~0> a( 2`~> a␅0(@ ` *  㿘 В   U 7@ޒ >: !>:>:>:, a$  , , , $ 8H /f * ' $ `@$ &`"` &@ 4  6 `  `* @ $@ "  4  6 `  `* "@ 4  6 `  `* @$ H 0 ?$ &  㿐 8> b > B! a  0 " 6 2  0 2  "  `   ` `T ` ` `< 8 `6`'@ L - Ѱ 1 2"- 4  0#a:`  2 ฀ > ac4  `@   > a 8 ฀ 2 0> ac `@ " ` 8R 2` 0`& 0 26 6 `  >9>9#c a:` y #  "X  >9>9#c, ,2 5`@8, Ӹ@0&@$, 4"4 \ 1?* 2`@45`: 4   > ac  0@ ڐ76 6, ȝ@$@, 5$@4 & 1 * 2`@ 45`( 4   > ac  0@l ڐ6 6@2 㿈` `  \   " V / I> b!`"`0  ? `H2 `0`  8 "`0`X$ `0 2`0`8R``@`@ 2 `0쀢 . 1'* `' '` @.`6 "`0 0 2 `6 2   12   1$`0 $`   @4`4㿘 8   "& @6 4 8  @㿘 8 u,"` " @m @ $@ H /f  "@* ' ` "` "  @ "`"`   @ "`H 0  㿘` &` @  , , 64  0$ 㿘` &` @  , , 44  $ 㿘>5 \>Òa0@ٺ ` *``&" 2  8 . 42 @2  6/ 2 @2  0 ` @㿘` `` 2  8   ` @`& @@> 4 D'`0'` '`4' `4  ``  }`00Y㿘 @ P& @㿘@ @9 `6/ 020``  `2'``4.02!``0`"`0 `02`     " `6` `@2`6㿘 @  @@ϒ  8  `2   . .  c& 㿘@ ` @28 8 9?"8&@2@@ "  @ 2@  .`.` 9&`` @ @` `@ 8 "`D 2  Ҋ4  2 4 Ү 4 > b! 2  1㢐 &@< 8 2 D" D> b!  2 <  D 1'  D`H(@"`` `@ `4` `6  ("@  ( `4` `6 ( `4` `6 ("`H 㿘@.6/  @7  . / 2' 4*2 @2! 6+ 2 @2 0 2@ ` "` "@ &@" #@&  2  >9#  *+ >Ð!@2< 3 ;;;;;;;;;;;;;;;;>>>:;H=>><8>>; ;4>><>>>>>>>>>>>>>>>>>>>>>>>CTChC|CCC@㿘>:! ?>:"a㿘` @ * > ac| "c|`?@ ` 2%`!  @* @          > ac|` "` # ` @ ` 8  @ @*  8   (8' iϒ     oq    j! i   &  ܐ"   ?@& `( >9֐!> a#| .` ``" *"` "*  `2 *2* "* B2*kF   2    $?쀢 : >9!  & & & @& * @ "*  2* 2` " ` "p ppi0i 㿘 @Y㿈'L'P'T'X'H  ` $> ac|` B"`@8 @ :  k 2 > ac|` 1"` "@& & @z > ac|` "`  "@& & (!> a#|*  `" `(>!*` P> ԓ.    A#| <#| 7#|   p `# #| *` @`8#|` "`< 8 >:!# > b >9*` *   *  0#|` "`>: 2M.  # #|F.>: >:  `  # #|`Đ "`Ā`` @.&,& >: ` U#| `>: >:"!( `r>:<!$ m .`h& 2  `  8 2`X " `X'   o  #|7 ``  "`* `@N" 0J  ox >:! >#|`#( ` *` @`8 #|` ("`>:!4# >:a$"`!>:!"  ' Ț쀢 >:! >:!> 䟒b쀢 !l!g  @0hPx   ` *`' 2  ?  "h7 > b $a >: H@ >:  8 " < X@2 <>:!$  "  ` Ϗ 2& Hؐ@  ܐ *` /"`ߎ؀`2 `t> bb`T z"`T   H`D "`t`8 ?"`8 H $ `a,@    g    % "@ "9  D 2   2  % $ $    (  `@ހ   4     *   % "4@* @ $  "`&  "&  `  |6 @  g4㿘   , "@& & 4`@r"@4`  "@& &    @ ߚ 㿐@T@wa* &. . @ #㿘`E ?`?>!*` >: >: >:  >:!>:!\3>:Ua 5>:  a `  &ߞ$a & *㿐ޖ  "#  4 >: 0   $  P (M P>:!>a   㿘>: Ґ! : 2#P T `   * $ >:`!T@ @>:!T !T*@(P`!'`@ @` "PT "Tޫ 㿈 2 4>6W!  2  P     0  ߳ 4> b >9*` *   *    0 "& T㿘>:!>:> a#ta`?㿘 2 4>6!      ߀ 0㿘.`    ,`. 2`&2 .@X2`. 2 , 4 .@N2` ,`6 㿘%?)> 'တ @I% x#c4 > > 2j2`h > 2`l% x x` 2 #> 4`p > 2`n 4`p`p @&*   % x@c4 % x,2   >Ð",  ,`@ 2 *  2 ,` 2  @c ,`2` >:r  > L` ?` > >:> 3 r"`t0r3ap㿘%>:p!/@> L > `t!> !>  x l$ x xp 2 @/@ $ xl 4> `!> >  hr n> `p @a?4 h`>  l> p> `h r *4p> `j>:r@ . 6 mmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmdmpmdmdmdmdmdmdmdmdmdmdmdmdmdmdmmdmdmdmdmdmdmdmdmdmdn n n4pnHnxoLo`otoooppoooppp(p<pPpdpxppnopԝ㿐>'1>  b6[x>Òb$ W>Òb4 Q> b>Ö  b@"#\ +ʔ   c,   >4"H>9 " *"@ *`" *  *  * " * "> b:*$ >:`   $> a 2`R   " *"@ *`" *  *  * " * ":* ` 4*> a""`> b>:!"b> b!"!"`>:! >:6!>:"a#> ab@ d   (@b2*  * @#  (@ (  (> a~␕2*@ ` ( * @ " > b>ÒbP @ʐ"> b>ÒbX @Đ"> b>Ð!bh@ 㿘H /f * ' > b` ` """`?"H 0 ` ` >3ߐ"p@ 0ց㿐'> b !> b" $"  "f   2 `  $`  <@  "`X "`X2 <8 ` "` e 2 "` "` ` "  ` 2    8 2 "`p "`p 2 ?  " t `" " t@ι  "` "`& "`t "`t`@6 > bb` x"` > bb` o"` >: 2"@ & `& eA>:"!@ǐ \`'@Y "`  8 2>``< 8 #` `    ``<`" ` 2`<`  `t 22` > b>:!  > b(`c>"(0@Ò 0`?@"`   e8 2 > bb`  "` H /f+> b* '+> bb   H 0  > a%bH 0 > a"` " ` @2`  @2 ` @2 ` @"` 2` ``"2 4`*` `*> bb`` "``H /f4%b* '%bH 0 0* 4`*  e > b"'>:>:ܒ`ؐ  $@d $dH /f4%b* '%bH 0 0r> b"*| d $dH /f4%b* '%bH 0 0V `$" *"@ 2@H /f4%b* '%bH 0 0; $@  @ * @H /f4%b* '%bH 0 > b"4`> bb`4> b "`4 `   *` >9*   *   0b(> b=H4 8>:40 '>:`"#<`2< 8"<X`8 `0`(2 <`  `2` 2H 㿘`  ` *`  " & -&     > b> ab`b` &@" "b`&` <.` .`  6` &`   &` y&`3 `2ca` p `     `  耢 + `2` 2> b` ` `@` ` @( :`    " 0`> b c$`2``"2` @ "@ "@aZ` @`"``"``@"@> b*">:aܢ?"a܀` `  4 2 ` $` " &` `  $ $" %$`  `  `` `@`@   o `? c * @  > bh`@a"h] ` -> bb&@*'>:ܢ?`$ *}ܒ?$bt2 5 `% `% @`"``"``@"@   * @&   *  "@&    @& > b``"> b"*>>:aܰ ?"a܁㿘 "` `"  "` "@> b*"">:aܠ? "a`"  "` "@ 㿘H /` * ! H /f#> b* '#> bb   H 0  > a$bH 0 > a"` ?  *> b  `" 2 H /f4$b* '$bH 0 H 0㿘H /f%> b* '%> b "  H 0   $H 0   "#> ab`  > bb``R""` > bH /f4$* '$H 0 㿘 2 `2"> a"`>:!ؑ*` >: ܑ: @?> bh  * ?   ` `  ? `@$`Dx``Q`Ҭ%`2ά%>:! "   />: $> 2?`%   '@#%ה `2 U  y@'Ԕ H%   < , 8 @ @ ?  ? z>:a    H`@'Ԕ H   b, ꀢ`$逢` 2   *` ? ~'H% А?p   "   +$j $f   a>:!" h %HQ   O!>:!D Œ?  /v'̒ ̒4  /% ``  >:! @@ 6 4 'Ԥ@ " !>'Ԡ".   ?  ?  $   *"@ 5  ٘ > bb`P  "`P㿘> b"?` > b`"  `8 ?"`8> b""Ē  > b$ , ,"> b"Ā   Dm > b㿘>:!  @>Ð"/|`+ !>  2 >:"a$?㿈   //'7ɒ "D  4 $$2: 8 0  > a3 834 "`"+ 8` "#` 0  @2     `@֒ 2   8 ?& 8   2``2`  8 ΐ?& 8 㿘!>:!䀢  ]{  !E %>:*`  & >/"!> `* ?  "@ >@."  *`*` `  `   >@.ݐ"> $@ ?`>  >:! $@>.ː"㿘  @` * "   "`&  "& @* @@$@㿈->:     >` #`. ` ! > b` ' 2 `> b(`]Y"(0`  - d> b> b",`  `@    8 ?$ 8> b""Đ  ,,`!> b$Ե""Ā     u 0` D4 ]  " @ @ `_*` @ @2>: 4 0.>:  `(>:! $`#>:Ð >: D!4` 0 >: 4 "` 0    >Ð#  .>:! > b`"Ė !#\  @N > bb`(  "`(> b"`$ "`$`, "`, A>"*   > bb`L  "`L  \0 㿘`ǰ ?`>#*` >:!>:!>:!> T"  >:!>:!3>: aa` 5>:Ā a>:!&a 3>:aĀ ! an {&a3>: |a>:aĀqa  0l>9[# >9V#>9Q#>9L#>:G!>:B!t>:=!x>:8!|>:3!>:.!>:)!>:$!>:!>:!>:!>:!> b"> b">:!  > b!   -\\0pppp(Lppppp L X'X'H'L'P'T    >+;#8`@ `@<`* @ &@6`@=  `*`*  > b6`&@b`8  "`8` #&@ * ` ` @ 4 "8``@" 8 ߐ?"8&   ,`,@`$`"` 2 * > b   @D.`< 8 2 "`> b! 0 @ "-`<")` 2<#` 2m`2 `T> bb`Tǰ A 4&`D`@ @`t "`t`4 2`0`< 8 `H&` 2|`2@ 4 "8``@" 8 ΐ?"8&   ,`,@`$`"` 2  x> b   @@.`< 8 2 "`> b! , @ ")` <"%`  2<`  2`2`T> bb`TE A`D`@ @`t "`t`4 2`0` 2`H&` `< 8 2x`W`!"7`    .`> bb`T A` T 8@ > b" `  8 2 ` > bb`T 3 "`T  > b!` > b` 2`<`H&` > b!` ` 2`<``t% `    2 "`   "`` @ߐ` ?'` @`  8 !Yː'鍒 "` 8   12`  @@ (`! >7`"`  " `  P 2` ` 6``    0 "`@`  ?"`  0 "`@` ?'` `8/`  0 2 6` ` > b '` b`x "`x6` @i6` ` > `xa,  "a, > ac`0 "`0 >@4   (P > b @T 8"T> bb`L 5"`LG 05@5 (+  '` Y2 > bb`D "`D` `8 ѐ?"`8Y㿘  @ * & ( "`@ ?& `  g ]  }> `'   & 4 `  c 6 @ː >` `**` $& `%?Ȑ*:`@4 ` @ 4 ` & "@ 4 4 Y  ?&& &  0   > b & b`x "`x4 @È4 > b" H`" H` `Z,% %``` 4`4` 0 ` > b %` b`x  "`x> bb`< 7 "`<@W4` 4`  㿘 ?` c @ I` 2$      $" & ]>  6  ` &  ?6 `> `&`   & & &@ &    & }    @& &  & ؔ   k`& 4 㿘  * ?쀤`(`  "%?쀢 `,  8 >'#P  >'#P>$@` ဢ ?" ,   㿘`  Т r u 2ʰ`g>!*` `@ "\  2W  `R>!*` J.`eH.`l`` B&`` ??&```` 9&`` ?6&```` 0&`` ?-&```@' "%  2   "``"`` " ``  ? &`` ?ߐ  &`` ? &`` - * ]VY`S>!*`  V͒ '` "F$  $ `  ? V ' `)$ >!*` !`e`l`` ``2 ``2 `@ V ' $ ``  2    "  $ "@ - *㿘 `V`&`  `T VP Ka`   E `&`  `@ `$3`  "/` `  - )'  2$@` ?&` ,` e`$@` א ` ,& V8 㿀@   X 5^ &@ ,$,4?`>"*` "  2 > b$!`  `H2`<`2` ` T`8@"Ӱ 1$"ΰ  2ʰ  ,"ð  2  8 ,"  2 <8 @@ 2 > b /' *͖" " 1 @`!`  `H 2`<`2` `l T`8@h  6  , `2 @@2  g 0c ;ِ,  "@ Z 7 V4"S  2O <8  "E `> b !  H 2<2 `"2 1  `,   2 ,   2  ,  1 6 , ?,  & `?4 -  @@@@쏒 5&@㿘 T   &0  # -0+ ``"` @`> b!`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘    ,  @嶠  , = 5㿘沐 U  ` 4 `@ *`4 ê 㿐  @ +   " ^ * ` 7 `  <c7 `   0 , 2      Ԟ0 2@ 80㿘> b# 㿘 +> bc->: Lc"`@@ `m`"`0 @24``0`"`  @2,`` ` @2$`沔 U  LLhB T} `8g=ఀ  `8`c@2 `mL>:bLh# T^0 gఀ  0     ꛘ > bTF> b" 0 4" 4" 0㿈 'P'T'X 'H'L ` `J  ?`#@I ``" 8`  $"   ?ܐ"   ?"    ?`& &  TO  "    "   &   .`6` m.`  6` 0.`&` /&` ?#$ Sސ- (@@  "`  `@ 2 <@6`Sǐ  > b 6`> bb`\ "`\  0 @㿘`  C  ?SR쀢" 5k3d1 0' `" ` 8`    `  ?$ ` S.\ S ' "  ``  "@  - S 㿘``  Z ``2 `.`>   "`># # >: "\>:`f x> bc) q`n, m` "i 9d >"#_ > a" "U 1? 8O 1 "K$ 0 "F 1C$ 0 = > a" 2 `6 1? (`/ /d_$ +ed'`   8 2 9    - >"#R㿘> @> b* @*`"@ *`Р@ d"@"@H$@4 4 $  t! t@x!    (4 p @j (4 p |||㿘 x` 8+> bbY 2 > x`Rj"ǰ   `    " $+> ``` " `# x@>  x  #   ;`BR:; bʒ0S"&`&`>  x #  Ȓ ;`B; R `"  "` "@b "$  ` " $$ 6 " "2 S $ 6` $ $" & $ $" $$V d $>  ":    @24     &   `  $` "  " Q > be L> bJ"؀``  @" do L   㿘H /f  > a@ ې 0?* ' > acHcH> a '<"  Rd 2  .`62   cH> a?2<> acHcH<" Rd  cH2 `x | 'L'X'P'T $ |'H   2  ''7'''` `( Q/07`  S   +$ +    " '@4  2 ?߀ @ `x!( `" "!(@* ` 4$`x` "`& `xa( "a(  2 * `䀤@"> `x` "``5' @ : SU > `x` "`"   'ԒԀ `$ 2 `@B @2  2   '' '  > a'#H'{褒 2<>  x!  $!> a#H W 2<! /$!->:Vd kd 2*@8` 1  7>   DД (` $b8 2 b/ E``'46g$0$< 6d`P@ .!> a#\Vd` &>+!> 2`@L!:` /4Vd  #\Ԑ@2Vd 2`P 7 2`P@,`P2`P`"`P@2`PĀ@2`P "  #\&&䀣 j"@ $`PĐ"@ 4`P@*`PVj 2`P!>  x!` "!> a#\ؐ"@ @i`؀"ܐ" $> a#\@X"@  x`|" `` <`B ;`#`dO&Ā@20ڐ` 2`>+!2`@Vh:`` bT`|& @Q`P M`L"@`X`T"@@ 4 4B`P> `xa  #a  & `; `@ B  ;`#`` @ObQb`Lb`L`  p >:"  &p> #<&p7|p@'`L"@`X`T"@@ 4 `& "@@ & Vd &  - )  ƀ  @2  2  @  # ꀦ < 8 ' ޷耢 ـ N  Ҁ'`! ` @&` , ,  $  @4 0 $01 $0NwNs@  &t@ ے 7' #\Ԓ@`&@ &>+!>:2`@:`"hp &&&p6d&&&&s&4> `x` p"`  > `xa )"a"@ $ Đ"@  yࠏ  "@  Đ"@   C@ y =? <  &&y p `&&p&*&" $> x`_"p  ` `6d..  ؀> a#\@"@ l &Ȑ 6d &@"@O >  x ؒ <  ДB; ؚ`'# и??&X& # 2"`܀ <> a#\" 4&>   x:  !B`#!# l; " >  &`?6?ߠ?䀤> p &p`x`` < B #`;` ?>  x  < B`; # @'̐&"'"6?6` "Vd 䀢 " @ Ð> x`+" @ " ?> `x Ѐ  ,# В : ؖ B ; Vd 2"  }@@ ' ꀏ @倏 p`x &p` "` ؒ < B; ؐN ?"' @  "  > a#\&&  @d?* : `>" *`  = 67`8> 6dx `S" @  6 2Vdp  ۀ > N M x`^V"p  ` `6d..  U?&" W>:䀢 )  2%6j@H>  x` $` A>:jbd * :`@ .6jȀ  l2 @/ ( &̐&l&&``aPB`<``@Q$aPVjrl@$ m&k&l@ @>&cڀ 6j"dVj &6j̀ 8&6jĐ"@ $> `x` "`>  x "@ <`B`;  # > a#\ؐ"@ @ے`؀" ܐ" > a#\@˒"@ Ā@20a 'Ѐ 2>+!2`@Vh :`̀l ~@?# * 8 &`|@  `|"@ &`|aD  `a@ "&` ^`| &&Vd "$    0E/ 5 0@ > `  ]>+!> 2`@D~:`L )6d' 6d@ $>+!2 :*"@ L*`]p   @>+!2 :*"@ L*`<  2 @ @@ @# @ 䀢 2&@2 &@> `xa "a&&耥@ && 'Ѐ ":"6Vd 42`L>6` (6-?ߔ " $&`L"  ? '`H` @7`[̐ ?.怢@`!̐@"@ 4&䀢 2Vd ^Vd Z@2I 2È2Bp >:"   &p> #<&p|> `x & :``  B ;`#`` J L^(`L]`L``  LRp`&pJƐ? "A`Vd <  ]Cp `&p&Vd "    (` >+"`6d6d 6d@ >+!2 :*"@ L*`\L `!2 :*"@ L*``  `? `> * :`D  Ѐ`p q@+0m NJ_p`@ &p0b>:"l>:>  pbp < 9  # 4 < 8 *' 耢 #    @   '   @r  #R0x 8    > * :`D K I`R㿐\C7 "    8@ 4@22@ -`zC )@2'@ "  p @& p`@8. 2@ '`z* `z&   > a p!& pc\@& & @&$ @   $  `    @x @Ґ㿘` > 8  &@>H# < `** " yٔ ?& > x * (:   ( 2 2*`& (8"( 2 2((22+ 8"2f *`R(8882h2h  2h2㿐x)>:"' , (`@`T 2?؀ "` 8 2 @>:! 2  @` ` '  @?؀ ` @"?ؐ * `44Ҁ 8 @@*p !!4а?2$l 6 4l@^{$4l 㿘 x l 8 ~V 2>dl ":dP @a @* 2``6  ` 6 =`$@ 6 p "*`z@!`H6 2 :  : 6  V * :  :   6 h6 h 6 hd ":?P`@{S>6` 8 [e|` "P?@{?>6` 8 [QL` "hP@/h ,` * & ́h  Đ  x`?` `8> a#\ V h" *  l&   "@  Ȁ8>:V d"xN n ` |*  ? 6 f|  < l   1  6 f 0 & @ l |  @* LP XT"@ 4  U`@ p @:N!N n 2J! 2` `2C!  Ā@,>!? #* 4 * " " 6-!* 6)! p2%!2"!  " 4!"! "!"<   28  0 24 @36 f/ !  & .& p `!&   //ѐR 7ΐΒwՔ   p   @"  p @#@'Ԫ  p ` `(`(  a`(> a#\ @B` " " "` `(( >#Ȑ"`(  !> ` (>#"^ pN n  2  > `x`l "`l  Ā@ >  x X P <B`; X # P x H D <B`; H# D L  "! LD ` `F ` (`"@"@ $`$` G[  $@F= 7H2` $` | "87$` > `x`h "`h`x`x "`x  " > `x`p "`p`x`t "`t K   K ` `F ` `$`  $`$` t`2` >Y#&@"`>R v` t `  ? p    Ā@& 2  2  0 "  $  `$ В vɔ `2`<**` $ , P2 ? l& ? #* 4  "@ & 2 = 4   "@` @ 8 4  ,  & !  2N n`   $` *` 2 ?c 8" 4 N n  0 2@  &   p `& & p  Đ"@ &  ؀  & > a#\> & & ܒ`x` "`  2   @>+! 2`@V hxȓ:`֐ 0 "  6 f Đ"@ 4&   V d` @$`!   `>:`2` x l*` x e*` x`@ ` ` ! #> 7 ( x@ >  A x@ 7  22 pV d $ p,6  > #<| |% x`@ "`@ p  `  "` $  p  "@ 4&  p & & p & p |28  㿘 V * :   : > 8 䀢&V f>:"*` x,  x 4 x>+!  2`@ x:`*V f  f`6 f㿐> >Ě`P"X#\    !>:"> aސ#H2 > a@"c\㿘`t %`x D  2aT  > ` & > `   (`@  & J8   2aD9 a 2%   @  4 , 0?$ * 2  2`  2* 2` *$ 2  2# `" 4  6* <*@44 $ 4 4 $ $ , 4 㿘   x 8 T P L X" " 4 !  @@<    2 D*  ^> `   &t ( Dx & & (& `` &` &`` 44 2&  4`  (`& && * <*@ $ $ $  ,  =?#44 4 @& 4` 4 @A4 4`>: !>:,`a `  $ x 詘 㿘> "X  @ @!$>:">4 l`4 А |  >Đ X,` `` >:"   >:" * :` * $ p4 $ x4 4 䀢4 h4 h 4 h $!$ $ >: !,l$<㿘 x 8V d  > 6 d> `x`  "` `x` "``<V  2@4 8㿘 x8 *  Ē@@ _@ [   V P @ V *"@ *`" *  l * ` 2 $ l$ l P  V *"@ *`" *  p * ` 2 $ p$ p P 2  d ̀`" d h 2 l d2 @ l* 2 2 @@`(  vI`( h 2 $ h$ h@!@ p  ?& p~ | t "> B>  Ԑ"XT$<> `x` "` 㿘@  ` "` "C% > b "@  ?  *  * * * 㿘 `P  M>:!.   >/"? >(#(  >:! > a `*`  #H }  >ڐ> "4  >" 0 > a `*`'  #H#\Ӗ0#H  <l ȁ㿘 <ֈ `" `4 2 `T.y  `T D? &$ 㿘 <f    4 ,?  !> `(((0*`0㿘> ! > ! @> L  ?`  @ > > "!3!2ԁ㿘1> !!/@ > L > aЀ!!ԑ*``6!2 ʰ> a? * .  㿘> cL 2>  @"cL> c@ 2>  "c@> cH !>  @"cH#< >+!@F $#<㿘H /` * !  p`& pH 0H(> @> ac\> ("#D"c\H 㿘  ː? 㿈H /` * !  f`*`:  6 f > 6 f`x`$ "`$V   < 0)>  x`( "`( V * :   :  * V f>:"*` tD  * :`@ 6 h6 h`$>+ 6 h>+! 2`@V ht/:`=>:! "=V f x"9V fV d 5V f 3 8 | "-V f7 " ! 4 "! P 2 V f!` @  // ' " V f P  $ PĒ V f $  Ԛ x  * : @6 6  & &   Ȁ 8  l2 @x ( s& & ̔ x6 jT`"TH 0㿘H /` * ! >  x`, $`, V * :   :  * V f > > a#\ Ԡ"@H>:"s  `0`$`0Œ <0F . n`. nH 0㿘H /` * ! > `x 4 # 4V d`C`x x 8  +`*>+> #D > a#\> L Ԑ "@ @-`x 8`# 8 t   `?  4>+!> 2`@@s;:`I0 >+!> 2`@Ls/:`= 4H 00 <`"<Y #D> a#\ Ԑ" >+!> 2`@@ Lr:`0HH 0L`,Pp,@h|LT,㿐 `  ДG  ? ; 0H /`4`* !`  ` H 0` ` ?    D   8@  ` " `T` 2` x4`` <В߰ 6  ǒ ր  4 d < 8 '" 2  '   6  С  Ѫ  0 $ t 7` `P4`P>+!> x>: "x2`"h@  4 dr :` 4$ $ $ $  $ | -@Gx` u Q@` n0`  h d `|R>[ 5V`&@H 0_ `H 2`` @"D `!2@  쀊  :  6 #&  0*@  ,, ``|"@``"@@ 4 ~`|> 7Q`|  , n $ n, nƒ ђ >a h  `   ֚ H 0㿘 H /4`* !`  H 0 l 6 h>᐀ `    / 敘H 00P4 < F% *""  (  `p &`p ?&`p"  (  `$ `l@4 6`l=͐ 0 = ' " "   *`p "@`l"@H 0㿘` >:`P  > a>:">:Pʐ > acHސ `  "a2`d  ` ? в4`` 74`㿘 x 8V d 4   T  ے  OZR L@  p㿘V d`> *` 6 d  6 d V d  xOH 8V d  >+!> 2`@D:`pi Lw㽈 2f 2c @"] l " 2V񀢠P H /`4 * !   > a'#H'蠒  >  x!` "!> a#H    8  ?' 8 '?''H 0"&@k"㿘`P ?` J> *` >:<">:7">:2"h> -#L> (#@= '> a" @>:">:"ܐQ>:"l>:" *x<<TDL4D<  <<<<<㿘>:"> ab#`P#> ac'L 'P'T'X$c'H @2  _   /р`   ` > 2 c` L"` ` 2 c` :"``" c 8$` ,"`> l `*c 2 ?! ``("`(<;"`0@ ` 6 @6* `7`c`<)"0& c`( "`(`  "` р`2@  //@7  @'//`7'< 8  #> a' Đ q#> ac`c`@O `6`@2F``0`"` @2>`` `  @26``4@@21` '沔  ac`   "` N~    `8  "  `c`@2`6 > ac` t"`=R LДOV d NT iX  > a'c`'@`Y (> a# $`$ $@ `8    $   #   6$  k7`   ѧ 01  `` 7  @) <`8А LO > a`8M L`8   0 > ac`  "` ;*;%㿘 :    k `& $ $$  㿘 82 8 8M̒ L 8    8M |㿈>`1#` -@ ) '>:!.  ? >#( `0 > a `*`'  #`#\0#`D  x ` 'X'T'H'L'P a > ~ x?# @ (    0 8H /` * !  " H 00 2  9``" 8`  $"   ?ܐ"   ?"    ?`& &  :  S 7     & J 7  @2  .` 6`  0>:&`  &` 66`b 4 6`6` /  & ` 2`* `2 `@2*@ 2@ 2 @*2`2?# 8"6`6`6` l> a.` e.`,`", 8 @` 0 ދ#\Ԑ$ 0$ `H 099㿘``   ``2 `.`>!X   H /` * ! > ac`H 0  >:">:L  >:` !{*`lH /` * !  H 0d  _ 8H /` * !  H 0 H JD  = 9H /` * ! 2$ 0H 0` ?%4`Kؐ" %K @# k  v    - ->  929-㿘H o*@ a H 0㿘`!  > a   *0  *0>: "" @ >:">:"(㿐>:"'H'L'P'T 'X  ,  H> P `8" 0H@ 㾐#> cP $cP  : 2  cP (`8$ (0  :    $ 2    />j :T  cP`8"0ɐ 9 2  cP(`8"(0  :  cP` "`2   >  @Q  2 8g0- ">: 8 2% >:" > a""  " "  ` 2` @"kcP 2  cP" :` B3  ;`> bb> , b@  ', '''H /f * ' `` @``8&`cP`  "` H 00*& ` 2" &@> a`&`(` &`"( W >+ L >  * iِ 0 $`7"$0 i H 0㿐  9 a 2 `/a%  > a( Pa 2  > P,`7",& ``" 8`  $"   ?ܐ"   ?"    ?`& &  7є        & 2  > cP` 7 "`X&<@* @ *@@ $@ >:4` a4` ,`a($` a ѣ$`4`  8  `8,` ` 4` /@ ,`78> &cP`( / "`(> #P  # &a 2 `  `?쒂B>`  ?쒂B;  㿘`    *>:<"8!> #>:b'L 'P'T'X"` 'H  , 2   `6" 0 #`6$#0u 82 `  # ` 2 " `6"0] 8ǒ ؒ#` Q"`@ە @ے   2   6# ?$# ////ܒ 7  7 8H # :  B;   7 ? @6   >9 @G   !"6 8# #`6g"㿐a% ```> a ``2 > @> `"  `6F"_    ;F  2  > `"62 70K#V @4`  f` &  ?6 ``$ $` > $`$` $@c`#```(? ; B;`(a  `<* @ *@@ $`>:4  a a, , , 4 C4 4 a($ a $  //  & 㿘`    *>:"㿘'@`  0  %@> @  ? `>Đ  >!  >}!82  Ā "C   >  `  ̡, < h (@ d$ 0> @' " $06 2 `@ @>Ȕ P@z  a `@ $`$a'@@'  >Đ@ ʔX>Ē 1!p 㿐\'` %@ `0e@> @ 2 ?  @  >Đ!o`>!2`>! ".`````̡,`< h`(@ؙ d$ $`.`  `>Đ"`I >ݐ"H ?W '= @' `@n@. `@ $y$`dT,@" >"h``$6 `2'`<`*g`(@> `̀@#>>Ēb `$``<`(g@- d`̀@`0>Đ b`Ԑ  $`>Đ"ޖ`>r#>Ȓ P@ $3`@@6 `T&?  @=  `$`$`d,"TZE0""0 H@X%@` 2" >Đ@ ˔X>Đ!p2`԰  X{'@&n  >:# U   %$ N     P@? ,`@`T d 0@ ѓ: 2`>#0@&  @6  ,`@ P "`>#X@&    8@  d`T*,` T "`>Đ#ϒ@ @   T@m:-`@`T@e:2 Ȑ@A 2 @8 2 `*` * ?@@ 0?V W 0  H@:` *` * ?  ` *` * @ @2>l#"  0?Vs  H @>ʔ!@ , @@%@" ,``T d 0@ : 2 >;# d T: "$>0# 8`@ߠ @>:" WV>:b ` %`    >:" V V~ @* ,``T d 0@B:   d, "T @`T d 0@ : 2>:>ސ # >Ő @@ 8`@ڤ W@ W 㿘& Ȁ f<@ 2@k,eΒ@: @l<@ L @   *@ @ ?*@  >˔ @ "9 X  @04 `" >Ő Hܖ>p h>Ő Ҕ& &  &b&   &  >Ő@ >Ő O԰ 㿘  , @ @ @  @ "= 7@ߔ , , #P*@ 6@`& `&  &#P 6 #P*@ 6@`& `&  &#P  @޼``: @8``: ,   8@Ո & : ,  4d$$d   0d@p%@ &@g @8  @]8 " 6 #P* 6 `& `&#L &B &#P 6 ,#P* 6 `& `&#L && &#P , 6 #P*  6  &#P 6 #P*  6 &#P du 㿘 `\@ۡ .? 2I`8`t @  @``M .?   @`@ђ@` `,@v`@Ē cP*   6%`&cP 4: cP*   6`$cP- `X )& * ``*  " `@0 $bd `8 d`Dd``|*"@ *`@ @ԁ*``8? @| c`8㿘  "`,/ 6`,@@6&@  .`,@`,@   ܲ``,@"  㿐 .`P T': @/? 8? 4  cc.@   d, ?Sz @`H"U  > L#Ԁ  > LT  T 0 $ @ڥT>!   @"U@:c `   ?":@ ؘ  8#@"   @"U@:c `   ?":@ #@  ># *` 4 ?" #*`  " T>-    @"U@: `    @"  * *+@ $ ?$ $̀P?$̒@` ?"`  ,S㿐 .`P  2 02  bb̒.@   d, ?R @H"U  " #Ԁ     > L0> LSې   $ 02 T@S[08>  . 4@ ,`@ "`8@I  L@@ٱ8 $   @"U@: `    "  * +8`@ 8  $"@ $ $̗+`P $̒@`  4 "` ,  " S0M@}  Sg 0B@6" $   @"U@: `   ? " *@* `@+ $ "$ $̘ 4P"$̒@` ,`""` , ?# $@*`  # aR㿘  `H @o` " 8`( @`@bU c``@ `@ > 2 `#X" 8%P`ǐ |a’@G `@bU -`T@`T@  @"U-`  @`X@a* a @В @a a@Œ@Òa @ؾ%Pa@  @,`U $`%P@,` @,`U 4 U`@,`U $`,`U d@ؕ a\%@ | `@ߓ* %L?,#\ %TaJ* R? ?>Ő  >!2%T,#\ %Pa/* R`@"U@c``@@ 3 2( `%L?2%Xe` `@  `: $ >Ő K >ߐ!( 8@= 6&`(o , `@>`bU "``cؒ@@ ,?@Ȑ`&` Ē& ` #P*` "` |@W  |`̐@ @O `  |`@ @ `  @%P`@; * `@"U@-` Ԑ@ `X@`* @?4`bU -``T@`T@  ?".  `` 㿐` .`T6`  `y`t.@   d, ?PX @ HbU "hԀ h.$    `@ 4$@ `$@ ` `$T@ Tv"@з"8  @\`: l:` * &  *    *`  p   26C @4@"U@`&@  2`>ɐ!P@$_`&`*@ @b".>!p @ޔ"8>!@@P0P 㿐 .`P  2 ް __.@   d, ?O P˰ 0@`H"U " #Ԁ > LP   $ @ֲ  :`b \  ?&:@ W 0` `:" ,  @"U@:" \ @Ђ 2  @ "U@ " \ @q 2   0>Ő!x> !@bU "  \ *    *>Ő"\>"$ 0 @"U@:b \  ?  &+@* <?$ Ȗ P?$Ȓ@`?"`  ,  $ P $@ "@O^Ր㿐 0  @> @   8T@>     >Ő"8>"h@5$@ > ">!@0 ^^-@   d, ?Nz O0@`H"U`  > LcԀ > LO 0 $`@ը0 w`@`bU >@c``@@  2 ` >Ő">4"@"U@"``cؒ@@  @+`-` $`ĐP` $`"^6|@λ|^0@c@γ^*|^&@Y@W^ @RP^@Ο* `@"U@-  Ԑ@ `X@^* @ 4`bU - `T8?.@`@"U@:c@``@   " $  : :@ `4?@ dT > 6?`$@ `@"U@:`c@``@  : *`"; " @ >Ő">""U@"``c@@   ?"  *@   +`$-`$`$̔P$̒@` "` `@"U@:c@``@ 8 " ?$ ::@ @ `@`"U@< c``@@ k d`$8 " $`$8̐P#@$` #@)#` ``$`P`$`"]5|@ͺ|]/@b@Ͳ])|]%@X@V]@QP]@͞* `@"U@-  Ԑ@ `X@]* @ 4`bU - `T@`T@ @ "@ ,M㿘@㿐` ,\ސ@*>`#@w` \\ɒ-   d, ?L M0g@`H"U   > L#Ԁ > LMސ Y  $ @ @bU 6`b \ `: 2 `>Ő#HԖLҀ 2 >d#h@"U@b \  +@* * 0@*$ 0 -  $ <P $Ȓ@ `    "` ?$ P?$@ ?"@ ,M 㿐 0  @> @ " $>Ő# >#@*>Ő# @̷\-@̰* \%  dࠓ, ?L  MH?0T@`H"U` " cԀ "M9 E?@80 @"Uc``@`@>@ .T > ! @   @"U;`c@``@    ?#;@ 2 `@ @  >#L`?㿘@` `, & : ` , `@:bU "@``@`81>;*!P@  ?"? * @ +`@"U@ c``@`8!P*@  ?"? * @Ґ 2 >Ɛ ` >B 8" *  9&`,  `@"U@:c@``@  `8 "  :& >:;@ c,.>: #@*   `@*+``8̀ >Ɛ Xi`> p 㿘%$lh>`.`# (.> . # (.@.%$p@6`8('@ . `. @ ` @ '@,?`8('@ (> @ ?@ '@ 4/  &.  &`*` &%$( ? $  #T( 㿘>ƒ` Ԙ   P'T\'X@x <0 @ ?'>G Ȁ 2%6P8 @3 ` S @P ` 40`*: ࠀ8 <20ऀ@8<0D L 03 /0#`T#\ݒ `P+ ;   @}m<.`$@   $X`Jl K .`P* : ࠀ8` ऀ 0?I٘  `".P<D L  @  c?I " J0T#`T#\q :0* : ࠀ8 D2 0ऀ(0DL  /Tߚ n  K %X`d*@ " T <@{ H" @"  Q$'@ I 4>I * @'`3'  0T  'Ķ0 Kfd'.@ <"T@8H I"`@ 2Ѳ*  $'`$ 'M ` ' JU C2 0  0TW  & 0K#d'.@ <"T@H IX"`@ @ * $ &'X`IDI ?0HȘ h-@H*  `;@* @T0T K &0 JϘ d'X.@ "TH@ʞ<" @%@* @X* `$Hn IUj I X0?Hs I0 J 'd.@ " T%I II@  @0`0@  ""`?*` * 0H: ">%!@X*` H$ HH > T@] "@ $$㿈> L *`" *   * ''`X <`   ?%  @    ?%      `@% `%   % %  H`B = H  " % `*`" *  * %   ?% e, 4 ! !5 5  ` @hW`@a`* W`` @@U`x``?* `d`0, G찒 "U H0  "`x>y!h@  H* @ U   `X < @GHD 'T   < `2  ` ` 'X @:`  ` `! " >+!@B   !  > & `O @f 2а@z & ( & ,& 4& 0@>e08 e4   !T#\` D T 2> @zW@z3`G]T GT !`&    @z=e< 2`PJ> @   !T#\` D T 2b > `P * :  8 e<2`0 8e<`0 eD `L @y< T$ H@ȠTI`FT`0GT`0  : D`P@іB?'`t$ '`tV$'`0 :` 'LS <. ? " "@ . $ .% `!&    X'H HS֔ <SҔ <>  (> B > B! T b[?'`t"@ '`t V9ܠ "@'  `d/ @P 2P  @ %`0IL@  {ޠ? +` , ! &`P* :  8 e<2`0 8e<`0 eD `L < @۴`J,`  E` 4`0`P`* :  8 e<2`0 8e<`0 eD `L ` > `P`* :  8 e<2`0 8e<`0 eD `L # >!  `T:  ˔< @H  0. ">l!Ѐ    H ">]!!> " &!&! `& ?@ 㿐  ''P'X    tUY?P@ג0:  Ge `0" > B! `, "`,`0`< `8$`0 $$`T>!yZI PFYXu"?"`H0  0Rt, "@@*` X < @ Eh 2'Ft?T?&@,  d. ?? 2'@0@?@ P @ ,  d. ?_ 2'@  X`0 $`0EX"㿐  P @ϩ 4 0*:  8 %<2 0 @8%< 0 %D  L  '?Ds E0 %< H @ & '㿘 8>;P/  @(+.`   '@;>:>:,@@2  8!/@/ 8/`/  8`@ڈ 㿐> #4> D*" *   <* ܓ:`  T@  ;"5 t 0@20 t \ +  wĘ 2% t` @2  t < " t T4 t: $ t>\"0 <> T;  "@??>Ӑ"p t ʀ㿘 8>>0#  >@ `?>@ * @ * *@  `?>@*` @ `?"㿘 8 >  >0 >.@>@ *` @ *` * * .@ >@+ * .@t"㿘 8 >  >0 >Ɛ .@>@ * @ * * @ .@ >@+  .@I"㿘 8 ">  >0 >@`?>@*` @*` *   `?>@>  "㿘>" 㿘>#㿘> #(㿘>#H㿘>#p㿘>#㿘>#㿘>#㿘>#㿘> 㿘> P㿘> p㿘> 㿘>ސ 㿘>ڐ ؁"@  㿘>ϐ!㿐> B!> K>  Wtaа  >> #!> KWl h >#!80>>>ǐ!`ahUє 6 h@   ?"U 0$> a""`쀢 2""@"`!`   Ԕ YNM @Ԓ DU @ǰ  NO l S Ґ!x<*@$<< @ @@  L Ҁ    Ӏ  /<* $<@]  Ӏ <@ L Ҁ  *@$< <@0@a E<@B   `sӐ !t[ u L р 2 <@>>ǐ![ Ӱ !V Ӏ   @В  ,   ,@$#L    @\u `0 @&(&&$&&,Q] < " > c &    "<< !!`si s uU v<@@#    ` 2 W W )  YM Z`" @Ê  YL Z`@}$ L Y`@s$ @Q 4LN l D`&@<@"&  L Ҁ,  Ӑ  , #L  <@   ?, Ӑ@  W/㿐`D `XאP ``VJ I ``  ]< "@>"`` @ʽQ`@ʶ`* Q`` @J@ʪ`x``?*  `d` , @`0 @  x@6  H* @ Ni U % BVl0Vix< '  `ry   \ td  >"0`h ?sN " (<` @ܐ?@ FH!T\@@0@eg8Aː o  ` #P"P#T"T *N  h h#@40 "0A %(@%@D@  4?@ ##P 8 0 4Pe$  d@*@ ?@I 0ܒ HMҔA 8 Ӏ %$ $> ,  #T%$"@ ,`>''''bV㿈 ?YӐ ~X > K hu q`  \  s a`<   ?r U `h r| " (<' @ ?Ƙ   F HaT%\  O 0@@eg( , В ?L р , Ӑ`, `<@>>ǐ! %L!  %L?    !@! h  %` HM h h#@0 "0@'`  ,  4@ %$  ,*  n  @$$#P 8@ 0 4Od%  d@*@ ?H  HLє@' 8@@@%$ $&a , @ $#T%$`"@ ,@`&a&`d "`  2&`h`  &`h`<%( &`@&`<%`%@%` t %`  d%`$ 8%`(,````" @y"`" , $#L   ,@$#L Ԕ!`J"`Ԓ" @%0> =aHX 04 : @Ŏ B?%0 8 <%0%4 <%0C Ӏ    #P  #L  , , `<@   ?, Ӑ@j  #P " 쀢 ?  pʖ` ` ے ؒ &a㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:  :`>%0 t : @ %0 B ?>%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿘6`<` @`@? 9L Ҁ 2` Ӑ` `, @  "#L), e `  ?" ` Z8 L Ғ  `  p:?T`#PK H E <*@$<$㿘<  Tǔ` % , `@ @   , T `o` p``qo 㿘!F aTe\ "`4>ꤐ"H&``0&``(&` `8M``̠ &``<M`(@< d$&``M`,?&``Ȓ D@ &` `TK# Z `K Z!LaK l `D`@+  㿘` "  < `  p ``R ` `pL` 2&@`q S` 㿀 L`Ѐ   L`Ҁ  >>ǐ"X맒`>;"h>ݒa''''SՔ耢 2< `` L 2䀢 >݀` < 2  nԒ` o 2 p @ VL`Ѐ @ɒ 2㿐a @ & >   Pі > & #@! >ǐT  ט >;" a$ $$ $@$ "R ͐0g@|L༠@u* L @ @ix`?*  d , <0 R:=?&@x H* @ J$T$=>  @. " R%& R$  2,tr `$ $ X < 2, $, $$  &㿘! ` ( FLi,`@  F@ ˔  2@ "`"`㿘  ` `4?@ѐ *cP`8`0`4L>%``d@*@  >R  HI`@=)`8< 2`8&`8 6 `T`d@" `h >. ,`> L`$` `hI HeL? H"Pe, 4H8 H"@"H`:0<0  2 >5` #\"> >ǚb#!   Ϙ @ ,㿘`  ><   -0   -0><  P T>:#>:"㿀   `>>ǐ"vb`<`X @ `2  2 >>ǐ"ab ( >>ǐ"Ybe0 ð 2 e4@(0 2   b'@c  '*@: 8 e<2`0@8e<`0eD `L  e<`0  *= 2`P@(`P`P+@:  @ <>< P  ?#\#`$A2$ '` 4'`*:   2'8eD 'eD `L '?#\#`: ?:Ә '$$`@$6`H`Hb ;'  b 4a`P`8]`P "; $x'` >>ǐ"炒b` 2<1 "#   >$>ǀ $>>ǀ "  <`  @"`` @ `  @"`0 2 `>>ǐ#Qb# Nb` % ``0 @ 2<4< `` ` @      ڰ  '``  ?耦 `P@: ` <0 @`"* $`!#\ r`< @ 8   @   < @mU '@m/` @P`* :  8 L20 8L0    8@ @@ @ "@&Hh  H@ɐ "0:*  >< T  $B  : :w  " `  $ ` 2r``(` " `  "` 34 ` 䀢`    !@ @``& @ b $`<``  !`   㿘 < 2   "   <@" a   `?H /d * % p m  0*@$ 0  p a  0 @W  0  > #0"  P &K  p  0@> `"@     0 $ 0+7 0` $ 0H 0` 909M RH /d * % p  "  *>ǔH T H 0Ӑ +H /d4p* %p   `k< >ǐ#XQ`H 0    `? 㿘  @W >  6#$  㿘 `"    "@      @  ` X  쀧 >ǀ` >>#`'@L@@?"Ȁ "Đ@  6'Ę .`$* &`" `` 4 @6 * .`(  2 @` ` '@.` (  "@~ 9D0z * @V  99 &L : `0"2 >Ӑ#`0$ , $`0$`Tl> B!`,`<", `H*Ā`$ !`"   @: @6  .`` '@ @ @ .``H ?(  "@ Đ? 'Ā 9 ```"$8Ґ$, &?& 㿘 X!&`&   ` ?` >ǐ#b^   &@`R  @ >`  2 ( % ""@ "&&& "  @}   @t@ &&:& @ܖ `" `2  >Ȑ  2& 㿘>+!>   O> > "`"> >  ࠅ(  @222㿘> B!>  > @ `* @ "  @2 @2  `K > 0 2  㿘> B! T    ʐ> औ@>  * @``2 @`@2 @   `2` * @ @ &@ " "@ &    2   "" 㿘 >6 !    D >Ȑ O2 1V 4#  X < 2 @ ?@ !   @? &   !& 6 `    !`    i MВ  㿘>6! "   D >Ȑ N < L$ @_ h' < 'Ȑ `' `' '&  ?° h5 @  @ X < ?  ; [ 2 TKY/ @ is J "Ѐ` @`gkJے Ѐ   @  iM `Te K,Ѐ   @ i8`&g; N ''耥'䀥2 X @"X  ?'X! L?' |  ;    2$  8$ $   *'$ Ԭ  !;   @ > a0 '$   `  "`ܒ'> a`D` 'ܐ "`  aB 2` * @  * '   " 6Z  !:@ ֬ 􀍡2 H?' H`  >< X @Ԕ   >Ȕ@  "" @$ P '@`  `  ?"@`@   '2@䀧 ' @&@   "'@ " `2 @` 2 X @ $@ ` "e`@$ `z$ '`@$ @`    &t܀ | '$ 5 2L`   2D @"@  ;f 2   $ taB 2` * @ *  $  耏a$  $ tؐ'@ $ t@ $ $ t!,#  ~ $ $ xА($g ?@YW:" ܀ 2 `> a`D` "` `  `    8> >Ȓ  @א `      < $ 5> @ >$ |F @Af+  !$ t" $ t  2XI_&   " ! `! "IN  `}&g[ x ,̀' @$e g   2X`   Y&`(Q$g/ L @# g&X ` `e"06Ѐ( @%e   H0&   2XHސ&  Ѐ  @f &@9/ 㿘 >`X!8 გ  D >!`㿘  ""  @ >Ȑ ? @ $>c!h     >Y!x @   J `@  J   㿘`(2 >Ր!&`.``@l  X @ < 2 ..㿈 `t  ?` B `!"a>߭! #\;  "  2``":  <` @f$`"6 Xa@`L` H @ @" fa`   ` : ` 2 `` : <`` a:@ t  ?`t  " "6  ` `"  ?֔`t  @0  : 6>!66>!6?fm``)$``x %: ` 8`` ` e`xa@:   @ ``c㿐`  !:@ F "@ *` t "@  !:`   @ 0 t "  2` ``?``&`&`6``X < @  t 2u 2  $ 㿐  !: @ !"`X @ * ``` &`&`6``X < @2D e  $ `   2D ?` ܐ  #\#`#h#d#l  a 20 ܀ 2,  "(   4 M  .`2M  "  M .2    D4 @8  `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# Fܔ X `찒 <   #`#\ #d#h#l   a5  2>)!܀ F_        -  㿐 `   &@㿘!KN`@  `0`4&& 㿘> `Ā  {"` 㿐 `` &` a`@"&F & F LLLLLLрѐќѨѴѴ``Ҽĝ㿘 >6a* @  @ ( "   r  㿘 >6@a* @`  @  "  "W  ` "``D?2"`E " <G$ `  2   `"` D=``5"`> L"`` > L`H @"`:`H`> L"`"`> L"`` > L`H @"`:`H`> L"``"` 㿘  ` `<`>!*` X <  А 2   @"    ,`! 2 JV!   6"> L" > LH @":H> L""> L" > LH @":H> L""""22" " "D:"$"(","0"4"8"@"< <(@ XL" : 0( @( :H < "H:P㿘     T ?2  ?2  ?2  ?ݰ  D? L? T"   @$`  @?c @? $` @ @$`` $` @`  ` @  2X ?" X <   @ x ?2< ?"" $< "l  " X a "Xa < ] a  @   Q $?2X ,?"5 X < 2D a@͒!: " $ X 6 ` / $?" ,` $` ,?"a` $`a` , $  ?#@  X <   @ N 㿘 !@ : "* "  < b"!  O! _ 2 d"  <  @o@$ 4  @ b2 @a 㿘  a"a a@2!:@  !:a  - 2 a!:; laa a " ^$a $a֐ 8і 1ϔ Ɩ0% >o"p2`` $`  ` 74`  ` ;4`$a $a !   㿘 `<  ` @2   ` "     ;` a  \ C0BB㾐  $ >"< 2 X`vf X@`n^   ^ `a0Q`#`WA ` @`M7 `` `a$`4`$`     ֔ " ``?``$`$`4` "   ޒ `I B/㾐  ` ``>0=*>0:X @ B @ -`(2X>k" @ 4'>d" `/``9 /  X @ 4`>J"*  $` b >"`$` ` ;$`㾈    ''$$ >#X X@  "0X@_耥BA耢 A_|BB0L ` ߰   ` ْ , < а _]A|AzAA ? %>ǐ#  %>쀢` ^ ]z #@ _b   @ ` @ _Q  <  :   ]  耢   ] _3 h  @J .@     _ K $`  A]   `$4$      ^g`  ] ^`2% # S`" @   O@2>#@=U A   `2[``@>#`% #`# `` `a$`4`$`     ``?``$`4`$`   ````a$`4`$`    ဥ`  @G`@>@>ז#``@2`>׎#p""`  `" `a@"`a  `<  `  B`  B 0 < 2  2͒ ` 2``?$``?%` 2 ```?`4`$`` ` 5`%`   !@ a` p ?ǐ萂 h ? ? %># <\쀢   ">#@ 0V@">#  >֛# #@  !  ԰ 2  `$a $a 2  Ɣ "`˒ a`  ? ? 04` $`Ԑ "`<4`$`@"` $``$4$     2X X @ ><>< \ tؔ 6ѐ`''a   #\`"  . `" <`$`Ԓ @\"А`H6 a     ]d ]`а  #ԔА; 2  "`< `"@ $$4`$` $`4`>5 >}㿘  @  " @>Ր0>g>e^  R   N B`] 2`E B @@   @"`9$` $     ` $`  $$ Ւ /```$`4`   ?4 $ X <! @ @? @@ . > >㿀 (`  @N /  " @ X @@6  5ޒ  <`$ <   #`#\  #d#h#l  X =ː㿘    !@n $" "   Z 2N  "J > >#  #"@@ D  4(    "@ < , "@ " @ "D @42 8$    @  2   @8" "㿘 X @@ 2   2  I   Z 㿘    T㿘    `  T㿘   T㿘` \<? >g# T P@2* T   T[) " T 0$ 4($ 0H /d * % ,QH 00,?2 T H@U <$ @ T?2 H /d * % ,2H 0  >8` $ DH8*` @ 㿘 ?   >Ȕ 2   #o  >  iT  >  H!b!  T>] x㿘 >7`> a`" 8*` @㿘 >7`> a`" d*` @㿘   D B>6  ":>6  "> L "  > LH`B ":H "# ?> L "ऀ ">6  "> L "  > LH`B ":H " ?> L " ?">6#> ab* @@ > (      $ "     㿐   `P` #\ 2 㿘< >6`aX 2 @`!$ <>"@*` $ 8`; > a &  @b*$ @$ 8<<$ =$` -` 2`H @ $ @`H> L  <`H  *` * " *  * " * <`H&㾈$`> '<& `  I ;0y  $a  `-$a 2  , "`1 a`  ;s;q0Y  >64`$`2 aX@  " <`4`$$`a 4 2  B "` ;4`@"a` $`a`    2Ҙ 2@ߒ ;'  &ג ;`$` $`4`; P >< 2 >< 8>< 8 8 < "   <2  2  <`@  4$ " @   2  `@" "  2   , `@  " "  @  2   N㿘> #X#X?@  >>>ɐ ` B`6@@ @& >!.`@㿘> #X#X?@  >>>ɐ `Δ ^`6@@  & >ѐ!@.` 2h.㿘> #X#X?@  >>>ɐ `Ѫ `6@ @ @>ѯ!h.` @ 2 >ѥ!`"   > ! €   .` " >я! "   * "@  $  .`"@㿘> #X#X?@  >>>ɐ `a `6@@ @& >f!.`@ 2"@>^!?@  +  ?.`"  * "@?"㿘  &   &  $    " $@ $ ?   @ 0@ 㿘  ?@0' &    ?&  $    " $@m $ ?   @}?0@x?㿐>5`> >#\ b  (   㿘> #X#X? >>>ɐ b(p ` 6>>>ɐ b(д 뀠@?#> 2 `ِ` ".  * 2  * & & & && & $&  bǔ &  b  &  b  &   b  bY`    @*㿘  >   >>>ɐ b(e! ͒ b ʒ b ǒ b $ ?">  b>  *㿘> #X#X?  $ P" @   L>>>ɐ b(:!7@  2@>>>ɐ b( .!86@ `@& ` `$ ?@ 0`$ ?@ 6`" @ `$ `$*  " * ? ""$``,2 `$  ?  b-  -`$T b?$`$- b  b   b ` & `>>>ɐ b(H˔!% `*``0o*` $``*0h`*  @Q`$` `*0[` * @@D`$#$``*0L`* @5 `@ $`$" @( `$2* *  $ ?$" b$` $` b b ?ݒ b㿘> #X#X $ "   P>>>ɐ b(h]!2 L` @ 2` , @ "   `> ! € &` 0 `,   L@@6`` *`  `> ! €` &`㿘   , @ * @`>@ 2?># "@@   & & & 㿘`P 29 "+`$> c``$` " 2 ! , @2@2 ` @ݔ@* `$`$@@`$` &`L"@ &`P`8 2` `8 ?&`89> `$"@#X?@ #X>>>ɐ b(Χ"v2@@?;> `ː` / .2  * $ $ $$ $ $$ $  b $  b $  b $    b ޒ b`J W`P    `8 &`8 & 0H6! `L*  * @ "   `"@ "@  "   * "@  & &`L * "  *@В  ? $    ?$  $  ? #X` `$"  ?`L@2 `8&`P ?&`8&`L㿐`P V- @*  `2>ɐ# $A`0 2=`(   4`(>ɐ"J @   #\   @:  `  ">@>@Aא @7Z??$ "`( @ @66`( &㿘> #X#X? >>>ɐ b(ͨ#\`6 2 >Ͱ " " 4$>ͦ 8 2 @   &` `" &@㿘  b*   & $?& $  @*  $  8"`"@㿘  $@@* ,` `  8 @&@ 8 $ $ " & .`$8 $"  @@ە,`` - `  8 ? @R@>7 ` `  8 @$ 8 $ $ " & ,,$ 8 $"  <> @ @-  - 8 $ " ,`,`$ 8 $" 2@@@@,`㿘 6@9  5   * -    , @&!  *@"@  @?  +   ?*"    * "@ ?& @? #@@q ̀㿘> #h > : "a> "`@"㿘> #X`|`x" 8$`|><!8. @   b>ʐ >w!  " " > ȖȀ`""`" "Ȑ @`x `@$`$`x> $   `"" `" > X|  |> ` > X "` "" " 㿘    0  @D !  " ( 0  ?>>>ʐ!a h  $ 0$  ">  4 (! €@:Ð@> `> & cX`"` "`㿘  @J   & > cX`p?"`p   0    .2 ." 0㿘>  Ȁ "!   @6 ,`@  6  @ "   `@&  2  㿘  @Z`"$ ``" `>> ˗! ` @J/ $`  (?> #p @4 (€> ! €@4W㿘 (>` $ * @ @ >` 2  2 >  !|  &" $& > &   @ܔ @㿘`  >D ̬!>@!` @7 @   `1 >>>ʐ"(b8!\* @ "@   " ?" `"`"> !Ғ 0` .`@"@㿘  @0  ( 6' $ $,@`" , ` "  @I > cX`p?"`p  , @> Ĥ!  & $ $+ c>  6  , @ "  @I^ > cX`p?"`p  &   c> "t{㿘> #X `  . 2@><䀢 > >ʝ" ̐ $ ?$ $  "䀎` ><> 〢` >ʉ"  "> "tž  $ $ $ ``*>< 6` @ : ! 8  c ( $ $>e".  c $ >[# @ `  ?$ >< $ $$  $ $ >  $ , ,"`0"$ 0㿐> a  "a> "!> !>5 "a> >ʐ!cH X   C#\> >#\"tcX 4  9 㿘@ " 㿘@㿘 ` 3 0&  ,`" 0 0"`0 0 ,"@    ( ">  4 ( ! €> #`@ @)@8  2 (`  & А㿘 `  > #`   * 9: 3> cX  8    +@; 8D  ;`   @ 2 (  >#`cX  * :  >  #`:`@d2`*  *`  2 @ `  ` `" @1n >  g   $@a ` 2^ $` X#X :F4 @1 C` "  49>ʀ 6> 02> 0 21 , 2-> ! €@2$  0 2 , 2 (  4 (> ! €> #`@6 @Z@7Ɛ #` ``4`` 㿐d@g   Z  ?K@1 4> #`@`   ` @  O `* ` ` .`@  #\  @5  ? ( .c  4 (4 .  ( `!  >  `4 (&> #X  :D '      2~> y> > #`@ `!  `4 (>ʔ" `4 (& @0 2 (#\  @5R 2 .>@ ` "` @  `* `` .`@`2@1 (@G   " ( (  ̔?@F  (?# @4 (@6ɐ0?> #X @4 (€&> #X  :Dy 㿘 (   >>>ʐ"(b8ܔ$> ! €> #`@ @,`&@@6  "   "  >>>ʐ"(b8Ǻ%     >>>ː"(b8Ǭ%  㿘e @FI 㿘> !`@ "`,0  㿘  @,  (&?  $*@" +  6   *`@-@ " (&  + 2 < $ 6  , @ 6  @  2  &  㿀> #` .@  : ' #\'#`#d? ",  &  ( " >>>ː"(b8 %ϔ @E ?(# @2(> "p @> ! €@/> >  㿘 > ٓ* @*`"@*`  [>א!xV>א!RP "!> ?F> #X :F !> ! `& (`@2` ` (`` `&`>> `!"  !> `` &``&`` ?,&` Ȕ ! ``@2` ` !>  >< & &&  & &  & & & ! ! `&  "`$$! & $ " 㿘  ?1&   >   >>>ː p`W!9    & >> !"   ` $"`$ $ "  6  㿘  8 ( \ ` > B  a T X  `> ّ*` * " *      0&@ @ `&B @ `<> `@  > B  a ( >@9!) > #X :@ D@ ,> ,??   > B a  㿘 & &   2  $ >͔       > B!`" ۔ 2   $   @p  2  *  ` > B! `   $ "@ @*&  `8 " `( ` > B! ` &   & `. `8     l   8   > `  > B!` >@9X!@   > B! t 㿐> #X `"    > B!!(b@ "b@> B!!(bD "bD    0  G "5#\ ( `! ` > 4 (cX`А "`   > B  a 5 > P"Y C > B  a $ >˔`" H2     @1  > B  a   > cX`>˔"`@8א!p   > B  a  > X`" @C  > # #Xؐ $ ` #> B>Ĺ! `a ֔   @a ̔  ܢ  $܀ P` ( " ( (?# @` 4 (> ! €X` > B  a  > cX`԰  G"`Ԁ 2  >>>ː!a^!&@B ?& @3 ` > B  a ~ & > "X@@-~`  ">  `L ` <"  > B  a `  > cX` "`'L > ><cX!8 `? cX'D".@ '')'ؑH/` /> !8`܀` `H*``L:`H 0 ` '  '@''` 1> B>! `!  @쀢   !    $ܒ"@@*'`8  `(!   '  '耢`H< @ > B a Ғ ̰  1> BH 'HL H 'HH 2 8 > B(  > B!  @> cX` "`P  ( D> B!   D 0T><*` *   > >>>ː!aM"#` @ 2 8 $"2 ?@  .      'D      L$@ H  T L ' @#.` "`  "` ( 2` 0 2` , 2 `> ! €@+ߐ`@&.`> ` `4$@  #` .  `         . > #`%@.@  @R  > `ؔT X?;"@ X@ XX1"?"@+  `'> `0 #> `( ! > @+ِ > cX`>  "`  4  H   0 `П@> #X```  @#`#\` @LX ` 0p`2p'L> cX`X 'P"` 0$@@8C  P#\ @ T#`#dP I'L E @`65> `(  >>>ː!a0##$'L@+W > cX`>  "`@ 48 H   0 `В@@?(# @2(> #Xâ``'L`- @` ``>0>"X  0`@ 2< 9#\     @.ؚ 2 > B a  >@5Ð"Ր@+F> ! € "  `0?"`0 ?"  . 2.$ .(  @ 5.5(%Y>  U> #Xa V&a   #\   @.  2,  "> BS> B a  ph@ >>>ː!ac$@2`̰  ">˒`&`@5]"o@*(?# @5(`Lܖ ` # ? &#X `"   H ؀`40>  А @ > B a R > #X h p  >>>ː!a$ >@5"(L  @)(?# @5(> B@*5> B a  L?'L ? >>>ː!a%.  8 @ L  > B> B!!(b@ "b@(bD "bD    !> #X  "'P` L`4P܄ " `8 `#\  T#`#d` ` `>>>ː!a%W > T>ː#   ذ#X ؐ & ` "`>!   @    ܠ  & L (   `L` ^"  > B a   -`L`( L? L( > #X Ԓ`"  $  >>>ː!a-% E@)a L? (c ;2 (`b > #X! $!`8 2L0 ׀2#\Ӵ     @-  LL`( L L?(# @2(@)+L> Ba    >˒`$ @3#0@)o(!?# 5(> ! €LL`( Lː L#( 2(L  $@-  @-'L>ɐ#@ L#\8@?    @,  =LL"> B`(  @(LL? (c 2 (> B a  > #X`p`h@ >>>ː!a{&M@`̰  &`K`>˒`&`@3r#p؀?"> cXa"a@(  > ! €LL`( LL L? (c 2 (L@( cXa  "a `Lܖ ` 큒# H ؀`40>  А @ *L( "((?# @5(> Ba  H > #X h p  >>>ː!a&>2 @3 #؀ @'z. ?(# @5(> #`@$  G(@("( "(ސ(?# @5(> Ba    㿘   @ 0> #X  㿘 !> B>!  ! ڔ @ ! є 㿈  >>>ː!a'2 H@ > L >>>ː!a'@@N t@># ؒ >| ` @: `$>>>̐!aX`'N@  (`@>`  >>>̐!apN'Q' H #> @~#> cX ><aP `2 2`@: > * \    #  2`@: `2`? > `\*`*" @ * @ "cX@&cX@@ > 㿘  > #\ 8  5><8` !> B> `!  8@E8`!  ><!4   > B"@ > #4* @@* 㿘  %> B  >ʐ   > #\ 8  @  ؔ 㿘> #\@ 8  @ ɖ㿘> #\@ 8  ْ@ 㿘a(&` @,><@  &` ><!8   "" > &`  @   D`"\@`㿘!(#>< @% ,a8 & ,a8@&!(  :`0  88  :`  > 8(X(   : P㿘!(><!8@ Z H /m4N 1* .N 1  @Z| , & ,H 0> & cX` "`㿘> S   J1 2, 2J?* @ "@@ $  2J1  > > K>̐"  < > ScX``2 @> > S@0א!> S㿘> S     .  ," @`2$  2  L 1   (  4 ><!@ @ @@$`(    2 ,`> X@* 2@   " @㿘H /m * .  ,N 1 ?`& ,@YH 0> cX& `>< "`!(8@  @}E㿐> #X 2> >[!8  @ > ("`X@&@ @@nl@,W@(n 㿐` ` ?@ | =#@u " -> X @  8   a +><a8@f   TX QX 4* *G F $@8a8 $  $ >͔    /   > B!`"  2   $ a8@@@a8` > B! `   @   +><㿈>'> "!8> r"!4 > > > a"a0""" ""> #X#!L> "!!"?"" ""!> #!P"!@3 >  @$!E#'& #`#\ ?@ 9? !>o!!><"!8㿐\`@> #\#\#' *@ #` ?@ ? "@>N!Ȑ&@n  @@ 2 @>="@$@@ >-"0㿘 >< @ %> >>>̐"`bp !KX &2  *   @H  @#J >  ( ">  4 (#`I6@ @)> #X@@ 0+  (     $ 2 $( ( "X  4 ( @ @) 2 㿘 ? !> >>>̐"`bp!#X &2  *  4@p  @" %#X`( " `.>>>̐"`bp!  >>>̐"`bp ! >>>̐"`bp@y!@)@ #X@@ Ӓ0? `<`  ` 2`$, 2)`$(%`( " `.>>>̐"`bpM!̀  >>>̐"`bp B! >>>̐"`bp@9!@) `2` 㿈>  @ %> >>>̐"`bph"!X  Hc#  * '#`#\?@ ? H  ><D@@> !8 H" 6  #\  @& ?(# @2(2 `>@-#? > > #4  X В4 @ X&@ϒ㿘> #\@ 8 @@ 㿐 2>  & >͔       > B!`" }͔ 2   & > #\@ 8 @ @ > B!  }  @ 㿈>  @ -> >>>̐"`bphi"X +> ` @  H#'* '#`#\?@ *? ><O !8` H" A` @! "(  >I#2(>̐ Ȓ" $` #\ @&8 ?(# @2(> >@-##` В4 @ X&@`Ĥ` @$㿘@ 㿈>  @ > >>>̐"`bph"#\?> !0@  H#'* '#`#\@ ?  㿈>  @ > >>>̐"`bphǔ##\ H@  L*@ " @>  !0 H#''#`#\@   >̔   > 㿘?ǖ?㿘H / * ' > #XW`?H p@㿘H / * ' > #XH 0p " >m   ''''''` #> B>Y#`a |v @ 쀢   a |i   $ܒ"@@*'`8  `(a  |U '  '耢`Y L ( `6  ` $   ؒ@P `ؒ@  8 ؒ@ ?  ?> #X@Π> B a |  `> #`*@& @ > Ba  { 2s' Ԑ": ` @# @1 㿘".     > ! €  &@+" V`P   # !?> T>͐#0    0 20> ! €0`@&0@ "@ &@㿀 `(`  `P`   @&#\#d#`   ''     р  > B  a {m   '  `&  #\#`#d      ݰ?> T>͐#@  x Ӱ > # #X ؐ $  ` 7> B>#`ᜒ {5   @ᜐ {+   ܶ  $  (  `L ` "    > B a {   $`(  Ȑ `( ` $ >ϐ P€ u @ ? (c 2 (k `0   > ! € `0 "`0@@D"@   &@"@`@&@8R `( { ? (c 2 ( > B  a z (?&" `0 2  > ! € `0 "`0@@"@ &@`( K ? (c 2 ( 㿐8#\ > B  a zi >@*< > # #X ؐ $  ` 5> B>3#` zP   @ zF   ܒ  $ ܀`"r #\     @# ?(# @6(@"@@ `@s&@ X&0 > B a z  "M?鿐>@) > # #X ؐ $  ` 5> B>#` y   @ y   ܒ  $ ܀`"  Ā #\    @"  (?# @@6(@ "@ &@㿘`@ ? "@g `㿘`- 0  >͐ ?$ 0@@ 0      ( "> >͐ r! €@$% ײ㿘   {{ @&㿘& $ ( & & & @& D& >& H& L& & & &    yF & & & Ho o> 88 "8 "`"8& H 0 㿐  & >͔    ^   > B!`" y( 2   & @ o > B!  y  @ E  " 㿘 ?  &  H L@g|1 㿘`N`"` "N$` 2$$ @ $@" @$` &`@2"`"@@$ &&@$@&`$  $ ` $`" @w$` $`@2"`"@@i$ &P$``" ` 2$` $ $ H2$$ ` $`" @M$` &`@2"`"@@?$ &&`$@8&`$  $ @ $@" @($` $`@2"`"@@$ &$@$@$``" "X" 㿘2 ` 2%& &` ` &`" @`&`` &`@@2"`"@`@$ &&&`@ې&``"`   "      2)`  `2$`  & ` &`" @&` $`@2"`"@@$ &$`&@$``` & &`  2" ` &`" @`&`` &`@@2"`"@`@~$ &&`$" &` @ &@" @k`&`` &`@@2"`"@`@]$ &&&`@V&@`"` ` "  ` & V"` 2)` `2$`  & @ &@" @*&` $`@2"`"@@$ &$@&@$`@` & &`  2" @ &@" @`&`` &`@@2"`"@`@$ &&&`@& " 2@2& 㿘@2`G` B  " 2 $`" &@2$`$@@$`"f ``" &@2"`"@`@$ @" ` 2" `@$    0`` $`" &@2$`$@@$` u㿘@   `  @? @ ` &` &`&`  &@`6$ $@Q$ $@  " `  ?@ &   "  20"   " "  `@`8`  8㿐 $ݒ? `A ` (  L2  >>>͐!0a@ `$"@` $`$  L2 `$>>>͐!0a@̔  " > !>!>͐!#\ 4 \?x 2` $?  `? " ` )^   >͐" 2? D` (@"+  $2```@ $ >͐!?>"( ?!>͠!Xٔ?㿐><!h> >͒<"<""`"` "`"`> >͔$"$""" ""> >͒"""`"` "`"`> >͔"#"" ""> 8"8>" #!hc " " " > !"!" #>  >  hb  " h"` `!>5 > >͐"4c8#\   > > >͐!Pc@ `   4#\> >͐#,cH#\ `  * 㿘 >+! $>  `h  "`hH 0   >͐"H#", X!8>5 >͒b@N > #,  , X >͒b@N > !Pܒ , X XV $ $&`( "&` `0@ B >`0&`  P  L`L  ( & `$ ` $ "` "     L2  >>>͐!0a@|  $"@$ $  $ >!   L2  >>>͐!0a@_ $"@&M&2 "`8   L2  >>>͐!0a@@ $"@&.&2`8  Y (0 `( €㿘 >+! $>  `h  "`hH 0   >͐"H#", X!8>5 >͒b@M8 > #,  , X >͒b@M) > !P , X X}&`$$ ` & ( "`P 0@ B < 0`P `L  L (   L2  >>>͐!0a@ $"@&&2  & $ `$ &` "     L2  >>>͐!0a@  $"@$ $  $ >!   L2  >>>͐!0a@m $"@&[&2 "`8   L2  >>>͐!0a@N $"@&<&2`8  g (0 `( €㿈`4  02 4   "     > B!` sD `?`   &  2'@" ϰ  2@ & >͔    P   > B!`" s 2   & @\#d#`#\@"  >  > B!  r  a< "a<  ?   ><>>>͐!0a@X"!8  H@" r`$@@m (@j`(e"`8` `0"@BZ@X`8 S`<O`@K`DG`TC`H ?`P >   7> `$  "`$ `"`P@`P  `$$`$    L2  >>>͐!0a@B  $"@$ 0$   2  & 2 ` (@"  @` @2 > ` "` >+! $>  `h  "`hH 0   >͐"H #", X!8>5 >͒b@K; > #,  , X >͒b@K, > !P , X@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8$ <$ @$ D$ T$ H> #` *  ߔ $ P$ L$ L$ P  ( & $ `$ $` "     L2  >>>͐!0a@  $"@$ $  $ >!`   L2  >>>͐!0a@q `$"@&`_&```2` " `   L2  >>>͐!0a@R `$"@&`@&```2`  @& `$ @:&  > B!  qf    (  >   @  "  $ (  > 8 8". 4 `  D` $ ("" @*$@   (  @* ""   2$""  㿐@?\' @r  ?@ @'&@ L@     (     㿀`'X'HXd  >>>͐!0a@x$M@  H>>>͐!0a@$NH`H@ @ 'H`LH@0@`H@ ``(@ $'HH @  $'H@H`L@ـ@ א`( "'` :'`ڰ  H#\j 2'``$ '  H $@ `"`$@:$:  `"$`*$ $ * (: `` '􀢠`$H@ *'H#\ 2p H?`lH`$'H`#\ "`Y3?`'􀢠> >>>͐!0a@Ԕ$`"`*'*$'H#\ך ?( $'H?@qH H?@yӒ'HH`L@@ `( "'` *ܰ '`H&2#d#`#\㿐 H@* L8@8?  @l 2  &      ( &  ('&  $& $  H"  $ H쟐 8 "9 ( ` 2>   >>>͐!0a@#%t2 > " € ><!8 H  $"@  (\"  8 @^k@><!8 H  $"@  ("  8$ ( ?$ 8 @^Y $ 2  &   $&   "  "   (`   L2  >>>͐!0a@Ӕ `$"@&`&```2`" ` (@`  L2 ` >>>͐!0a@ `$"@&`&```2`  ("& $ '  *T $& 㿘 W H "  P>>>ΐ!0a@%߀  >  c` $ L" 2 p 8   (  X"  X ( `" X@  X  H /f * ' >   h& " hH 0  > #,#> !P 2 H㿐> #\ H@  .@ ' #` #\ `?㿐 ` 2 `$2} `( 2y `P s )  @ > 0$@ ( >ΐ Hp> "     >  > 2 > "`&  @"&  $ ""`   (    L2  >>>͐!0a@  $"@$ $   2   (@`  L2 ` >>>͐!0a@  $"@$ $   2   &"  @?& `` (   L2  >>>͐!0a@i `$"@&`&` >l!    L2  >>>͐!0a@L  $"@$ :$   2 `"`    L2  >>>͐!0a@-  $"@$ $   2 `@^``2`Z&  @2 `&   $& "```"`   (    L2  >>>͐!0a@  $"@$ ڐ$   2   (@`  L2 ` >>>͐!0a@͔  $"@$ $   2  X  H /f * ' >   h"" hH 0  > #,{  > !Pu  㿈> cX @2>̀ >>>ΐ!0a@&ސ` '耏`" H>>>ΐ!0a@y&H' 6 [ @'   '  & >͔       > B!`" l 2   &  ` &@` @> &   `   '  (` `$`8   `   `8 ߀ ` "$ ऐ`">+! $>  `h  "`hH 0   >͐"H#"/ X!8>5 >͒b@E > #,  / X >͒b@E > !P / X " ' ' ' ` `$"@ ' $ ' $ (`' (` "€  0@B   ? 0` 8' 8 @ <' < @' @ D' H' D P' P> cX` L4  ' L   $  " 2 ( ' L쀥 `' T' T% ` $   (@ `  '`   (@`2%ऀ    > B!`kS਀`?` ଐ &ଐ  @   ऀ > B! k2 ٠ ``耢 `" '&   *'& ' i  (f`W`$@Z9`  ' ?&   $ "  "   (``   L2  >>>͐!0a@ `$"@&`&```2``` (@`  L2 ` >>>͐!0a@ `$"@&`&```2`'  '`  (@``" ऀ  > B! j    > B!  j ` ɒ `K ऀ  &>͔ ऒ  ऀ  > B!`"ju਀ 2ଐ &@ऀ > B! j_      > B!  jP 7` `@㿐 2 H & >͔    _   > B!`" j) 2   &  H@* L8@8 ` @`$'`"! ` 2 `$ `( `P 2 `8 2  "`8 " ( :`0  > B!  iՔ 㿐   & >͔       > B!`" i 2   &  H@* L8@8C  ` @ r ' (  2N `@2I `@ " ` *`8 7 () `<&`<&`@&`<`<>  8  ` `$ ?  `H 2` 2` `$`  @  2 `@" ` *`$ > B!  i: 㿐4] 6 X  2 H & >͔    M   > B!`" i 2   &  H@* L8@8   @ ϒ (   ($ D "  * $ > B!  hڔ  㿐 2 H & >͔       > B!`" h 2   &  H@* L8@8G   @ u (  (B4 6 $ T > B!  h   "  * $ > B!  hp  㿐  >>>ΐ!0a@x.);2! H 2 H  & >͔    |   > B!`" hF 2   &  H@* L8@8Д  27  > B!  h" ,  @ (   $@:    |  x   " * H ( H "  $ H $   * $ 2   > B! gה  2  8 2 "  <  ( 2    Ԓ @ $^ H < `$ H $$ ( @"  (` (  (?$ H    $8 H 2  > B!  g    ("  * H   &  '> Bᜐ gn   ( @  H 2  $Z < " Bᜐ gS >,! 瀊`&   @>!?$ H " * H  H? $ H $ H $[ 2 H 2- ᜐ g #  瀊`& א ᜐ g   g >ܐ! 瀊`&   㿘  >>>ΐ!0a@x*9`  & >͔       > B!`" fД 2   & `!` D (@" `H "`` &`H`$`@2`H `& > B!  f հ `  & 2  D > B!  f ð  (@  `< " ``H 2``$` " `@ 2`<> #X  2  H@ @(   > B!  fn   (@"& `<`"``H  `8 2`H `2` `( 2 `H` `$ " `H &`H`@2`<   &  )> B! f:  D  (@`H 2`` `$)`< "`F! f" >! 瀊`&   @>! `< "``H?&`H`@2`< D@" `< " ``H? &`H` &`H`$#`@2`< ! e  瀊`&  ! e֔  㿐 ` 2  >>>ΐ!0a@+$ 7> B>  ᜐ e  H@* L8@8I  ᜐ e ̰ ` `8 2`$  (`@"` " `ᜐ e  `` *`8 ` @'`P@  `(>>>ΐ!0a@H<+B o`m><!< "j` `$&@ "b` `L, V>  Q "9  4G>΀ D> 0@> 0 ?>  , ;>  . 2   "3> >>>ΐ!0a@`+" > >>>ΐ!0a@x+! €@ ͐> 4 0 , > m? $԰> "> #X` `4&@`$@@#@         2` '`` @ c@ᜐ d֔ 㿐m @  (@" ` @*  `< 2 `$@ ` 㿘>  "4@ 㿘 @u  @ %`@S @S & & "`  ఄ ఝ㿘 `  @֐@f@fs& @㿘 @i` 2z`` 2` $`>͔ `  ``  > B!`"`dQ` 2`` $`` `$`> B! `d@ `H`L` 2`@ $`>͔ `  Y``  > B!`"`d#` 2`` $``@`($`H$`L   `L2  >>>͐!0a@Ԕ  $"@$ $   2 ` > B! `c 0 = @f@e& @㿐 ? 6&  2  & >͔       > B!`" cŔ 2   &    H L   @R{> "4R&㿘ऀ 2 $>͔ ऒ  Øऀ  > B!`"c਀ 2ଐ $प(L H  (D8`" ` >O" 2D>I"耢 " 4 2`   0  >+! $>  `h``"`hH 0 ` >͐"H#",`X!8>5 >͒b@ #,  ,`X >͒b@<2 > !P  ,`X X P  $ H>  c` $ L" 2 ͖  (`"  ` " €   ( @ & $` @ $`"``" `   L2  >>>͐!0a@ `$"@$`$` $ >!    L2  >>>͐!0a@  $"@$ v$   2 `+    L2  >>>͐!0a@j  $"@$ X$   2  >+! $>  `h``"`hH 0 ` >͐"HG#",`X!8>5 >͒b@;x > #,R  ,`X >͒b@;i > !PC ,`X X`P  > ` c``$`L" 2 ϖ `(`" `8` "`8€ `8$`H $`8  @ & $` @ ( $`"``" `   L2  >>>͐!0a@ڔ `$"@$`$` $Q >ݐ!    L2  >>>͐!0a@  $"@$ 뫐$   2 `"P    L2  >>>͐!0a@  $"@$ 댐$   2 P "H  H    Ί H  P "-e( "@8  @ " 8> "<  $8 $8 @  > b`<`$ ` 2 8& ऀ > B! at H0lThh㿘> L @w  2><> @ L><!@> Kb2  : @ 㿘> S ` J`1   2 ` a 8`` 8```2J`1  ><!D@$("@*` 4 $@``=#'`` ` >*"*` > L @ 0> X !T>4 lĘ {>h> #X X'z" \ \ ` _T Q*$ X@pI d$ LK > #X \'z ? X `  _7 4*$ \@p, d$ P. > #X `'y " X \  _ *$ `@p d$ T ><!@y -㿘 @pٔ 0> S 8> ,20J1`+>*"D*` >< ><  6 !@ :  6 !@ :  "  6 6 2,> cX`& ,`` `l"  & `l` & ` `" & `& (& & & & $pppD N N㿐> #X@  `` *  8 2    ` ;> B>Ɛ#(`a _ } &`( "  >>>ΐ#HcX : $>>>ΐ#HcX  `(@"j ` d `$@8`8 ""`(`(  8 >>>ΐ#HcXl  $ 2`(; > #X 0,`P    LT$  @ ` `0$ @ C  @ 2 > #X ؤ`(  'a *}8a  _N`݃ `` @ ` ``' ?  `7> X  @8 @ d  #  '>@@ İ   В  *'sI 2 0  % 0U   (`<  D  ``@3   0 ,?`% 0~ 0> ``< 2   2   ?     \    @ N  @   D  ? `  7     2 " X Ę *  : b 2@ ( #\;` d #h@  '   0 ,?`% 0~  0㿐`@`` `  "`> #\ @ @$ *@`/ "  )> B>#( ! ^* Ŕ! $ "@ ^ "  `  `<@㿐> #\@`   <$ N>@58I   2 & >͔    |   > B!`" ]ܔ 2   &    > B!  ]Ŕ   > B!  ]     㿘> #\@` @  `   #@  @  ɘ     㿘> #\@` @   ` #@   J@   0   㿘> #\@` @   ` #@  8 >+#p*   @    @    @  x㿘> #X @`   $ *  @:   2 H (  #!:g "      㿘> #\@`   $ * @:  !:gt "      㿘@`"  !:gX 2   d  2 #㿘    㿐\ `Ұ /> X  :  2Ȱ 2İ `2@@ *  &@@  1@n@@`??@ ?`< `?@`' # @ ` ?e   `? `?T  ``< s q 2/ / `-  #`#\ S 2 T 2  % >͔    zk   > B!`" \5 2   %  "X`` 6`H   > B!  \  @@@   " @̔@0> B!  \   `@H&(H>  `> ଔX3@P( H (    2  2  $ 2 H `,2E`,`.@"`` > `@ `.? > 2`.X `.!0 @2 ``>  Ȁ"`` > `@ `.? > 2`.X > X  `,2`, ,(2 ,> ""  > X  .2 . 㿘 . " .`"  "`> "  "@ .?# > 6 .cX`?"` .`6 ,  `0>>>ϐ `0x ր "> > & &  &  "@"  .>  6 .cX`> p "`€ (  > #@ ? (# @6 (`.!0 @2 ``>  Ȁ"`` > `@ `.? > 2`.X `,!`.@"`` > `@ > 2`.X > "@"` 㿘 (?c > @2 (㿘`(?> # 2`(㿘> >< 4 #`P2@2: > *` \ @   @ `2: 2? > >>>ϐ `09!; \*`  㿘  >  , ,`@@  " "``$ >  "`" >  "`" >  "`" > > A"Ԓ (# T# P# ,# X"(" > ><aP`"!> !  @  > ,` \   `aP" @ > cX 5><cX * @r`8-`$, @@ju P @I> A 3> `\`@"( `>ϒ$@!P>Ԑ!, "> "@`*`Ȑ ` "(  !%@ `\@1> " 4#X 5@  8 #X @`# @c#X 8P`@ > A! > X> A@*@&$!> ><*@'T  "P  0$      "(","`"\"T 4$` "X"L㿘> #X #X##X#X ">h!` "#X `#X* "㿐+> cX)><!X`.!> A#> A! @:ݒa$ ! %!Xa$8  @ $! $a$> A> A!$ ">ϐ">3!*@ " @ɐ 2> >$!# cX 㿘#><aP?, + >  ܀ %> >"\` f ` @ @.` `  @)> #``*@& @   ` #@ aP 2?>"H$aPv +  , \   r aP m ` 2/?` )> #`* &?@ @ O#aP 2?>"p$aPD +  , \   @ aP ; ?aP?,4 + %> \``  &> #``*& @   #@ aP 2?>{"p $aP , \     aP  ?Ҕ 㿘 I     㿘> #X  >J">ϐ"D ><>?"P >#>Ϙ #H  >#0W > \  2><P\ , P><P `?  > #  > \ +><P\, P+><-> aP,\@, ?, \  ? $@$`$` $` ?$`$`aP $` %aP@㿘><!P  >  \ +   "   '> ,  &, '>  T+>  P, cX -><,`  8 8!  > #0c   "" ` H /f * ' ଒?" X" P`:" T0` "` $  "@ cX$`2 X  P* @` `2 X  P*  "`$2@  X  P * @"`2 H 0> A!(8o㿈'><>P  P $>> `\,` ``    @    ;`  >Р  P|#\P> >u x>r > !>m ȁ㿘\`   3> >>>А `ߔ#3> cX 8  :   >>>А `ʔ#  <@ >  @@  D   > v 䀏   ` cX`  8` cX``,4`(`( > B!>  耢@> a"@     ` 3`2> >  *@+`@ *@+ @ %@> 0 > >>>А `c#̒ +`  +    ` ̀`>А!H_` "`" "@cX`?"` (! `$?"`$ (! ` "``  "`p * I > 6 (6 *& & & 96 .`5cX >  $`2 `X@ `P* @H /f * ' &  & ""H 0 &   ` & ` " "  (  6 (` "`6 . ? (# @` 6 (> "@0 㿘 N` (  > >>>ϐ ` #`>  $`2 `X `P* @H / * '   " "`  "@H 0  `"  "` "`   "@ (?#  @6 (?" *&  6 *`F *>  ( 6 *` & >>>ϐ `o > #`>  $`2 `X@ `P* @H /f * ' & ` & `"&`H 0 &   ` & ` " "  (  6 (` "`㿘 (`W 0 ?# @6 ( (  > >>>ϐ `" #`>  $2@  X P* @H / * '   " "`  "@H 0  `"  "` "`   "@ (?#  @6 ( ?" *&  6 *0 " . .`?# @6 .|&  "  .>>>А `pȔ$ " .`"  "`> "  "@ .?# > 6 .cX`?"` . ! 0  `2   >  " Ȁ`"  "`> "  "@ .?# > 6 .cX`?"` , > cX6 ,` ?"`  (?" @6 (&> `*   & *  "@* "  > 6 .cX``$ "`><!T$ 4㿘 @),` ""` ( " (tD ( ?   ? `$€  `c  4 (`# 4 (`@ۑ,`㿘a%> X``$ 6> > ଔ  ଔ*@ @ 2> " O 02` "`$` "@X ?"> "@ (!,4 (` $`" $` `$`$ X $`"$""> B! $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ 㿐>  ؒ>    > >>>А!a A#`><aP `2 2`@: > * \    #  2`@: `2`? > `\*`*" @ * @  >>>А!a` C㿐#> !$a8 #\@  > "`d> > "`\a8"hI@> A> A"a0"4?$?"  ><, !\    ><㿈  )> #X#> .@ #``d'#\ ?? 3> B!> `耢> A4 > A>> !0!0@:  "4@'>>>А!b h > 6  "`h>> `d \"qH )> &   >>>А!b ڔ  (  > >>>А!b Δ `d Ж 4@#X޲@㿐'> X > Aa0a0.@ > A"!4r 9'#> `d 2`d $ >͔    p   > B!`" RƔ 2   $ `d > `h `dr~"`h`d` > B! `R X .@ >  @A͔@  Ԓ 㿈 'X   X`@ 4 ? @?耢4 ?`(?+> cX@@lkb :  2  @ ( & q&cX@@lVb*`&   & cX  < CB(UW "N`. 2`( "G`( 2`( 2`(> #@ ?`(# @7`(`( 7`(`( ` +> !`7`(€ 2?&* &@ &D 4  耢4㿈'XX```` ;`#\`  &'@ &  ` ``@ o  2 N L `E@B 0> `9@6!` `  `. > ` " #``@k`   ` `@ `@ `  '@&@ Ր㿘 d @[Y 2@. !"@ "  > #`@kG  є @`( "@q @(` '?. ?# @2(> ! €@@ ( `$€  >>>А!b ߔ"# @ 2(> "p@@> "X@@@`( 2`(`㿘>5 >Вb@*  >; h& X& > !  &  "@" p?ԁ㿘'> X  8: - 2  2 * #>5 `>Вb@)  0(  4`"  0 2     X  H,Ӑ@,$@  H S  `. 0@ "` ` >>>А!b [#F ` `( +2`(" ( @" >>>А!b C#X( @2> ` > "p@ > "X@@@?(c 2(@( 2(͒  > ` 0  > ` \ "> `>> `"L $>7ć*         㿘 H /d * % >  > B! <@>\#h>+!: oڐ 8> #h @n4"H 0㿘> #X` @_ `: $`< : @ $`< `, @$`<$`<`< @_i, $`@ $`@` @_a $`H㿘> B!> " H o@> #d>  >Д "m %> X! `C$! @"    @_6 @$ D `$ D  @@ D  X@FX, `2> o\> 㿘H o$*@e%>   >ДԒ" m$$`H 0'> X% 0@X8  : "@# H /* d % X@ H 0`> #X`, E> o J0n`0p> #`@: * 7  2 * #p#p'  ' `  ` !> #X%  @ *`  `` `' `%> X! >  $! @`@'耢 "`.!, $!,`2``2+`(`  >>>ѐ#c!2`(`0  ?>>>ѐ#c!`$`04`.`( Xa0 ^"a0a$  "a$  !0 S$!0!( $!(`( %!> `. 0 > cX`p "`p> ! €5> cXa  5"a 21% >>>ѐ#c8Y"##X@ * @4"hp $ `.>>>ѐ#cPD"E `0  #Xu` #X h l  `0>>>ѐ#cx+"X  2`(`" `.` "`.@Ȓ `" `.  #X @hH` ` j `(> `.` 04`(@ € !> #X` 7"` " `  `@ % @h$` H`-#X @: '@"  2 `(?# @4`(- &@ % > #`@h` @ `&''  "@@c@> 7 '' > #X4 $4   ;`   #\  `8 `$8$`. "WU@T'G 2`(> "`(mt`(?# @` 4`( G% > ! €@'+ & `$€ @  '耤 > > "p@ > "p@> "X@`( 4`( '耢   . `'耤`I `G`㿘%> Xa \$ae``@6aa L$aa  a`d >  Ē`>  ̒ > Xa  > `d >  > #X "@D "@lh@ > p > "" > k g .`2   2  (   >>>ѐ#cƔ$2 ( 0  ?>>>ѐ#c$`$ 04 . ( 2?`- .    "  .@O  ?"  (c 4 ( . > #`@f    R  @6  (?# @4 (> ! €`> cXa< "a< 4 (`4 (㿐 ?>>>ѐ!a h] f !> >>>ѐ!a R g#X#X` * @eu  u8#X ( , @ ʬ )> #X!>< !P4` 2`@: > * \ @   @#@   2`@: `2`?Z#X  !P`32`@: > * \     G2`@: `2`? 2#X@d> `\, `)@*" * @ . "#X*`" * @@  4?  `@ '*`" * @ . {à @='*`$ , @; (2 @    $ * *`@ >   @"` "@> #X`?"` (!" *`$?"`$ *  6 (6 *6 .& & &`& `"'` @' > #X@<@ > @@ D > kQ 㿘 = .  " >>>ѐ!a <! ` "`&  "@ 4 .$ʐ> `*  $ *  "@* " > cX``$ "`><!T$`4 2 .R㿐> A"!<> "c> >ѐ!P(  K > K!Д!> ` "!,>   ">>"0> "`#\ \ xU > A "a8>"h> >ѐ lb#\   ~ > >ѐ!pb#\ x  } @㿘> A<  "4 "$ $  $  $   "` " $ << $ < "`"<$ M \&  &$D &$H @2 $ "$D$ > cX`d "`d> A<) "! $@ 2$D`$D@ $H "dH$H@  $D"dD> Xd d  2$@ 2 㿘> A!<@  "$  "@ M \ 2㿀> A!8    #`#d#\x  ">."&$,&$(> A< " $( &$D$,@ $D 2$( 2 H`-> P  J%@  > #  &25`> A!< `,```#  $  :> @d|`* 2`  $ 侔$ `$$ $Dd` `2`&հ a:TR АP``2@> K h  ° @ * >ѐ"$o " @>"    $" 2P  D'''''% P@    ( 0 2 < " >  ~"c` \ K ݒ    h0Q`˒ `  \ Kl$̠ \ Kg  @Yϔ$̐ $ $$@< 2? $< `S$$Ȓ] \  KF$$$$$ ">"@1 % < 2$S$$Le \Lb \0y 2     @א P헐P I 0+> Kd@`h @@   <  2 4  > ٓ* "@4*` `" @?! @  `hX+ 3`    ` D `hX  L&dP&dL< * -> 2&`X@ @Y* <  ?   `><_ ald4 "al>є ; #\ ? \ uښ  &d0 v  "`h>j#`h(> a x X D  瀓:` X*  * :@ $d0>R# v  >>H#H#p$@>ѐ#ؐ`> ? &`cX&d`h  "`h`h@ h 㿘`d( d,&`q 2 `d(d,@ "d `  ?&`d$@" d@>>>Ґ#c$m < Rdd@> Kd@ h  @ 0 d> #X h d" " hWd@ >ې 0~ > Ad( d,w!8ud0K) \㿘>D> " MY㿘>D> " MM 㿘 T: 2* @ > #X@a͓*   | 2d( 0 (& 4& 0H /d * % ۗH 000$ @b< d@* <2`    >Ґ PuH /d * % ?& TH 0 0@ 㿈H /d * % 9>  l{c H 0 % % % %% `<>2`*   `H*` `&`@$L$@: '@Xs  씒 ?> p"$LH /d * % % < @WԒ `"4H /d * % 7> p{ H 0`0 @$ 0$ <$ 8$ 4$ H=  $ T`,>E!P"c!$ ,$ X$ $ \$ p`d 2`<$ `$ d``""@$ ``<`d""@@8$ d`l 2`<$ h$ l`h""@$ h`<`l""@@8$ l T$ t$ @H /d4 * %  !   % $Tq9@<H 0 >D@TH /d   p|@  * %   ?`%  `" l`0&`4(&`0 l|'cH 0㿘  ! $$P&  &$x&$0@\`t "`t  $$P6 $x2$  ?& 㿘 t>5  >Ғ`@_  < @`@"@ " $`@ ?$  4 2$  \ > > !p{Ԓ  "`@`0($`0 $`4  2' 2#>  l{ 2 "  >>>Ґ#cҔ& 2 >  l{$㿀'> X d $] > A!<`"P``"G`   "?$D$ $ 48$D$0   #`#d #\ ta 2)$D$D`@ $H$`"dH$H@ $D"dD$$D`$$H` 2`$`"$D$`$ X $$ l "l$($`2 ` `2` ` & 㿘C$$@"$$㿘?98> #X`d  >>>Ґ#cA&2 $ >>>Ґ#c7&6 $(>>>Ґ#c,&$0& u,  >Ґ!$ "$$ `l"$`l㿘@?@+ 㿘> #X t'D  $ t>>>Ґ#c@&쀢2 p  ?$ pD@    p $ p㿘)> #X66>`@_` `* 2` @?@    " H /d * %   > B> `! ` +> `xސbLH 0`   `> K!P !&`0&`,&`&`T&`H&`pH /d * % 7> KАo&`\H 0#X`.&`8&`<&``.&`dH /d * %  t`" tH 0> B!> ``02`@ @@>; &`0&`X, .`02` `H /d4`\* %`\  ` bL`\ "bLQbLyH 0㿐> #̀>!X0JΒ  \>!p0A F5$̢ \ F0 $̒ @T $`$d@ 3$@  \ F$d $d>d!޾ !> B>!! _ d@dG= \G: \0! 㿈#> cX   @   Ж*  "E'cX$@8@   đ*   * '4 `##` #\?k? 2>  ē6@   @  >  ē4@ "  $ Ā`!>!>Ғ"`&   㿘 Ԁ@> & #X`>ȑ, "@: ` "2 "  :0 B ; @] 4  @  $Ȱ  p`  ( ( D Z8 "<>:" L= #G$>@ 8 Ԁ > Xȑ* "* 5  ( #* @#@ aH ''' #\#`#d#h#lr  @ D #`#\#d#h#la   @ D &28㿘 >~"P > #\@ 8 ɸ@  㿘> A"!@> A> >"aD"T  B˘ 0   >Ґ"!  & >Ҕ" ` > < 2  > `4*" * `@ "  " <  `) ` q&  "m> A@@ & (@ ("`,"@& , "_&  `!&  > `4*" * ` @> B  `h@  @ (  @X   > B!@ "  ><  "& b.& & !p& &  & &    & & > `& > A@@ & (@ ("`,"@& , "& 源 b " 㿘 ? <&  @  ?` & @    @ 0+`&     @     & ""   (`" , ,"`, , ("@  " >}ܐ"Ѐ & aÐ㿘  <  ?&  `H&     @o    & >Ҕ " `  2     & >}#(" &  (`" , ,"`, , ("@&  a㿘 (  >}#X> ! €`&@7 `"&   " >}s#  b"   (`" , ,"`, , ("@  " >}]# "$ aD$  `> #X`@:* '2  2 * #p '  '`'"'`  8 ;    ;`D    ; @[Id2`*  *` '2 @ ` `H   B "'  = ܀`2 ( 4   $ 4  (2   $(  (?# @4 (   ! ? (# @4 (> #X @ :E "  F'܀`` 4<   $ 4`22  $ `, > #X @ :E ` (   ) ` & #' `"  ( . > ! € (  > #@ ? (# @4 ( (`2`  4 (25 (    ``䜔`? , @2ڠ> ! €#Ѡ`"Π (  4 (> ! €> a 4 ( € *7;`2'#\'`` ```"`>|#`   ֑*` *2 @2   <z  .@q  **2 @2   `````Q` ``( "`(_`(?# @  4`(/ ;i  `4`(> "X@`? , @)> ! €x ````(  4`(" >  > | (>| h'> ! €=`    4   "   & >Ӕ " ]   ! >_C   >& 㿘> @4 > $@>{? @@  B > ?X 8  @  ; F;`  @   X 8   @ ; ;`F  ?㿘@ 㿈d @5    '  @?3 '`( !   >  2`(&@> #X :@ D ޲` 'u s   l  @ 2]>  W 0( `!  `2(>Ӑ " ]@`2(&@@  '#\  睚 '> @@ '>   @. `( ^n ? (c 2 (30?(# @2(> "X@&@> #X :@ D ` p@6   '> !&  " \   4 2  $ @?  2 2 {  & 7> X 'г.@ D 4 $2  $( " %> B ?''쀊`@'''''  Ò! 8  `t  `|   @  耦`&@`X X@ X  `. "@NO  ?  & `] `  㿘   "   `& = !> B! & X !Z`  㿘   4  2>  $( >    % > 㿘'> B%> ᜐT = #> AaH" $aH> A!@ #> A "  X2 (  2 (     $ aHaH $ 0 0"`$aH ( 〦 > A!H $ᜐ     1   " (`" , ,"`, , ("@  =$  0 ᜐT =: 㿘 ><!><a >&@&`&`!zn 㿘`2>x!  .@     `.@ `.@㿘` >xݐ!@"@  @      .    㿘`> z%! 㿘>+ L  `@R8 `?@`> ""x` >z !0` `40@ؔ &`0>Ӓa@ &`D> "&`D`D> %> X""t>Ӓa@ `0&`4@ 2 *@&`8 <* '' @#\#` ?  >><!8X@ >xb! 4 &`@>  4 #`X @>`<  -> `T    Т@-> X@U`@* @ `8@T* ?X$`0O: ? 0$ І$`@ :`@>`< 2?`T  ?&`<&`8 H `0" `0*` ?  "6 `0 <"``0" H 0 `0>@"(`82`4 `2yK3 a4  >@Qda 2'a4 ''@ bX@ ǐ@ߔ >OL'c @ ڐ>Ӂ> #X> t2@> x*```<#X"0@( 0 0 > `x<> `"0@( 0 0 4@㿘>+ L   `@P `?㿘  >Ӑ"& ">> xː"> 4xǐ">+ L  >x" 㿘`> x" P!>+ L ` 4>>x#>RbW#@ L ` >>x"0x#a4  >@Pb` 2'a4 ''`>Ӥ#@  $`@SҒ &`< =&  &`8>Ӑ#w@ǖ`@ '>⼢N %⼐@ >Ӑ#8xSv@  @a >P'b N `4>Ӓc`@Ő@PK 2@Д >Ӑ@P;ch 2> cĐ "cĐ@+ >P'by @ >Ӂ㿘` >>+ L >>Ӑ bx@T  >>w"0w#1> " >R$ <  &">vs#p@K$>Ra#4@㿘` >>+ L >>Ӑ bx@T  >>w"0w#1> " >R$ vA#@KX$>Ra[#T@P>+ L ` $`>w"0R0`4 @a &`0`@< @[ >Ӵc&`4@ $`0@Rג &`< <+  &`8>Ӑ#v@̖`0> >"|#wc `a4  >@O|bx 2'a4 ''>Ӑ"p!>P"' 'a>Ӑ"h''a 㿘 < 2`4>u͐#? ? -   ="@ <  8 2    * *  2  &`0P2` >+ L 2` ` @r> ><2} > <@@"t ` >+ `L''`' $> "|. '䀢  ?@> #X@  ` '`'?'` '8`"' >Ӑ @NӒbp  >8@Nʒbh  2'>8@Nb` 2'8 ''@'   "'耢`">P@'>Pa3ᔰ 㿘i 㿘a 㿘Y 㿘> . ">+`L*  ` 8@ʐ `>> "| 4 tݐ > >v@  "*@  `" @  2㿘> "`?>t @2. >t x@ 2"@ 2 & > ߐ".`   >R#t@ 2  :  2>t @I >R#t&@& 㿘>+ L '> #X"#X?`  * 3@ ҂`6#X @2 #X?*@#X> #\ @ ? # @ 㿘> #X?@>  @' 㿘> " N> #@ (Ho o>+ L > ?8` **H 0 01> "?8`**"> "?8`**"Ho o>+ L > ?8` **H 0 >  L>+a(2 > "]& 㿘>+ L "   >0>0 > >Ԑ @Ma`?sԐ Ё㿘0?8 @  >+ L ?8 >   >  > *b">u" > >S"b@\ > #@ h 㿘> b >s H > ⠐*b**@H 0 > "㿘>+ L  > ? > # @M   ɒ 8@ 㿘 > "#   @0> #x > *`* @ *#b@ @ > T"#|i #> $c5>  *   *`   #  `* > #>Ԁ`!>!0>Ԕ!@t 0 cĀ` >Ԑ`$ct!H㿘>+ L  V` > ? > #\@L   ^ 8@ 㿘>tk!x  0@;%> > "c0"<㿘>+ L 2> ? > #@Lp "   4 8@ >@Lb!`?㿘%>+L` >Ԡ!  >@a 2>>r!t%!>Ԑ@L@a  0 @#> !>  a  a&  0 @ؖ(> a>    L > > ? cx> >  "c<"0 > T *  *`  *  > ##|"b㿘>+ L  > ? >@K!   ү 8@  >!" >Ԑ!@K`?㿐!>+ L   ?* *   @r ?   @m0? ?> > "b""  L  ?0 @\ ?   > !> ""$#Đ $#'$@ղ d@6>r!Ȑ#> @: @d&#> #>s`!㿘Ho o  > AaP    "aP aP?"aP`?H 0 > #X> " > ! >    > >+Lg> x `* `*  `*  `*  `*  `* 㿘> # !!>+!`d>s! d> L"`В d$!@EE"@!> >+"a" *Ө " *`ӡ " i*`%>+"@@Kے  >Ԓr"( d$ d@E">+"a#> L`Ԁ `$``Ԑ@KÒ " `>Ԑ"Xrϒ d$``> L" @E3 : >  db  b:  "b!>+ L  >+!> "*` > ""+ " L  >+!?`*`  "* " b> :  L#`"> L 6 㿐Ho o> #  > " ` '" 0>+ L``> "'`? 'H 0s 㿐> # !>+>p" L  > "> " '  L> " ""  "`0" ? '> "*? > "  L  > "* "@ L * ?"`  㿘:(;`; :9 8` / /`+* *`(@ ( `.  .` . .`D @E ` ` 43   F,   2!m!n   >Ԅ⠅(P ?`4 * (*&@ (.`& +  . (( 㿘> L Ta@C @J @C* @J &  E& &    `?  >ԓ,"R  4  6>Ԑb* R@$`& & 4& Ta@JZ@C.& @JR.@C <& @JJ <&@C * @JB & @C*  @J9&  @C*  @J0 &  @C|* @J&  &  @Cr* @J  &  @Cg* @J & 㿘> "Y`?!  >q" ư!@ > # @> L   `@- `-Ԛ> L"`!> L  >p"$ `$>@& > , " >Ԁ@#>#0>Ԡ#8Ta@C p>p#@x> #  > L` -> " )`@2> L !> " @  ' `,',',',',',',',' ' `,')㿈@@㿈@D'@#> H> ⤄ (  *@`@ ⤄ (H > H> ⤄ (  @`*@ ⤄ (H 㿘!T!@Bj!@I@Bc..`@I .@B\ <.` <@I.` @I .`'2>>!l!m`P.`>  "c> cȔ        & cȒ "  .`.` `; `7  3'  2!m!n2 8     ? >   ?@* (@*   (*   ("@㿘> # ѿ0=H > L  & & H 0 > AT@ T  > 4> TcT&c`"? & ?/! && > A"aT aT"`㿘>+ L  =  e9 %"8@p .1> #0    %3 `  #0 , `d#0Fx   @ 5 @]㿘#> c0` 5 , !> #< #@  @N* :  .@>+!@A; 2c0>Ԑ  Oؘ @N* :  ۴` #<  㿘#> c4  !>  $#8>Ԕ4! O $#84 2!>  $c4㿘> 8> #4`"#4"8Q; 㿘>+ L  >@Fː#``?㿘  0@w > "b>  >*,n#h㿘> J , "> " @ *@ǐ"@㿘`@F `? &`0>Ԓc@  &`LX:   @2`H &`H`H  >͘ 0>͔!x>+ L  0 >#>Ԑ#> "`@@Z`H>Ԁ`#a0`@@S> #t " `4`8`<@na`4!>`h@}#nV>Ԓn$#> >> c"pnJ> "J" ">>n#>n#` "`H@.`H >9!xH/ /aD@H 0㾐'pPp:   &!>  "ct㿘>Ԣc>Ԡ #m֒  "> `#>#mȐ  $ > , m: >բ  <0> D (m: (>   > ` @c m:` > >Հ` pc l :` > >Ք   s   hm >բ  T> \ : m`>m} ȁ㿘> D  8 <l  @  ""`l0= . 08" >&"`d"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!> #x  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& 㿘@p>Ւa@ & h& d>Ւa  @z& \>Րa0@t & 㿘`? >Րa@@@g$`& >ՒaP@a >Ւa`@[ >Ւap$`@T $` `  * & + "@>k9! * $`l$`>$`a$`@6 ! &!㿘!  >+ x @0 > >Ր"la㿘` >Ւa@& >Ւa@  2&  & >ՠ!& @ y%>Ր@~ t> o@ & 4>Ք b@& ,`  ` * ` * `"& 0>Ր" jϒ& 0>Ր @ђb8 4& 8 8& $@Ɣ & L>Ք bP@& D`  ` * ` * `"& H>Ր"hj& H>Ր @b& P Lͷ͵ P 0& < H 8  ,&  D@ 8  $& 1 >Ւb@ & >Ք b@& `  ` * ` * `"& >Ր!j`& >Ր @bb wu&>ՠ"А@Ւ 0@P & d>Ք b@J& \`  ` * ` * `"& `>Ր"j*& `>Ր @,c& h dA? h& T >k#(㿘@ Ā( Ơ㿘@@㿘 ւ>`!  @ & T&!>kR#P  T &!>`"b&!H&!\ T   & 㿘 > T  #@2 >k2#h@, 㿘 &   Ң @|㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@Z&!X&ƀƠ㿘 H ?>֡H` >֒`@?`4 ` >֒`@z?>+<  >+ L ? ` >֒`А@f?`4 ` >֔?`@Z'> < # !?`@M?>> 8`@C?>> <`А@9?>֔?`@3> #h)>+ L@2  ?2  ?2  ?2   ?2 & 8& <& @& D ` 4 2 \ & 4 \ 2   & \ 2!  & ! 2   &!  ` €`"!0 2!0 L >բ!0@Ք & @@͔ & !0 2!,  &!0!, 2!D  &!,!D 2!4  &!D!4 2!8  &!4!8 2!H  $&!8!H 2!L  (&!H!L 2!P  ,&!L!P 2!T  0&!P!T 2!X  4&!T!X 2!\  8&!X!\ 2!`  <&!\!` 2!d  @&!`!d 2!t  D&!d!t   H&!t㿘> !`!` 2``?2`` 2` `@ 2`>֒ai֐㿘> c  "cHo o  > ch@``@Ĕ"`` H 0㿘>+ L 2    ` >֐!@A`?㿘>+ L  > "耢 2"`>g!``2 >  0 @ * > "">iO"㿘>֚" >"0>֒"8>֖@i= >>֒"i6> "耢`>>@"i,>g#㿘>i%#>>֖@i#(>>֐#xi`>րg#㿐>!8€` `>#h2`> c䀣> c  > ?> "#c"㿘 + #`!>h֐ @> c쀢 "c>א h˒> 쀢 + > c䀢 ""cЂ$ Т@  㿐>!8€ ''|㿘 4 > #. @  `@$ ` " 㿘` @@ "$ >+ L 2  > >+ L  >  >ג`@?V`  `?#X  I& 48@ 㿈`> ,# @$ 2 a0`@"a0>fِ `>h= 0`>א h6  ```P`0>א ؀ '耤>א '2,>א ',,> c@> '' ,&&&& p1>  & ;&7  > @&#&> #  &.G.J.H.K @U >aܐRP 2 @ H /k * , @: H 0\\`\> A\ > A> A "\"`> `L@ > `\ @  >!`">>f; aT˔``0Ho o  @  @ H 0㿘`" >g!  >g{!( 㿘> 8    8,@ 8@z "L |   $ L |L آ@@ 8 8`> Ȁ  >+ L "Ȁ`  0 㿘> cȀ ( "cȑH /e!> * &!>  8    8. @  8@v`  8H 0 㿘@i @e   * 2 :@9B 㿘`2  .`>e!8@92 4 @9+: 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  *H*K*J *J*H*KH  㿘*3>+`L "ܐ  `L " Ԑ  㿘*3>+`L "ǐ *`L ȿ 㿘>+ `L " ȳ  㿘*>+ L Ȧ 㿘 >+ `L " Ț  㿘 *>+ L ȍ 㿘> #>+ L @  Ȁ  2>+>f=!H@㿘Ho o#>+`L  g  "#>+`L  ] H 0㿘Ho o>+ L  F  >+. @ H 0> > ? @( `(  " " 㿘> #㿘> #Ȓ`> 㬄 㬄 " " 㿐#> Ba   Ho o a    aH 0% H/` /1>+ L a> # $ *a P L`> # $*H 0 " 㿐`/Ho o> B!  0T@H 0> B!3> ` ``@?>צa € ?`>eK!0=x @ " >`@ 2>>א!e40& `€ &> b@>@=C`؀ Ox `J@ 2`J@ :J` ` z$?@>פb € >e!J@x @ " >@ >>א" d0ۤ"@u>@=bH > " `$ @i>@<`؀ ?Ox `J@ 2`J@ :?J` ` z$?@`L`HJJ@@`>d"P`  `$ >גd"@*   > > "c l >  -` >d" ,`>d"0,  > # " > "#@&`` @㿘` 5 % ` % `. 5. % %֒ 㿘   p  0``Ԑ 㿘ؒ 0 0 @8A  O n                     } y u  q    g  c  _ 㿘`0B  8  p 8   @@  `€   `@ `U 8   @@  `€ "  `@ 㿘 0  N L " ? . L `@? \ * L * L * L㿘     L 8 d D  T㿘>+L    " L L  L 2>># #@;w@ "    8 ?  㿘`>cA#0 㿘@  @  " d@ @ @@ 㿈 2&`P80 @ &`P`p&`l &`p&`&`d`d&`h> `">o@r`>j!&`0 `0 @&`4`P 7   &`&`&`   7 + ` " 27*`p &`p`P&``&`&`@   X@  X`   X>  ؀ " X>bȐ#@ X&`|`p  @ @n >b#P>א`Oݒcp>ח4 #xb 8 7'>+ L >># #@: *>j  " #`  04    >j  <@ >j@  >j'>j` `J2>j``J-'> !'>eܐLΖ   ' @ 㿘$ pg   * @* 0 { & @ @   #> j# Ѐ 2 aa"@   > @ΐ >  >  ؀  >א#b  6 >א >b#& >a#    `? p   *@ ْ 㿘  > 0#  a?>a֐#?&`&`ܐ T&`,`" @  @ @> "`0`&`&`XO2&>n@#!>h">5 9 &`@/>hc8apIiIea㿘 D> : `' ⌑*@ !  T &W& 4 < 0@O, ĕ:`  $  @ B& @*  :& 4& <  T @3>  ؀ & @> <  a\H /d * % N IM!!8 2 $@*0  l >a? 8@H 00 0(& 0H /d * % ŐH 0㿘 $ d&!8& h & h""h@ 㿘 ` $   & &  "`  "@`$ " &!8&  h &  h"$ h ̐&`@& `$&! >+!*!H@ $ l㿘 p "   *@  *@  * p   *@>  ؀ >`Ő `㿘 p   d  ߖ  * T "   * * *0 * T " 2 *  0 { 㿘H /d * %   $ & H 0㿘 $H /d4 * % ?& d l @x H 0㿘a"  Ѐ  $  >ؒ`p_ ?  *@ o 2 >ؐ ^`?$ ?㿘 a b?X   ? $?  *㿘>   :  6I * @  `p2 ` ` *` *  > * `  2 ,  "  Ā " # ?  $ $ 䀢$ @# ` *@"     $  $     $ > 2   ( """ ("(" "ࠝ㿘>g>"" '㿘>g>"" ' 㿘 l >_v 0@㿈 $>   l _h`>``>%!>!!>_W#0>  _P0 >  >#\ >#` >#d !(#h_<!X0_9㿘 dH /d * % >ؐ ! "& l l & l@<H 0㿘H o*@ e@' H 0㿘 "&  H /d * % @ H 0 㿐  > l^ِ" l? h& >]h"8 d`2a & lǰ $````"`& h``"@$a80@2H l`>e"*` & t$`<a$`TF$``   & l* T`ܐ * @ " ` "`F! ?$ ``$` p ` & l>+!`ap`FB:`t ` ?$` p " `0@2`@A$`@@=;  $`5 ` 0   & )    `# 2  `@`(  ? h& l$` & l& `p`0BL<`p>+! E*`#  $````@7 `̤`$a:` @8> #X  !: 8$`<- $`@@0=$```Ȓ@ >]"hH`> 0 & `ؠ @ & `/ *@ ؀ >؀ ">">ؒ"Ȑ `ܘ`]#\  & l& $&  M _- `ߒ@ ` X   R   L   F >   { 怢 " `: t ŀ 25  `ߑ-@ `k ,  `e % `   `Z   `T   `N   `H    `B  & lK`0>+! E"*`T EV  p ` & l>+! @/ 2EC `0K  >  2 > `@ (  >  ؀ >ؐ$`> ?8`* *⠐ *0>+ L #> b!?8  ,,bN b ,,b0E  <`0@K"  !>    D   | @2? t!>  ؀ " 0@>">ؔ"q >`Ԑ#` \    | 4 x ؐ ?  & |>ؐ#(\ & x x  & x & l t >`В#>؀ #@!; ?J9 >\#& t x??& x | > `ؖ ?  & |>ؐ#(\ L& x`؀``̐ " `$``$`̐  $`Ȁ$`@.`$@f d d>+! 2`@ & l&  & D%:`W DY   & l& & *    `$  t& l>+!* D@ 8 D:  p ` & l>+! @.n C'   >  >?  >  ؀ >ؐP @E d$`` " p >ؐh  㿈 d & x耊`` t   6 `0 `0  p   0& l.& l +& l!>В#>؀ #!; ?Ig  >  > > > !(#\#`#d#h[!X`0 ($`0$`4 t & t? 㿘> "6  @ "A@l"@@"c  p@E 0a ">@Qe e@ 0W !@"2V  `m@`q@ 0H )"=@* e g@ >  1!7 5   @*` " *>g @*b#   @ 2 n @ Đ 4q 0 & $ 㿘> "4` @  Ē ސ t  t 7  &, 2p@.ƒ t $D$,$0 Ő```> * `$H $T$<>ؐ#ZYH /d * % 0">+!>ؗ* ؗ* ;  #H 0 # H /d * % aH 00(24&  㿘> "6  @!@.U@.R""$ (> c$ 8Ĕ  $ 0Đ $ , @-$ 4 4 >ؔ c@-Ӑ !,4 HĖ  $ $ < 44 J 8$ X3$ $   aW4 $ $, G4 >gb@( >ِ Zc㿘>+ L   $ G   B 0   p  ? *@   *@㿘 >Z9 @ڂ  >Z/# `p2```   *` ( > ( /> =%/> %/>  4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +>+`L`-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +>+`L`+?P `-`0+-?P%/> @̀㿘`> Y P3> b @( !<: b>Y `!@>!<Y| h 㿘>+ L 2 2 ` D 2   & D @1 `?P`   ">YT 0i>_^@`@!>&`0@斠 YD>ْ`@ޔ ?&`@ 2 4 H &`< L&`8*& D  >@1L`8 2'4 ''>٤ Ȑ@駒 @4w &`< ˔  &`8>ِ W@k@鳐`@锐@欔  @ >o'C` @飐`>ف㿘 < 23`0`4=#  ?*@2`&a@M&a<>+ L "`0>Wf >*  `  &`4&`0@ &a<9&a@ `4@ >"@  `0"@ ``@ 0( &a<`4`@"&a@ `0 <    8@  @  `4  "  8  # ``@ 㿘`$   >>ْ`! >ْ!PW `8@5q  2 $& 4& $ 4㿘> "б. >ِ!`Xe  4  `"  @>ِ `XV   2 㿘>ٔ `@@ a<: 2` >X@!p ` 8`? h` >vb`8?> ,`* "* ` 0c & & &`4 > &``?&`\ # *` @ *  @>ِ!X `\  >ـ`  ! > "  ` "`  "`>  " `\ >` !>    "` >  " >ـ  !؀ > ! Wϐ >@/a >@/b 2>>W">W"x>s#>t>ub &̐&l&?&!> "  &`0Z* "&`p`p*&`l &`|&`t&`x&`d&`h P 2`\ & X`\ 7 @ ʐ# ' ''БH /k * ,  1 . 1H 0&@ȑH /k * , @} H 00` @ H /k * ,  @` H 0㿘?>  2 `  & >UŐ!.   0㿘 4 0H /k * ,  `. @ . `@ @% >+!>5 7  \ 2  T 1 ` , 1, !d  T`  X >U"@ 4H 0h>   ? 2`  6  * @ 2 0 `  4`p $     H /e * &  $`lP`"'@ "'H 0>ِ"8V  '' `  @' ` @ ' `  'БH /k * , 1 ,1, H 0$`@ \ 2 $` # %$`$`$`$`$`x<}vH /k * ,  @e x> $ p pb$ l$ t  `, @H 0H 0 `h>5"8*` € 2`p 㿘?2  > c .  0 p >5 h"8*`  €o p Ԑ 㿘?2  > c . >5 08 h*` 㿘?2  > c . >5 08 h *` 㿘?2  > c . >5`0b8 h`* @`4@ mrn e H /k * ,  ]@ "4```y@9`x@7A `z@`{@8  `\@ "  j@), `m@'`k@*%  0 0&!:" $``@u 0 @r 0 @0@& H 0㿘 l? 2`  >  * @ 4H /e4 p* & pA =V  H 4 P & p7 Hg*  H , P H~Ԓ H o4$ *@ l$ $  p  & p, `1 2   ,`1,`!d   @   $ $ H 0`l?0> # (H4`p(`p " " `p"`pH 㿘 l? 2`  >  * @`( 4``$`@" `  `   \  @,@  " 폒 2 H /k * , @x 3 c 5 ? !   " #" ` 4`@`@ ` 4,3 `d,5  @"`@2`,4& & & @ @   $ $ $@@@> $ d $ h   , , ,L    `, @> "b$ d$ h@a H 0@@  , @  4 `G `H*`F " `F `I*`F `F `? "߄ *`?㿘 4 J`` 5 * *5@     & & "@ 㿘 4 ?2  l@ " 58 m k@" 5 @@" 5@* } *5@     & & "@P  4 `5`   `D2 @ 2 㿘 l? 2` >   * @4 K 4 H /k`* ,`    `*@P    ***L   `*@ H 0 㿘 4 K  58 %  @ % @ *5*% %왒 㿘  p | tx 췐 p 줒 0,@,``@: x쏐 $ p$ t  , . L   d `,   `,  1   . 1T. !㿘 @  & @ $ $    z @   $ $  1  . 1. !/  ,  , . L㿘 5> `\  `[`2 F D F@ . D E  `@ . E$`$` ,`. L㿐H /k4 P* , P& X T& P& TH 0 >ٔ "X>">٘"`2>>""#\Q1 㿘 l>5%> `h"8*` t "  4 |@   T X `& T` & X>+!*"@  8: *``p  `,` * $ `@@  p  @ P X `& P` & X>+!*"@  89*`@@?2   ,` > "* $    .  @: x2 @6& lH /k * ,  t% & t t h@     `. `1  -`1?-`!   `. H 0㿘`p `&`p &`p `H`P{" >5`h"8 *` @㿘 4H /k4 E* , E D, EH 0  G >5`h"8*`  €  H  . >5`h"8 *` @0. 㿘  0H /e * &  .  .  . H 0㿘>:㿘>@)Yb   ` @  " 㿈` >{a`48>|c`L8`h&h&h&h&`> ,`* "* ` 0c& & &`0 > &`t?&`p # *` @ * @  >ڐ"P `p "!>   >>   >"c""">   " !> #T  * #T&``*&` &`&`&`&`x&`| P 2`p & X`p $ @ #@ 1`. 1 !( H /k * , @ H 0 >+>+` @ H /k * ,  @ H 0>+ L &h> "P>@b  >@(b 2h̐ &hh̀` '>Pl"> #8>hPe"hȀ >hP^"> #0'> cx>'#PT'􀤠> #@m>: &h㿘 0$@ >P:#0 cV >P0#00H /k * , @n 4 3 ` 5 @ ``, 3, 5 , 4(   & & $ @뿐(& x & |(  .(.(, L(   ( `.(@v@ H 0( .(@@Ho o ?&(&(@ ##`   @@M( `7##`   @@6( `"!(Ȁ 2&(̐@X #ِ#`   @@(̀?`?>O#HH 0㿘(  ` &(%.(`"   0  .( .(  (     .(>ڐ#`ON 0&(ȁ㿘Ho o 0@ "@` *@uH 0㿘H /k4 * , ( ? & (@ *@((  &((&(&(H 0 @ 㿘 0H /e * & ( 3 /H /k * ,  .( 1 2   , 1, !A  w @  (  & & (& H 0H 0 0 `G `H*`F (" `F `I*`F `F `? "߄ *`?㿘 0 J`` 5 * *5@  (   & & "@7 㿘 0 K(  58 %  @ % @ *5*% %֒ 㿘    絒  p  0,@,``@: ̐ $ $ (  ,(. L (   x (`,(  (`,( 1   . 1. !㿘 @  ϐ& @ $ $    @  (  $ $ ($  1  . 1. !g  ( ,( ,(. L㿘 mv `2 F D F@ . D E  `@ . E$`$` ,h. L㿐H /k4 d* , d& l h& d& hH 0 >ڔ #>#>ژ#`2>>###\Lq 㿘> #T   0"@ @  h l `& h` & l>+!*"@  45S*``5@  p  @ d l `& d` & l>+!*"@  459*`@@       (@k: 2 @6& H /k * ,  %@ &   |@ (  ( `.( 1  - 1- !( ( `.(H 0 0H( `E `D*`EH  `H  *(0*(㿘 H /e * & ( .(D( .(ǐ( .(H 0 㿐`* &(` `2``2` // (㿘# @ #@"(!? # @  #@?     ɐ  ܐ&   @㿐>+! /8@'ڒ#袒 $ H /k4(А* ,(Ѐ  (Ԁ 4h L`2 (@H 00   &(&(В"  L4H 0㿐H /k * ,  /&(Ԑ &(БH 0`> 㬄 㬇H 0"H  "@"  "@"㿐(Ȁ /   (Ā   (Ā  / H /k * ,  H 0㿀 ?>JX#  ` @&`$ &` N'`$ 8 " 028`4  5?@1@.?2* `4 ' `4'>~>~('''5 " `$ "0`$0"`4&`$`$"4"<`( &`(  '㿘" >I# / $ + 82 0` <2 0`` 0>IА 7 " 0>ې @ IƔ  ـ㿘" >I ` ( $ $ 0  8@2  <2 " 4 4$ 4 4 0"@6  㿘`"  > : *` @  2 J >J  㿘`  "@ @`㿘 $ & 0 & , D  " 0 2 D 㿘 $   D  0 2 D㿘 $ & 0  & , D  0 2 D㿘 $   D  0 2 D㿘 L  `2  8  4 $ #@# 0` (*`>I!>ې * @@  $  8 8 L 8  8 $㿘 P ` L? T"`8  $: 8  L 8 $  8`  L  4 8 $ 2/ e# !$ L'  P`>+!>ې`& P0: P * @?`2?` d& P>a1ɔ>+!2`@ 1Ǔ:`?㿘 ( !H /f * '  P  ? L& P`4 $ 8 D  LH 0㿘 L` 8 -` 2* `4  8 $ L`4  $ 8 2  ` 2 \ & ` \ `   & \@ & \[ ?? ?㿘 P #!| L  8 $  8 cː#  c   L 4 8 $ @ @   P d L 8  8 $㿘 P  ?& P1i d㿘 H@㿘 L | 0@2  <  ,@2 <`  <@ $@ 0& | ,& 㿘 L  ,` `   ^ 0 ?" H, ?  H@`$ H `H /f * ' ߐH 0㿘 P   L @*``" >  T( @*``# 4  T)  @* `#  '  T' @*``&   T%  @* `&    T#  @*``(   X<@4@   @*`& ``+   X  @*  `+ & `   X   @*`& ``0 ۖ  X  @*  `0 & ` ͖  T  @*``  Ö 㿘 @ L`  -㿘 P 0v d   (""4# # & 0&  0 ! A ! :` ( c  㿘 >>ےaP H:!@ (>&`@>`"&`8&`D&`H&`L  &`P@ &```L  4`8`$? b &`T 㿘`( `u "`"6`0e^0```@2  [ 0_`@2   `L 4 `8`$`L$`8 `8`$0L` 8 B `L 4`8`$`L%b`8 `$`8U02`@2 4 1` 8 , `L 4`8`$`L`4 `$`82 `\``  $`\@$`\^ ? 0 7 =A 㿘 L  $`,$`0 L  4 8 $` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,S `0 $`0H 2 L`0D   4 8 $ .  L 4 8 $ L`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   L  4 8 $ @`0  $`0㿘} L  4 8 $ L`4  8 $?b  L: 8 8  $  :` (Q c  㿘 >>ےa FӐ!x (>&`@>b0#l&`8&`H&`D&`L @&`P`L  4`8`$? b &`T㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 8 0 @2   ? 0    㿘 L  $`,$`0 L  4 8 $` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,? `0 $`04 2 L`00   4 8 $ L`4  8 $ ?`*`>  `0 `0 `0 `0 @ $`0`0 `0 $`0㿘Z L  8  8 $  $    P $        p         $ H $ $ x㿐> Ah   "h> >ې#̚a#\   ;x 㿘H /d * %  >  4   &  ``@?> #E!H 0㿘>5  >ےa@J > #=Ғ   ` 4 ?# @4 '0  `@ p@ b  %h/#\#d#`  @;   . * *`  @b>E4! 㿀@ܒ  ##\#d/#`   @ x@Ȓ a" @ //#\#d#`   @ 㿀@  #  ://#\#d#`  :@ 㿀@ c /#\/#d#`   @Κ 㿀   @~  /`//!0 ##\#d#`   @ 㿘>5  >ےb@    @& 0? ' 09@ْ 2 0@@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@  㿘 & , $ ?& & (. X `@@ "@   >0;*>08   (>Bא"H /d* %  >۔8  %   >ۑH 0 0 ?@Y ?" & ,B"H㿘`d2>B"B `Y ,$` \$`$`$` $`$$`$`$`0$`T  , `  * @*` ~? H /d * % MH 0㿘 ,`<*`>!@ ; @<?27 , 2  & ,  ?   ݐ"@  ! > T>ې#  $x  ??&  & , ?& ?  ? @ >C~" 㿘 ``4@?  p qu@ >ې"C^ `  ` a>!d*` ($@"Q$(V ``?# @4`@k `  ` ` $,[? `  f"@P?N -!H E %  )2` ;?``?# @4``0?` ,` 0   ?   @0 0@ >ې#B `    > **` @ @ Bݐ#(>Bڐ#H 㿘 >ۀ`#P`>ے#`   B 㿘  > @ 4B#p!># @BL`  >B#L`  >#B  , ` @>B#Р , ` ">>#B>B#H` ` * *`  *  >B L` i` ` * *`  *  > Bp @Y  > @BgL``> XB` `@I  > pBW`>    L@     L@ "  )> B< > B6   B1 ?2 @> в B' @>B# ?`   `>B#H㿘` ``` ` ` `> #*`1> A !p@C0A`>ܘ t !> A ` !p ` ` >  `>܄ t`+` `  >ܐ  >܀` @2 > >Ac0!p>cXA !p@!pJ`> #*` 3> Aap>`Aߐ>ܘ t  ` ` ` >  `>܄ t`+` `  >ܐ  >܀` @2 > >Ac0^ap>cXA Vap@RapP ` L ` H`E>!*`  > A!p>䀋 @ >!>! ` `*  Az 1> A!p>䀋 @!(>!>! ` `* Ag 1> A!p `1> A `*!p> a@ `1> A `*!p>aXAQ " " " # # # 㿘  ː!@Ò!H /d * % > `` &" "`& H 0 㿘H /d * % `"  "` "@H 0 ˒ H4> (>  @2H㿘>5 >ap@܈  0` >@!0:Ґ 2! >@!0/ , [ X, Z ,`*`> x  ( $" $ $, [ , Y X 4 (  > !     >!@t , [㿈  >@e"W ` <  a >@X"0J 2 D  ( `v >@H"`: 2(  H #d `#\#`" H /d * % p     0">H 00 0& 4(& 0H /d * % H 0㿈  !"[ a awav ! "h  !\w0!q `& `   &&>&&&&>` `&& #D` *њ &L&4&8&P&D.<Ȕ `0<?# @6  6   6   @6 "'   6 @*@% 'В"#\#d#`    S  @㿘! @0!@ "@ !@ 3 09!@", !@.  ! ! @0!@!  """ 2 """ "    ` @ 0 0 0$ 00 0H 0< 0T 0` 0l 0x 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0㿘`>>ߐ"  㿘>+! 2`> " `.&`0 2`0 6`0`6`: `$ 2`: *`$`:>>"`: * k  &`4>=G"`:   \ `4."@ `4 >=3"@J `: ϐ `?@e?㿘+]㿘+A㿘 : 6 4 4, @ " :d  : & 4 4\ 㿘` @2  "@@"@ `㿘?!>  `   `.   `@`  ` @㿘  > `` 6> ``. @ 2 06   ?`&, @6(   $ ?  @4 @"` @ 8: 2`@@ ` @ " " """  " " """C @  \  "*  2  *    *  \_ \* @ 00* @ 800* @ 0**  @`*`>=m h      ` `@2  `  >> > >>  8> p>; > 8``5В ``.> *` >( >% >" > > > > >!>!> !> ! >!8>;!P>!xА ,  ' p "  > a#\#`#d>!>!#h #l< 㿈 4.`.  (    0  ( %>  > 84 4 $ 4 a, , #> Aa@u : Ɛa * a!  * > A#> Aa  >   >aȔ @>a@ a2 a>aȔ @א>a@Ҕ a>  y` @   ? # @4  ? # @4  ? # @4 쀢 a  4 a   a  2  4 a  `, 8 *@6 8   8, ,   4  a @;  `  `01`0 ` a   > A  #> Aa'>#\'%ɔ  4@"@ؒa>&00  >;! 㿘 2 '5 @ 2-`2)@`` @{ 2` @ `  @p 2`@@` @e  @@'ϲ@x@c 6 U ///#\#d/.`.@#` x\@F 6 Z(///#\#d/#`y  X Z X Xt [ [ [ YP Z [ ` ` ` ` `㿐> Ò`  x㿘> &``  $``$` 4` > Ð `0`&`&`X)@ `"   2`` &``"">>#8"&aT>;:"P 㿘H /d * %   В $ $0"4("0  $2$H 0 %> ٱ*   6%> ߢ > ِ 4>!@  (   `%>   > ِ#>!@   `, 㿘)W 0㿘? 2  @> #'ʓ4 2   0)ސ   ` 9s 30m!   ה! _\0.``4` ! 2F `  4`@8 4   @   `+ ,@ $ "      *@$  *@$    @ )}$ 'u0`?# @4`   d!`?# @4`)g'_㿘?2  > ¢ #'36   0> )H 'F05"      **@$  **@$    $  Ē %!@ #?c 2 `!   -  Ēb 2)' 㿘 D'? @2  `@> #&2` 2`Đ =& 4  2` 6& 4 <(@Ր  -& 4 ". < D   ` `@ @ " $ 5  >bX@W  `?# @5 0 `$  $"`$  2   0 ( <$ 0$ 4$ @k ( T@4  D ` " <*  @ <?@ "?,@ @   0@  4`4`///// @ ڒ  0@ * (44`4`4`///////  0' H <!0#\#` 0@( #d  ' >"`8  2w 㿘  0` `@ 0`<'"@ 㿘 D? @2  `@> #%ԓ2`  "  ( <*`" 4& <``@㿘>>! !d 㿘>>! !d ݖ 㿘? .!!@.@!@@ K.@ K. *  ( ` (("  ?jX? 2`@ `> #%v2`     Z! @"Mc@c@Cc@c @=.!,c# @"58" p ! `q@") !@"# # # @`m @0 @" !@ 0!@2@2   @"2Qc@0)c@"!Tc @"!T!@^ `r c @c@ `i c@"F c@Dc@ `[ c@& c@ :c@c@ `H c@ `p@ `s@q `9  #@"!T2 #@ "!T# e e@ "e  r @ ` @Y #@ ` @ "!T# @k `  `m@T`q@ݐ `  e`g@`f@D  h@"8  #@q `  !@ `瀢 0#@"p 0#@0#@ `ր 0 @2@ɐ `̀   @Ԙ 0 !0ɒ `& *`` & 0 &S  $   @0   $ &L0` € @` € #\@!T` € @~ ,@@> pˑ*   8bd   @J Z  $ ?# @ `*`2 @7 0G#$ { # : @   2) ``"  "+  <*@ "  $" ?# @ `*`2 @2?  $ ?@# @ `*`2 @6@@?8`>    #$   @̚ @ ,  $` `?# @ `*`2 @2  $ ?@# @ `*`2 @6@@   8 &% 0!T@ !T    @     !T@     !T@     u@     k!T@     `@ \@ W  R   L  GV "A !=2 є 8 ̔ 3 @ Ĕ + 0(2?#ϒ @"2@ܐ!T`@K@u    "㿐@ -!@ *"`Ƞ d &(&0&,`@͒ d &4&8`Ĥ  ?"  >bp@  >b@  6> b@` !W  &&!,&<6H6J&X&&"Ȑ<6 &6&.@    @ "@``|`,    ֐  @ l`Ĩ  $   *   *` *    * *`  *    ?  `   `$   *   *` *    * *`  *   2+  + "" " "    00  $`Ā ,  @b  * 6 ? 2  @?`6 # @ `* * >a @p"( & & (2; ̠ @,  h %/#\#d#`  a  2% * *` *  aa(& * *` *    c8& "&  ́x @ Ô@6`6`6` E6////#\///#`#d    h@& 4$ А@ " 4Ҳ@ &.`.  `  #\ ` @ `  x\ @   G/#\//////#`#d   Ԛ x @ Ē K'/#\/#`#d   ᅳ 㿈 Ē'Д"#\#d#`    ﰚ x@e  B`/ / 7` @( //#\#d///#`  x@C  C`/ / c7 (/#\#d///#` n 㿘   ښ 2``#  +    ˚  㿘Β   ? `@ В @@` >"*`  a0  (//#\#d/#`     װ 2 .`` ē*``0  (///#\#d#`    ʰ `I ` ē*``0  (///#\#d#`     `-``* ě2`!0 2`2` ////#\(///#d#`  š   Ԓ`2 2  2  .` .` .`Ք  0{` ē*``0  (///#\#d#`    d װ _.`` *    ///ђ/`ǔ  a0#\#d#`  x  A $ ` *    ///ђ/`  a0#\#d#`  X   .@  .@ ` ĕ*?0 //#\#`#d  <      @  T@@ Ēa0`  T(///#\#d//#`  T  M` @Ȓ ??(?*? *`+`@  + ?* ?*?  ?*?*`?@ ? ?  0  `0@2 2` 24    `.@.`.`.`.`.`.`.`.`&` &`&`.`  ` p@|  @x `a0@  (///#\#d//#`     .`.`p@S (@O` ē*`0@ ( (////#\/#d#` ({  `( 㾸@( ( @$ @a0  (///#\#d/#`  T  ()*   &``,  p@ (@ a0@  ((//#\#d//#` $  *  &``Y  㿘@` >#*` Ӓ=a  㿀 >"0 @ @ B b  (/#\#d//#` Ț 㿀>"0ǒ  @r.@ b  //#\#d/#` 좚 P     ``/ɔ P    ////ʖ P    Ű .@.`.`.`P  n  ` `/`@////ɐ/˒  p b #\      //// ~ p b #\ ؖ     .@.`.`.`P b #\  s  " N #\ i  ɒ@` `/` /͔  Ę //4  x @ Ô@ /#\//#`#d   Ś 㿐> Ò`  Ә㿘> &`0` >"2 #x/"@ x?> Ðp2 `  o p* @ 2 00g` d  2` 0h 2W 0 * H $@ >  @Y >#/ B 0@   *@ "4. 8 L># >#X># T >>#X# H#\ H 2>>#X##` P#d P 2>>#X##h/C 8 $ 4? c 2 ? 0 > Ðp* ?0` 2`㿘? 2`> Ð p* @# # #  ^  #"Q#"?4#"+8H0 #"(HA0 # #40 #"-0@0 ,@~ (@ $4"  "?@$8   48" "H"L"P" T "@Xx@ 4M `4I +  H`?@4A * ` ?@ X8  :  81   `` ` @+@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   M x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ ``   ``@ @Ť  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d   ܚ x@ * 0  H `?@ '  :` @~  4, `4  +24 ////쀋 / / 0ab#\#`#d   饚 㿘 H.`  S   U$ 8 @I$ ;` ` ` *  F |   ;@0 "` ` `*  >#-q   "` `-@ @א`J `E x @ 0a6`67  7 (////#\///#d/#` & h@ڒ ؒ @֐#p0` h//  //#\#`#d    >D ߥ, ,`, @  +(  (+`+  @  $D$T$8$H$<$L$@$P@  @ 0`////#\#d#`    > 8,ƒ0X@q \@m  ,@ , $ 0 ` 2`㿐> Ò`& d   `& d㿐> Òa  㿐> &`` `0 .aT> $`$` `&`&`X`@`" >"8>"p&at ` 2`` 4``" )>  ` &`,V ``   >   u aU`@ a^`@ ao` @    at> ``Ƞ`> ,+ >  >0>0 !> @u@q#\, 0 ,  0>, 0*!, >5>    &ax>!0+ 㿘H /d * %    $ $0"4("0x  $2$H 0 '> ٣*   6'> ߤ > ِ 4>"Ā@ `   '> ภ 6!x > ِ#>"Ā@ฐ`Ȗ ภ ,!x`>5Ő  㿘  0㿘? 2  @> Ð |4 2   0 {  ` 5o =! j` 2 ` 拔! _``4` k! 2J `  4`!t@  Ȁ 2 3  @  `+ ,@ $ "      *@$  *@$    @ 3$ +0`?# @4`   !`?# @4`㿘?2  > â  6  I  0 "A"      **@$  **@$    $$  "  !t €  Ē Ҕ!@ #?c 2 `!   ڔ  Ēb 2ǐ 㿘 D'? @2  `@> Ð 2` 2` B& 4 <(@  9& 4`    /& 4 ,& 4". < D   ` `@ @ʐ $ 5  >a`@  `?# @5  0 `$  $"`$  2   0 ( <$ 0$ 4$ @x ( T@a4  D ` " <*  @ <?@R "# @?,@ @  0@  4`4`///// @}  0@ * (44`4`4`///////  0R 0 2 H  &  H: <"`#\#` 0 ( #d咚   Q >!h)  2j 㿘  ` @ ?"` 0 `0 @ <6"@ 㿘 D? @2  `@> Ð j2`  "    ( <*`" 4& < ``@s㿘>>"l#  }㿘>>"l#  q 㽘? @ `2` `> Ð .2`     .  !@"! !@"8  p !   q@ " m@  0!@2    `m@"e e@ ";  `p@`s@$0 r@& !@0 !@"vV `q@i  h@0 e`g@{`f@ x0  @ 0{@z 0t!0p & *`` h&T 0 a $   @ 2  e g@2 ? @2  @?`4`# @ `* * > bl@   $ 05"4    -$ ?*$  @  " "  !22 @   W_㿘@!@"`&(`&0`&,`&4 &8 d&8 6aT  >>a@p aUa@j aU@a^@   >a(<`ؒ@S `ؐ.( 6H2` 6J& &<&&X&&  aW6&&.t? 2`  ?6  +  *6 >bl@Z㿘  !t € x@s  @o 6`6`6`  //////#\#d/#`  㛚 㿘  4    ? 4 ? ( `;?  7 ` 3 `  > '!#@%?$  ` ` >>!'p   'j"  ⏒  >"'_ ? 㿘?2  @> Ð H4   /? `*@2 `Đ  2?`  , ` "(? 2`   * 2?6㿈)> A" 2p ?> Ñ2  ؒ@2`  ` %%"ؑ. @   (@ S @R.` @1,   ` @ > A? = "4`7@ @ 6` *6`6`4`///////@{  @&  #  &&& &&q&(& &,j&0&$ `@@  %"  _(*``  @*@ @< Ģb  # /#d//#\#` o  L    "   >"@>"@: &b 6 *` *  `* `*` *  3  @ .&` &`&`&`&`&@ Ę#\  &꣚   ѓ*`@ * ̐ &@&`&`&`㿀@֒ , @Ґ cp   //#\/#d#`  , P"&`  ௒  @ cp  ? ///#\#d#`  ,   ʑ* ˓*`  &` &`  @ &@&`@5(&`&` h.&`!T Ȑа  8 ː`  &@`  *` *    &`ґ* ӓ*`  &` &` @ " ` " ` 2 Đ"&`  ;`&`@F @&` \ , ː` `&@  *   &`ґ* ӓ*`   *  &` `&`@ D&`` c "`&`  * 5 ˒ @ &@&`   *  *` *  2 &` &`ґ* ӓ*`   *  &` ` "  2  ` ( "%&`    @2 Ā` >>"x% >"%  >%" ߫ @ 4 "&`&@&`&`&`  x @  "`!@ aba 5/#\#d#`   Κ  >"$Ԓ 0  @&    4 4 4 4 4 4 4 4 4     l < P  | 0㿐> Ēb(  诘㿘> &`L" $ $ 4 @L>$! `X>``!(>!0>  $ 5> O`  >@` "`d>$q!8a>$l!H```>>$e!``0$a!h`0>ꀊ`!x>!>!$U a&a&a&a ?# @4 㿐> Ô ax LN  & X& h& 4@& @㿘 X l  @ڒ   *@ h " ``$  * ` ` ,  *   㿘? 2  @> Đ" 2H "*@ 2 L0@2` ` >!# 5   ޷ $` 4`%  D`2 0 @є  0(`@S$ D`   0  $ 0 @ `?# @4`㿘?2  > "6 * @ 0 !   @   " L     L @  L   2  L @  L @  L? c 2  㿘?2  > "6 * @6  0 h Ld `@,`$ 0*  l@ h $ 4 @ S$  4 "@ H"@P ?@y : @ *  t d, < 0 ?$ 0 @  ,`@K  0 *  p@ $ 8$ 0@ > $!@ 0 ?($ 0 4!# 㿐 0( L @n @ @ @ !@` @ @ 0? 7& 0 c 4  L"  P 0 `" 0"" < T2 < 0" 82>ć( 0 `" 0"" 8"" 8`" 0 4  `2 0 ` 0" 0 `" 8 0" 8" 0 < 4  0& 0 0 0" 0 㿘 D? 2`  > đ2 *  <C@ 0   8@Y >! "e  P &  T T    T>""T  & 4H /d * % & $ `( $& (`("@#"`(H 00 0(& 0 <& @H /d * % xH 0㿀>5  L>b@@ ` `?# @4`0!  $` ("`(&! (" 0h"`` ``?# @4`6`"# 0 0@  @ " 0 0 ( <$ 0$ @$ 4xqU`  0$ 4 < 7$ 0$ @ 0   0  <($ 0$ @$ 4 0 xV& 0:` @a  0@   0 > /& 0'/( 0   / 8@ <2  <2 2 /// H <# #\#d#` x >"H!~ ` 2m`㿘? 2`  > đ2 b* @`L>`"`鑒 㿘? 2`  > đ2 b* @`L>`"` z 㿐?> Ē " 2` 2`* 2`! 8 ` <  aa 0 !7  @X @ɒ 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0 ( 6 0(" H 6 H6 J64 J4 HV`o>"*` @(   @N &@  @   @>   @   0 @J  @D } @ u Д  0*@9$ 0 0 4$ 0@T b`2 P 0 ?`@  T  @ S  T@$ 0M  0 $ 0 0$ 8 $ 0`EB  , <  <  L6@ޒ >! [ , < $ 8 0 %$ 0 0 ?!$ 0   V   ,`0,` 8*  p"@ @   <* * t @ *@ 㿀2 @Ւ  0 `/ 8 `/@W: 22///66/// Lc #\#d#`  x`L  % @ a0h /#\#d#`  Ϛ   * *` *  $`T$`P0 @ L @p a0 h/#\#d/#` ۤ  &*`*@ **  @  & \& `. d 0  0 ?& 0 @ ~  40 @  4  L"7 @$  /@/   03 <//// 0 "  @ 82 2 /// @ ~!0#\#d#` 7 㿀@  `/ 6/b /c  L #\#d#`   㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @ L66`6` ///#\//#d#`   ڳ  㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @R L6`6` ///#\/#d#`   ڃ 㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @ L6 /#\/#d#`   5 x   0 =& 0@ߒ  L /`/!06"#\#d#`    㿘  4 4 0   7 7 * *`  *    $  p2? 0 "L $ 8& (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4>"X˒  4 "  (  2 ( 8>$ 8 ( $@*;  0 2T  3`2L$`@M & (  @2H  `C =`<     8 >"" 1  `   `>" $ & ($`@   2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$   6  '$$`8(`82`0`0    ?$`0      0 2`8   㿘`"!@> "!@>" 㿘`@+   >@%" "   > #X `{&`48ĥ@ P "8, 2  80 @ &  %>&`D@Ѐ ##>+>@dc>@c >@c 2 `D`D* "`D "~" #>+`L > @ " >c @H??&`T&`T`T &`T>#0`D< @ &`L `>@">!>$@>(@">>#8>}#@>>x#H>t#P >p#X>`Lk#`>h#p` > @"<@>>>"a>#Pbh&`l&`x>>>>#hc&`p&`t&`|&``L I&`P 28`0÷8 >@Xb  >8@RbȀ 8@MЀ 2'8 ''@`P ">cx@@Ɣ  , >'|z @ >0>@!bȀ  >`@"# &`<"# 㿘 D@$!@耊d! ?~$  D$ ?   > D@#>cԔ!P>ѐ# D@ < "@ D Ȓ`"~ D @ ?"@ D@ "@ L  `2 L D " L@(@2)& H D* " T   D " D D@0 "& H D " T  D@ 7@("@& H㿘 㿘`@  2 !@ 㿘t  D  D 㿘 D@$"! D@耊d! ?}  D$ ?   > D@#>c:!>ΐ# D |` "& d& h!>0"  >뀠 @@ $  d?@@*@" 8 & `'" > ` >+ L 2 d ``   d @& \ & X> 8 d D"  L@2 D> c\ d `@ @ *  D"  D@" >! "@  D  " H㿘`D`<@)>0"  `>> ` `Ŗ>`D> }"`D ` # ?`H 2`D>B @$"!`L@耊d! ?|ܐ `D$ ?   >`D@#>c"> #`L @`2`D`D@ @@ "@`D@ "!`D@耊` ! ?| `D  ?   >`D@#>c["> `D }"`` ($`H" "#>  `€ @€  * @  € @€  ,   @€  " >!( 2,``  € @€   * `@  @€  * 2 ````@@2`` @" ``,>0"  > @!H € @€   @ @€   Ř >+>`daH€>+ L 2 `h`X "`h`\@```h @""@`d@"@㿘 D > }" D>` "    l@ 㿘`"!@> !!@>! 㿘`@  2 %@ P "8, 2  80 @6 &  &`H8&`L @ " >a@??&`D&`D`D>`L a&`D C: &`@ 28`08  ''@ܐa@@Ք  ; >'̐ @̐ >㿘`"!@>  !!@>! 㿘`@  2 @ P0  @Ė &`<D&`H4&`\4 2&`L&`@@m @ " >b@u?&`P>ϐ"0Y >Ȑ" 0R>bH@a??&`D&`D`D>`H bX&`D`P: >"x>" &`@ 28`08  ''>"@@>b@@7  @W >' @. >㿘>" @@   & X>" b01 @& T @ X@ T $ `< 6 T  X`8 @2     " `8 X  @"`` T㿘`0(&a< X(   \` @"&a@ `0 T   X   `4& X#``@ 㿘`< $   z. ?   2`P>"`0@`H$  `P$```H@*`$ `P *``H@$`d$ $ `D @ 2  < $㿘 ` ` `v@`F㿐 K  2$ > Fr 09$   ܐK   2( ? $ '􀦠&  K#     K   2(8  v$ $@&@ޢ㿘`@ `?㿘4``L>X"0>c@?&a>b`0  @ 4&a<  @#`&aܒ H @ &a&a <@&a>c@Δ??&a&a>c @Ŕ??&a D&a D>aa &a&`<`<&`@ @ a@Xa>>H㜐8 @{ ?|( # 3 ! # -  #&a ! # "  #&a &  ! &   &&a ! &   &&a  (   (&a     &aa``du >&`L">>?aLP" $$$48$_ma!>#0N8 >b@ `@"&㿘b $ 8@ 8 $@ @I b 7b  "  ,  & & $  ?&  , "  a* @ ?* b8@,"a "@"  2  8$6 8 2  a$a"`b  6 6$b $b㿘"0 6 ("!"" !" "!ܠ xZ !" "!ܠ?!"# !#   xI !# ?㿘H /f * ' ɐ@H 0㿘>cP   `$ 㿘!ؠ  !` !!`@K`@!  ``@` @~㿘2      `  `>뀦 #h `>#x># >#>#㿘 @ >#؀` >#x># >#s>o#l"  L "`a"T  *`"#``6T$26"  """" 828" ?!"! #㿘 L 㿘"", @ &&" @?* @ "*   "!`  "@ &" 㿘 L!ܑH /f * ' b@bDbH@ bL@ \@  \#b@#bD#bH#bLvH 0>+!"㿘 H /f * '  a2a1;a a H0!5=0 !69 = 8 6 8  @H L0; 8@  2 8~ 8 ?/6 8  @s@.0$  L{ L`4@Ő ! L $  H 00H 0㿘!ܤ L!!ԑH /f4"* '"  " @b &"!   ! @X &" "@"*  + @" " ("   " "*`   + " 4"" "@  "   $"&" &"&"@h&"@!(!*  $c!!*`@ $c!!*`@ $c $c @?vC  $b  $bP $@"$ "($ `u!$ $ $>$  $a_d? $ , , $ ($a$ $ &!$ $ $b,$ 0b  $b c  $c 8 @ ;48H 0>+!"K!  "   #d"  #d #㿐!!耤`> @ 0  $   '$   'u   &!?  ?&!$'0> ` 㿘!      > M1? @ @ݒ @ڒ @ג  < `@Ґ?< `:@ `@ɐ?`! @U@S @P *?@@I@G@E@@ @ *?@@ @@㿐! ! $   '$   'u\  2  > $   '$   'uJ  2   㿐! ! $   'u4  $   `2`'0 > $   'u"  $   `2`'0 ڒ 㿘!     > ˒ 00@. @+ @( @%  <@ `@ ?<@ `:@ `@?`@ @  .2`:@ `@?.􀠠 `( (   #d" #d#㿘% L> t d  P!`*`   2 L P  $ P , `$ L 㿘 ɐa !"  0 2  & & #&`  `   ?&`㿘!` X  J F  tU ?     > ; |` ` ``*  !ܖb " b ="b ?*    t ? N $ >   Ͱ 㿐!ܰ L 8!c  @$c 0Tc ?$c  8"?#$c@$cD$cH$cL0G?#$c@$cD$cH$cL 8>"!d7777' @>  ?    @;n # 22?2``$ 22*  * @3 2  א$c@$cD$cH$cL 8 =6 8㿘`@ `?㿘 L`L>Z!0k>a0@?&a̐0  @# 8&aĐ<  @ &a&a <@&a>a@@ܔ?&a D>#&a&`<`<&`@ @&a``dpa >>&`L!Hah>?a#`"$`$`>>$`4`8XF<  J # #i $`Ȑ֐a!>!P8 >a@ `@"&㿘 8 $@ @= 8 "  ,  & & $  ?&  , " `p `ԑ*   8 ' ,`" Đ `"@a"   $ 8$6 8 $㿘! !,   rܐ ?    $@@   r̐ ? @ 㿘ڐ@㿘> apB   & H /f * ' H 0㿘!! *`2 2! `#߀@c?"  @  " @1 㿐! L!  "T !? &! *!ܐ( ' 6T!䀢 "26!耢  &!8$ ;28&  㿘!!ܕ, @ &&! @ @G  `! *`# " !`  !@ &! 㿘`L@   >!ߒ` X  $ X@ X  $ X@ >!̒` X  $ X @ >!` X  $ X @@ >!` X  $ X  @>"` @>"` @  \  Xa!$ \$ X@>"0`  @ >"P` X  $ X @ >"hx` X  $ X @@ >"l` X  $ X @ h \  Pa!$ \$ Pd P !$ Pb P !$ P >"K` P  $ Pa >`A" P  \` $ P$ \``@ P !$ P` P !$ P >"(` P  $ P` >"` P  $ P ` >#` P  $ P ` >#(` P  $ P ` >#H` P  $ P  >#h`>`#e?㿘 H /f * '  a2a1;a a L0!5A0 !6= A 8 6 8  @L L 0? 8@  2 8 8 ?36 8  @@20( Lt L`4 8  @ ! L $  H 00H 0㿘! L!!H /f * ' !܀ ! @U &!!@!Ԁ !@ @I &!!@@  * !ܐ !ؗ, @ "   !ܒ !ؓ*`   , " 4 ! #"@   $!!$`!($` &!&!&!&!$`$`$`$`$`0$`4 `o!$`$`$ `$` `$ \ d  $`,`, "$`(` , ,,,, , ,@ؐ ,    dp" ? $!  !,!,!,!,!,!,@;,8  `@ {a48 , H 0㿘% L>#  d  P!Ԓ`*`   2 L P  $ P , `$ L :+㿐! L 8" ,    doÐ ? $     ,? 0M 8"6 8!d7777&`@  ? @   @;n # 22?2  $ @22*  * @5 `2``ؐ ,    dow ? $    , $  #"`@ ` "` "`   㿘`@$  >@#؀  >@#耢  @ 㿘4``> #0`> ݐ 08  @0&aD  @<&bP  @H&b\  @T&bh  @`&b >&`L`8@V? &b &bb  `!&b>`@@C??&b @&b @b @ @|&b`0>"&`<&`@`<@ a>`P@  !>T!> h2b y>>"`>`P#&`&`>>&`&`l<??? `t   "   "` ``k > >>?b`" $`$`$`4`8$`$@8`@> #`@M >`@G >c@A &㿘 8 $@ @6#0 @?* 8@,`" `"@` " 4  $4 8$6 8    & & $  ?& 2 ,$0㿘! "@!    n !    2 |>  Ē  | ?& |㿘H /f * ' Ӑ@ːH 0㿘>`  k  `$ 㿘H /f * '     H 00[a2@a1@9a @a@"8F 0!5@;0 !6@7 0;8 48  @s0-@  28m8 ?"48  @b@Z0 4 @  PH 0㿘" 2 "(" @ &" "( 2 "p!@"$ @ &"("&"4&"0&",  "(@@@*(" (" f &"8  "(*   "@ !# 㿘" " !"@}"?#$" "  ?$@@!!*` @  $bP! !*  $c ! !*  $c!!*  $c$b,$b$b" %`" (% " @  $  $ >   $!$ % ,   %  %@l@">   $c @l b  $$b " 2"$@b  P`$b c `$c 856 @ ;58㿘"  " ?#" Ȓ "" l&"㿘" $"0l `" `>  < 㿘" $#0lp `# `>! ' 㿘>  !( 㿐" HLD @  \ @$ \"H"L"D"@",` T { 4 8` $ T "4?&"4"4  ,`"(@i)  6 8&","4 "4 6 㿐"8 , @P $P@"!'@i   `  " h2  &"8 㿘  & *     & * ?" >>h!H  ߐ 㿘a?a" ֒ d@f@㿘.`* * "$* @   `2LH /f * ' V> Bb*`@ ?2@  >  "#8@ <"`<<8"`8> `$ $($0,4&0 ?6> _#4H 0PhLH /f * ' V> Bb*`@ ?2@  >  "#8@ <"`<<8"`8> `$I $($0,4&0 ?6> _#43H 02d 㿘% >"  P"$.` @ ;  P $ P9-  L , `$ L @1㿐"  8!#  @$# 0]# ?$#  8"?#$#@$#D$#H$#L# ($# 0M?#$#@$#D$#H$#L# ($#  8A"!d7777'`@  ? @    @;n # 22?2``$ @ 22*  * @3 `2``א$#@$#D$#H$#L# ($#  8 =6 8" ` "   " 㿘" "j` ``"   !2 "   ""  "@@ 㿘"  #" *?.`c   $` ` @@ j5 ` @@?  3>"8 0. $`       >@ `>@ > `> > `>$`㿘" " % *`@.` $` ` @@ i ` @@?  > "PB ` 1?#=  $` Z ?U R O L  >@ `G?>@ > `??>$`B >*? 630㿘 8 h 㿘 P &` |&` "b b "b 㿘`@L  "  > #X `f &`48͒@ 㿘!>"h @  > Ēc&`4`?`>"p0 >" &c( 2&c80 @˔ &c&c$ [ >b@ &b>c$b@?&b" &b&bb耢 `$ 0&bb@b@`&b&c & <`@"h &c " <>Ð">W"b  ` .`.`.`  `@€ _ "`-&b .``  `.`   ` .``  `@€   `.` @`.``   &bb#@ظb`&b``>,!>,!@&b &b@&b@ؠ$&b@&b>,!&c  >:`c`$Ȑc>:Ē>:bhc(&c c &c@8 >bj`0 "8 6> >b@S />  <@   #>  `@2> Ē @G > Ā > >b@3 >  ? >  `@2> Ē @/ > > ĒchƔb `&b@# #*` #*`( 㿘#  t@㿘#  l@㿘#  x@㿘#  |@㿘#  @# D # H  t    㿘>  >    㿐```t>>>+ L`l`& 0& 4& 8 (\ 0`2Y 0> #0@ D 4 H "N 0'2  E"G 02  E"A 02  E2  `"6 02  `/>Ð"*` $!##$%$"!" 0J "$   $ 0  %  0#&@%& 0& 4%& 4& 0 0f 8 & : 7& <>@̒b& 8>@ƒb& 0>@b& 4 8 0@Yf 8f 8 & : >c@& < 0f 8 &  <: @&& < 4># 4f <& @J   J* (J А 㿘 `& t 0& t3>+`L 8& L <` 0& \ 4& T& X!> >"P@[c8Ԓ ""P>@TcH͒ P`L  L> #0   " Q` P "  L P P L@3U 㿈>+ L @ڒ '' & p6 & l " & l?& l l` & l p` & p 8 ?; >  p                 U .            >  l   `$   > > > > " x"l"p# t`$ ! 8  > >  p l L@  p L   @ p l L@> > " "`@#``#dd"@@d`?"@0 d0E Ed0# H2   H`#dd2 #㿐 , ȍ  `K >  ` 2 #\     0(  t  &` &@@  &` ɡ ɞ " `#\`\ &`&` &`,Y$,*$ $   $ $ $ $ , (㿐  " 낐 ,& ,R   c ` 㿘@` `>>>#c!h"`N@  `  `, @ @E  @&` 㿘>  ;>@4 .` <>@ ,` `">># (>  8㿀` R .` < L  8 2 0E   4耢 8#\#` 2 & 0  € 40#H /e4 p* & p    0    `@ 4$ l$ pH 0@E 㿘@ 6 @ p "@ l&@@` *`  <  ``@ `` @   㿘` >5 h"8*`   € >  6 > c>Ȑ!@"  ,c !@  <@@   . @@2  2 > @ *`@ l 㿘` H .``< 2@ >  Ѐ@";   27  / H /e4`p* &`p"$`p&H 0  "䤐` `0 €`4> h``       㿘@K  *> > Ő @$>  6`> c>Ȑ!@"` ,c !@`?c*   ଑* "`㿘`>Ő   㿘 @  㿘`>  㿐> @)  &">; " h`;&">  ̀  !> >>>#c" 䀢 " #\>>>#c"#`     V& <> `` >`!t$ "@"q >!(k` <& l& p >d!8& 0& 4& 8>  8@  ; "`@&@ >+!* * "@*`& :& >В` t&  &  @ !>  <   >5>А X ;  $ <㿘#> `̀ "  >>>#c@"`4  >>>#c`"  >>>#cp" >>>#c"&  >>>#cu"> `"`>$ $ @!$  @> Œ`>  $ "$`́㿘?2  @> Đ# 26e #ԑ*@  `` Z *` < 2Q  J> p>̣2#c`$ $ Т` $ l"  p  " p8 "{  a# %$ $ $ $ $ $ @  ' p>5 h $ p*`8 € `" ` "  ` 4   4    $ 㿘 ?> cԱ6 W*<@  "'   " H /e * &  @ H 0 >5 h"8*`  €?  " @    ?&  $€>  Ā   $€  > ` ?& >  @Ӷ > *  㿘 ?> İcԱ6  *`<@   >5 hb8* `@ 㿘 ?> İcԱ6  *`<@   >5 hb8* ` @ 㿘 ?> İcԱ6 >J!*`<@ 㿘 ?> cԱ6  @7+*`<   >5 hb8* `@@ 6A 6 @? 㿘 0 4 @ 㿘b@(Ř  L"<#K "*` #D"``0#RE"y`0 #Q"V"`0 #PI0 #U`0   :& 7&5&` @ #`` ?&`  `` &` @ ڐ` "`0`t`0` `@̐@ ː`0 `0`4@ `0  &8`0@ ``4 p@ `k`$ € 0e`?Y&`(`0]  2`4W -`K`0`>+*`" *  @* &`*" *  @* &` ;&  $` ` >+!`O @#` $`$``#>+!`@ @#` $`$`@R 0@f  `0`4@㿘 `@ ca@"  #V@NcT@@ 0cb@X@$ 0 cO@   #S@ cM@": 000#N@"k0 #U@# 00A#c@u 0|@Au mה 0hcI^@ X  T  P(_$_@E  ¤8[] "&8֒ 06 0   4 ʒ 0**" *  ] <0 * "@*` `\ < ?2 " 2"@&"@&J 㿘 ?> cԱ6 *`<   `0 `4?㿘> ? #ԓ2`   * <    v㿘> ? #ԓ2`   * <    㿘>  lc 2cԑ*@H /e4 p* & p  H 00 H    * <@   & pH 00& pH 0 H &ِ `% P  >>>#c%@ؒ p2  ( @ Ґ@ x   &&    P  >>>#c\%@    &ՒH /e * &  p>+a ? & p` 耢`&`:` uV  H   p  ?& p# H H 0H4 p( p" pH `$ `( ` ࠝ㿘  ` `   㿘      h>58*@ €`㿐  >>>#c”& p F  B}* 2  o!<@ 8@>@  >5?#@` 2>5"8 h *` ` * 2 €0 +   2` ?>5 hb8J`*@ '€ ?㿘" >"4 " *>"0u  < ` >"XՒ   """ ?>ʐ"" ?$"$ p$"$"@d   ?$"`  8 㿘 >"J  , >"6< ` >"  "$l ?>#( ?$)$p$$@% !$p``" `>  쀢  >͔!8`  # q㿘" >T#HA " ? $"$ pʐ04*>#pג  < ` >#7   "@" ?$" " 0  4>  쀢  >͖"4  @ #f 㿘  ` .` <@  H /e * &  p` l@`2 "2 "H 0 j   H 0 _ &"&"H 0  p 2 l?&"J &"  .` <  2 @  2 .` <  " @ t@ ~  .` <  2 @ t  " "  >  쀢  >͔# `#  2 !㿘 2  p>>>#c'4``` 0 @   $€0㿘  " &  @  "&  &   " "   @"   " ` *`   <  * p?l㿘$ H /e * & p !Ȑ  p` >H 002` .`< ) H /e4p* &p  > $ !Ȑ ڵ    ?$ H 0㿘` p "``"` } 㿘!>  䀢`"   @b   㿐>  ̀ />  䀢 ">  <  >       㿘> Đ 6  ԑ*@> ` " `0 $> `4€>  耢€> ń>   > >τ>  " 㿘>  䀠  < 0  `@4㿘`2 p  `  ?  0  p 4`㿘 @` 0   `"  t 2& 㿘 0 ' 4  H /e4 * &     t &   &  `?& H 0㿘㿈X  #X@2&?  @   @0 @,     @\?㿘  * 0  0 : @ 0 *`:`@ 0@ 㿘 ".`  `0/*`0,` ?&@   0 0@@dP@r@`@@@\0@:@X @@㿘  0  > M " @@ΐ> * &  > * ?&2   &>А (    > )' 5> @,  <`" @  Y 2 @@:`6`<`2`2 2 "2 $2 &* (  5> Ű 㿘+> `@ p@ ` * 5@@5.  :` ?@ ?` `@.``p: @ ``? `? `@ `p5`Y` @4 `p   ( @0@ `@ p `(  @0*`(㿘)>  @. p6 ``0@4@Њ5` ' @,  p4 , `4   w@ `@ɿ@i  `@㿘>  @ p  Y! .`* @6`. 2   , 2  , ,`@, 㿘5> @ p @`"  @5 "@ @ -2 8.`` @-`p5``0@o4@ .`:   - ? ?  㿘/> @  p  @` %@-2 &  @-`p: @``0@04@ڐ  2? 㿘7> @5>p@   `@Ͻ "@. 4  @@ϰ40   *  .`2 @8 @-p2 @``0@4@ό * ߐ 2 㿘7> @5>p@   `@m. < &@ȹ@c40   *  .`2 @& @-p: @``0@ȕ4@? * ߐ 2 㿘)>  @. p6 '>  04@p@ @ p* @`.` 6`04@X` @`p@`@` *  @ 㿘> J` !> Ő *` @`p (  @@̐  @ p `(  @>` @ p2 p2"p 2$p"2&p"`2  @ p `( *`( @ p `( *`( @ p `( *`( @ p `( *`( @ p `( *`( @ p `( *`( @ p `( *`(㿘+> `@`p ( `@@ `@ p `( `@``@p`2` p`2`"p@ ` 04@̐@v   `@ p "`@`p `@! b`@ p ` " 2` p`" 2`"p` 2`$p`"2`&p`" 2`p " `@ p `( *`(`@ p `( *`(`@ p `( *`(`@ p `( @*`(`@ p `( *`(`@ p `( *`(`@ p `( *`(㿘%> @`p  @i  ( @@@ p `( @n`@ `p`V`4 `p   ?@2"`p` 2`$`p`"2`&`p`" 2``p " @ p `( *`(@ p `( *`(@ p `( *`(@ p `( *`(@ p `( *`(@ p `( *`(@ p `( *`(㿘!>  @0 p `( *`( @ p`( `"` @ @  @ p`" 2`㿘!>  @ p (  @@ @ p ( @ @@ @ p ( @}㿘#> `@ p ( r!> ŀ ; @@ `@ p$@ `@ p  @2 p` 2`"p` 2`$p `@ `@ p$ @2$p`$?2` p`$?2`"p `@ p `( *`(!>  @p`$` : @`" *  @@(  @p`$?2`"p`$2`  @p`$`  @`  @@  @p`$2` p`$?2`" @ p `( *`( @ p `( *`(!>  @ p``$ *` `" * 2   @* 2  @ p`2`"  ?*` 2` @*` 2` @ p`2` 㿘!>  @ p `( 2#> `"` @ @9  @ p$ : @"@ *  @& * e2  @ p`&2`" @ p&@#>  $  *`R2` @ p`$2` #> `@ p$ *E "Ԑ `@  p * @ 2" p2 3`"r`@`*` ^2` `@p " , 2 "p2` " * 2 [`@`@ p`"``@  p, 2@2" p " H * 2  C`@ `@  p?*`"2  p2` 0`@* 2  `@p` `, 2` p2 ` *`ړ2``@`@ p` ``@  p, 2"@2  p @ *` “2``@p `( `2`p{ 㿘!>  @ p `( 2/> `"` @ @i  @ p$ : @"@ *  @& * 2  @ p`&2`" @ p&@/>  $  *`2` @ p`$2` /> @ p$@*2"@"2@`p @@* 2 T,`"4` 4"`p*  `"4-`p "2` * H2 ,@ @`@ p   @* 2 T] ,`4` 4  p*` (2` @ -` p` 2 *`2`@p `( `2`p 㿘 p `( ` p `( *`(㿘!>  @ p `( B *`( @ @ p  ("@"  @ p "  ("" *`* @  @p` 2`$p` p`2`$p`"2`!>  @ p (  @ @ p ( @ @A @ p (  @㿘 p `( " p *`( p "  p `( *`( p `( *`(㿘1>  @  p  ``S  "  H* *`2 ? $C>  @-p2 @``0@-4@א> -`༓2`* L@ 2` @`p`@``@ʿ? -2  ,@  *`  .2`-`2   @> -` 2`* 㿘> J > ` @ˍ* `>  @>5 p8  `h*  € *`  㿘 >  @G 0 @C 㿘 8)>  @` H /e* &     S!,`2` S?,` ȑ4`  `!> @  C 4`  > "`>E#% > " ȑH 0㿘 p (  㿘 > L >   D D`@  2  l l l l l l l j j k0 l4 l4 l4 k k k l l l l l l l l l l l k o o o o o o o o o o o o o o o o o o o o o o o m m o o o o m n o o o o o n n o o nt o o o o o n n ox o o o o o o o o o o l o o o o o o o o o o o o o o o o o o n n o o o o o o o o o o o o n n n p p p p p p p p p p p p\ p p p p p p p p p p p pL p pl p p p( p8 p qX qX qX qX qX qX qX qX qX qX qX qX qX qX q q q4 qD qX qX qX qX qX qL qX qX qX p qX q qX q4 qX qX qD qX qX q$ qX qX qX qX qX q q qX qX qX qX qX qX q, q< s s s s t tl uh uh up uh up uh up up up up up up up up up u u u u u u u u u u up uP up up u` u``" "`$" `" `" " " " 㿘#> ` $ ($ $ $  `>   `l @  ``   @ 2$ $ P$ T$ X$ $ |$ x$ t$ @㿘  >   ( " >>> 8`HU ̔  \& ( & $ s & P  n  & T@֒   & Xd!&   _"& t  Z"& x  U"& |  P"& @ @`㿘 &@ & P " T{ & P T " t & T " tm &  t " xf & t x " |_ & x | " X & | "> Q & >  I 㿘`  ` 0@0@ b0 @֒ & &   0   `@㿘> `l `> & 0p& @& D & , P& 8 & 4& L& <& H  @B   :  t P *  * P t  & p& h& `& & & & d& l& \㿘 0 ! !'` H L  " ? &  T "& XJ    2 ?   & X& & X@  0&  ?& 0` d `* @` `*` d &  \ d* @``* @` 0 "   X 2"   ? + *@*  X*@    4@  X 2 " &  0 & 0㿘``y>ؐ *`  $0p `m 0 ?& 0h&  0&  ?c& 0 P" X  X 3@ " W`@:S& J 2O& 3@ ?`@:I& J 3@ C&    2@ ""@  8 Β 3& \1& \>< 0* ,   $& ,"& , H L  " ? &  T "& XJ    2 ?   & X& & X@) 㿘``^Ǡ >ؐ! *` &   @! (. .    &   4& &  8 <& &  @ D& & * d  쀢"  \ `& &  Ȗ &   & & 4  & 8& <  & @& D*   d"   & \& ` 0 |& 0 0 ?x& 0&  H L  " ?  &  T "i& XJ 2< c& X@ 0^ P2  >>> 8`H! P*  M& ` J& \ G& ` D& \ A& ` >&  ;&   H"@ &  T`"0& XJ@ ",& X  2 ?  $& X"& @ 0 &  @~ ( "@ & & &   &      `۔  >؄( dd( d tdxd|(" ``5ฐdt(" 㿘`ۀ`5% >ؐ#*`    d t* "             @7㿘``6@.      Ā ( " ā 㿘``\ @6  `0 9;  ` *`  ((Є " "   "  " $ 4|0  ``p`q `t   " " ā 㿘`̀`}>ؐ#*`  X t   .`    @` 2 @    "  @ 8 T *@X& X X T 2 ?,  .`  @ <  2 @:     `  @ 8 2 @*   T * & X2 ?  8!& 0  :&   @:    E 4@` @*  * & &  㿘`?߀` >ِ *`  *  *` * ?А "   & .  .    &  & @   㿘"  0 ( 2 0>b @    X*   "* 0@   )` ,`` `(>9!(> Œ`P* @ €& ,`2@ 0 @    X*    $ < p p p p p p p p p p p p p p p p p $ L T \ d l t | $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ d T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T ( T T T T T T T T T T T T T T T T T T T T T T T T T T㿘 L@ 8 "  H   @ T H@ J  H @ 8 T`  H@@  T`"& X J@    2 ?  & X& & X㿘 L@ 8 "   H @ T H Iʐ  H  8 T` H@@  T`"& X J@    2 ?  & X& & X㿘`"1 ``" XT T"DP T  2 "  * *   @ 8  " ?`<`   8 T`4  @@a , T   8  T " @P    X`*  @ 8 T     8 T " T @6  T`"& X J@    2 ?  & X& & X㿘`"``" X0"0  2 "  * *    X`* 8 @ 0   8  @ `N `N *`* @@`m"E < `M `f`L6 `C"t  `H`A": 4M `@" 0" 0`J`D"q 0x`Kz0"t 0`h`X" `c`P" 0" 0"j `i`l" 0}@'"p@ 4p`r"u `y`n"< 0!p@0@ "4u"q@@w@" 0K@1iu@">~s@ c@J@0j@"d lh@"' 0`@Aɐ p@Q0X> $aHӔ 0R 0N1 0K @H,` @ !@Ԑ `@,`0< @9,` @ !@ `@,`0- @*,` @ ,@ `@,`0  @,` @ ,@Đ `@,`0 @ 70  @ 70 8 00   P   >>>!XahV!V $>ah   > PJ >`!>!>!  $N   * P> $aC 0 a`"   X 2# 8 #  + * *@  X ,@`ו*`"   H" 8 "&  T "& XJ 2 & X"  H L  " ? 8 &  T`"z& XJ@ "v& X  2 ?  n& Xl& "   X 2 " ? 8 ]&  "  @  08" "   "  L@8 H  `"  8 ?&  T`"& X J@    2 ?  & X& & X "   X2@@ 8  0 ?& 0& "  H L " @ 8 "$ & L`L& H;& L& L& H`"   X 2# 8 #  + * *@  X ,@2"`*`"   X 2 " 8 *  *  8 @ 0ƀ > $b? 0 P`2  >>>!Xah!Ҁ   0 *@ @ 0  <@ @3 D,`  `/(>ݐ#4*`  ?@> >  l `p     ? ? ? ?  ?  ? `@җ,`@j e& D& 4& 8& <^& @?`Z>ݐ"ܓ*` > $bϔ 0N 0 "   H"@ >b O $꺔09> $b0> $b8갔 0/> $b@ꪔ 0)`"     `?  8 " ` 0& L & H  &  & >  l`p& <& @ & D& 8& 4㿘`  "  @` `; `  `  `` `   `  ```  "`"  2  `  @  㿘 `;`6> P 2  >>>!Xah"@  Ĕ   J `/" `94 đ* * ?   P*?  Ė&   P*?"P&  >݄(!,`0`0"`0`0   㿘`0`CD >ސ @*` !, " ?2 3 1 !, " ?% !, " ? !, @" ?  @@``` @!, " ?   $`0㿘 ,    t   $ >"x x, ,       $> >#x |, ,       >@ 㿘`   >>>!Ȓaؖ0/ ,      $ > x,  .`*, @ >  *      > H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H m(0  *`?Æ0> ņ(l(0 *`?Æ0> ņ(mo(0 *`?Æo0>  0 7mЅ(0  *`?ÆЅ0> ņ( "*`?Ç0&(>(>Ʉp>Ƅx>Ä>>>>>` *> A(" *0<c{>6cbu>bb"{  bbn>b  bp  Q> bbT>bU 0wE>cJ 0oJ>cc"O  cc8>c> [ GcM S >  cc>c  0D>c 0<>  6">  >>"! ">>">> ">>   > >(" 㿘&   & &  @V㿘   㿘` b (H /e * & = $`>P!  :@`@`@ !`" H 0` 2 4` *@.6@@ ``$#$@  `0H 0 #H 00 4` .$@㿘 H /e`A* &`A   @  H 0                      $ D d d d h H p @  @ @ @ @ @ @ @ @ @ @ `  " 㿘`>R  `       㿘&`h` &`d`  `" >>1 ?>+  " > A"&`0 Ր $ $@&`0`0"@ `0>`Ԓb`0 " ?&`4 ``0&`8&`&`<&`T&`@ ` "`0>ᐐ > a4 &``lB$ > ŒaD`|B  (>> A"  > A>>> ؒ`0b!bĀ " >>>> ؒ`HV!"b̐!h &`h>!Ò`>!㿘#> Ab  !> A>>> ؒ`7!$""M>>>"$ $ c=P $b㿘!> A"  > A>>> ؒ`0!Β""""`-"`$"㿘H /e * &  `2  hH 00"  6>+ 0,     h & 0>+  D!@#H 0 㿘  `. & D  d > AbĀ" "b>>> ؒ`ດ"& @  A> ߑH /e * &  ? *&   $   8$ %   " $ đ  >+  >+!>* "З*  >! H 0>  6 > c> 4@  ,c  4@   K  㿐 7`2  0 h " 0虒  0@ _ h< 0 c€  m  @6 >+ 0,`  `a h@& 0>+ & !CU @#a08 T 5 @  `,`  a ? @"@ 2# >a J 0q$ H$*"@ *`@ *`$ $ ~  " $    w 㿘 h 癒 <`  ? 4 € 8& <㿘`2  4 "   h " 4 € 8㿘?> Ő2 `   * @ 2   ` 2 T  2  & Tѐ @& ǒ  㿘?2  > a. @㿘`  &  @& T  㿘?2  > Űa.     $  @ `$ Q 㿘?2  > a. @㿘  & @  ? & *㿘 "~@"}@" 0  v@" `T0  @ #`\! ` @ @ ? 㿐 #@$c@ "ǰ | #@E#@" , 4#@ "y l#c @>  4@>  4 #@ "1# #@ "t #  #@ 4@"  4@ "Y #@2 40# @" 4  4 c 8 l  " p & t &  x & & 4   8c˔ l "" "" "   ""   && &&  !: > ڔ!4!4  |` >+A|!@#耢 " ` >+Aq!@#耢 " `" &  "  && y   & &&q !: k> ̰!D!D:@@H*` *   <<  @  >  0 $ _ 0? 8&*  *<3 0&?+ # !2 0 !  ? ߀" 0 @  '@'  0$    8@㿘?2  > a.  @]> Œa 6?a* "aha a?㿘> A"Ā  > $ haP  @@  㿘` `h d 2(   h "  h   2 h @ & h  & h>" Ȕ  >"0 `  h@ 㿘  > Őa 6 a. @2    T  > ŐaP @@㿘  > Őa 6  a. @` @㿐> A"  > A"Ā  1>  !h2 1> !h?`&!h> A> A"ȓ*  < 8@"/> @ " `*`2 !> A"  @> A&!h"b㿘> A" > A"Ā "> A > A" € 㿘> A"  > A"`  `x h !0'ؒcYޠ @'䀦  '܀ 60"''0 hcZކ㿘.2 <! 4!!  @' @"   0`  ` * "` @   0     0   * " @ 2 *`=6,@-@ 0 0 " 0 h p ` l  "  0 h d T `  6 2V 6?Ò@`+O>"p*`  h D6?Ò i @  h <  8  h 4  0 =6$@ ?%@`? =6'@ ?(@`? =6*@ ?+@`? %  㿈 `'H!  ?Ò " @ & `2`2` "  <@ 4 € 8 " < &  6 . * @@֔  =@!`H`?Ð"@`}># *` H   & ?& H   |& ?y& H v   r& H n   j& H   b& ?_& H   X& ?U& H   @N& ?K& H   D& ?A& H  !:& >7& H 4    /& H +  "'& $H 2  (&   h  H H`` 2> `  "7  H "$ $ Q $ H 2 `"  ` @ b2`d2`h2` " <@4 €8 " < !` 0"`" * 2  o< 8@> @  $# b       * 2  o4!< 8@ >  `?# > > <@", 4 >@@", #=@@,   ,    ;& &   2     ;& & 6  , =2`!@2  ` @ b2`d2`h2` "| <@4 €8 " <` " *  2@ ? & c @   {&  ` @ b2`d2`h2`  =<@4 €8 " <=* 2  o:< 8@5> 2  ?# ` 2+6  0?* 2  :, 2 ` `2 ?  * 2  `8?" " 6    6 6   6  㿘 ` @ b2 d2 h2   <4 €8 " <`     ( "   0㿐-> h 9   > Œal :  , *  > Ől@@ " "  l@9 ? * @> œ*`!l@9 ~Ш  %h  <$ : * @> Ŗ!l*`  @   @  $  : @4: 2ߙ<1=!-(0 @#* =(0o< 8>   * ? 2 ** 0>P *2 㿘`0>!(.` 4a666$666666 6666 6 6  66 6 6 6㿘4a22222 ? $ 2+  * 2  o|< 8> t+?# ` m+>   +_[+ * 2  o< 8@>    ?# = "< a @a@a@2 2 .`!  +* 2  o< 8@>  .`?# `  .``@ >#P#/ 0 + *|`2f㿘 . @e . * & ! &@  @4!2 @ 2 @ 2 @ 2 @ 2  p ?   `  2  2 > ΐ#x * "  `I Г,   (<* 2  o/< 8@> '(?# `  (@ >   <(< 8@  > @ " ` ( *А`c Г,   * :* 2  o< 8@>  >?# `  >M# 8@  > @ " `*`2  * 2  o< 8@>    ?# = +`<  @@@2  +` @*  2@  (! ,`* 2  o< 8@>  (?# `  `( ``+`>#@ *  ,` * @ *qdа @"` 㿘 l ݔ   l@E >Ж& `  m&  㿘  Ŕ  2$ 9 $ $ $ $ $ `` $" ``$ $```h "`D  #  € "  ? `#   * @`T`X`\  " 㿘  ># `  2 2 h>#׼ 02    `" @  "   ` €  0         "`"  "` "@}  㿘` `  2     " 2 < 0& D 㿐 ca@r  "}@  v@`D  #`@"`Dcb@"e`D0A#c@"f```D  `0H /e * &  ``` ?&@  `H 0 4  .` 6Kgo $ *"@ *`@ *`$ &   " &     H 0Y  U 4P M MH   *"   "@  2 &3  @ -$`L! ` &@ 2```h 2``    2   @ "  2 2 㿘`?    `" 2  @ "  2 `2 㿘` ` `h` h "  hB  2 h= `& h>  Y` ` `$ `` " ``  2@` 2 @``€ 2@` "@`2`2 `2> 0 '  h@ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ H T Ќ р D  x Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ Ѩ \ \ ք ְ ְ ֌ ְ ְ ֔ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ְ ֜ ֜ ֜ ֜ ֜ ֜ ֜ ֜ ְ ְ ֨ ֨ ֨ ֨ ֨ ֨ ֨ ֨ 4 h Ӡ d X X  X \ Ԍ Ԩ  X X Ր X X X X X X X X X X X X X X X X X X X X X  X X X X X X  X X 4 P`" "`$" `" `" " " " > > p l" L " 8" @" P" $" 4" <" H㿘#> aܚ $  a> >   `tx@ D a`   @ D 2$ D $ T$ ʐ㿘  > ! T "& >>> x`Δ   X\& T& 㿘``_> |*` ع 0V `S 4 ?& 4N&  4&  ?I& 4    "@ " @8   D @ @  @" ,&  4 (& 4     @ 4&  ?& 4&   ?& > 0  & $  " `& @?㿘 4 "  " `& @. 4&  ?& 4`    D <`@  " `&  4 & 4㿘``[2  (& 0@M  㿐``3->!*`  ( "   # 8  @   #  @    (`"    "& &  (`"   " ? 8 &  (`"   " ? 8 &  (`"    "&  (`"   8  ,?`&    8 ?&   " `   @    X"  ( "   " @8 @ "   $   ( "   " @8 @  "  &@    "@ @u  ( "   # 8 @@     # @    " @ @T  0  H@ L' P,` ( `/> *`  0?@D> >  p  `l      ? ? 0`@ ޗ,`@ 2 & H& <& @& L& P> >  p`l> >  l`p (  8 & 8ؐ  "  4 ?>  p`l& H& L & P& @& < & 4㿘``0 `9`; 0  0* ( *` * ?А"   & 0 0  & 0 & 0  㿘"  T 2>Ѷ!0    "/@`۔#`" $8 `     >!`*  & $Sц& $`2@    㿘 `  @` `; ` `  `` `  `  ``` "`" 2  `  @  }(0o < @ 8> @ 2- @2 -`2-> A(-(0 * ?,(0 * ? -o(0 * ?Æo0> Ɔ|( ",v(0  * ?Æv0> Ɔଅ(2j"* 0<"\>&#"a>""^>""R>"U 0\"F>A>"8>"1 0N<>##(>#"< 0>%>## 06,> ## ># 0( ># 0 > 0 8>@H>P"  X`>h>p" >x" 㿘 > &@ a쀦 & 㿘``"00     @ 4&  ?& 4& @    㿘 8` &    @  0    "  8  "   @  8 " &  Н㿘  *@  #    @     @  >7!?  @ F  4& >+! ?@  2?@ 㿘Ho o  ? (>Ϥ!   ( `  \& $ $  2 & 4 $2 @ & 8& 4 8 4& 8 4& 4 42 2 @9 & D $@5 8& @2 : $@<& H& L& <& $&  22 & T $2|& X (2x $ (` & P 2p @֒   (` %& \ 2d <: "  :  ?@ 8&   "2V:  \ " @& & d  \ @~"@͑* & `& d& `>>>>>>> 8a"c& & & & & & & ̀&  ( >>!P   & & ?`>#(*` @ (@v (@ܐ (@V (@ (  ( ( ?& (H 0 ? & (H 0 㿘 2>" @     @ &@   &  & " > > lp  2`> 2 2**` #      ((# 㿘  $1 <:`:` ` X1~ @ X1y  <@1r `$1l ?1f @1a@%  ?""" " """"  " ?"ۖ 㿘 T10 X1,  $1%1! / 㿘 ( "  ̟@ & `& $@` (` ̟€& (0 ( ?& ( >->)"h *h? 0~**⪐h"UUU?""p"h ****h 0a ,    /8? /(( -     08? 0((@ .     18? 1((@ *`4(*`@( 2? @?( @*`2  2` ? @ `0(*h *h $ ,2 2 "@" "㿘> h< @2 < (    :` \  :` < :`$ 05: X01  H@ "## # # # # # # ?  "#?  㿘 $ X0    T0   " @$$ @ :: ??: 8"??2 0)` 8*`82 `8"`` 8*"?82??2 㿘 T/ X/ /?   < h@ <$``o> @"@`2 0`\> @2@`2 0MK @*@`2 0<  " & @&>>/  `@*@``2@`""@"`"`"` "`"`"`"`` "@`*@`22@2 >`"`  >>>|"@"`"`"`㿘  / X/  <@  @  $  l h" h l@ 2 ?     P&. 8 (@` Y,>, c@@8 B @  &9 `3   *  *` * 82 @ @&    *`  * *` 2 @ @& | @  * &  t& `>"*` >8,88 @ S @ @ @&&F  `#">   *  *` * 8*  @ * 2@ &&!    *`  * *` *  @ * 2@ && -@  * &-@ @ @  &&㿘 ` ..?  h <@ X. > `$  + .>@ #@ ???8 ?   #? 03>b+ @ >"8*  : >?/ ?/     # `#?  `? #?2 㿘 `  - $ X-  < `$  *,> c@??-@ ?  #? 0">"* `>8*` ?8 ?8   # ? #?2 㿘  -a-]-Y X-U $ U >>    @:   "``* > , * > c@@ * "&+ @&",   &+@&*  "@  &>"8 ; & @0a>b+@ )>, "8@ " ?: ? 6   >>  "   2 @ - :   "`?* ? >>#@,  @ *   #@"*" @` @ @ #@#` :   "`4#@* #@A :   "`* ?> *`>)  @@* !#@+ @#@"+@ #@+@#@* `"@ #`"8; #`2s 0 >>    @G :`   "`* ?>+>)  @@* !#@+ @#@"+@ #@+@#@* `"@ #`"8; #``࢔` :   "`4#@* #@``* :   "`?* ? >>#@,  @ *   #@"*" @` @ @ #`#@2o >" 㿐 X+  T+?  h?  < @ <@  ` `$` //;  + 2 + ` P+b& `(`8@ ` `*  ` @*`  *  @ 2 @*+ 2 `   * 񀦿$, > ,"  * ,* /`  * -* .`* 0  * 1㿐 X+  T+ 7 7  h < `<  $ ''< `3 2 -  P*&8#@ ` `*  ` *` @ (*  @  ` 2* @`*3 2 `   * $4 > ,l "   * .* 1* ,* /* -* 0>>܄X" " 㿐 X*  T* 7 7  h < `<  `$` ''M ` + + + 2 : ` P*g&`80@ ` `*  `*`  ` @ * ( @ 6 WW+ : ++ : + + *2 `  *  $, , , 㿈ʔ0: < h@?*@* 2  2 *  * @ ('耊 '#'?#?  @* () (`@ 3`2+.  @0@1 0`6 @ ''' @2   (   \   `$) < X)ΐ  H@ $@O, , @&@H ** &7:  " 谆?&@&`&`&` &`&`&`&`&` `$ "  谆?&@&`&``  6 . @ &@ `Ͳ@㿈 Ø0 X)s  T)n ` )i?  `< h ?* / ?  ? / `$ / @ ('耊`'#'?#? @ @  @* (..`@ 3`2+,`  @0@66`4` @ ''' &@ ** &>??H ` @? *@`? *@`*@`" 蔂"@"`"`"` "`"`"`"`"` `$ " 蔂"@"`"`` " ?? *@`? *@`*@`??2  , >  * .* 1* ,* /* -* 0>" 㿐 X(ǐ  T( ? ?  h < `<  `$` ''=  # 2 , ` P(& `(`8 @ ` `*  ` @*`  *  @ 2* @*# 2 `   * $$ 㿘 8 (` ((^ $   >c@ @,  * 㿘 (  8 (F $?? ( ? 6 ? , ,  &  (??㿘H/` /> A"     $ ( 2 H 0> A"> ӄ "" > A" @` ""> A"  22 㿘H/` /> A" -`  $2#`  2   (2  @# 2 H 0   ׀H 0?㿘H`  9 `,  H 0-?   " ,"  `0"   H 0?  " 0   * 4 &@2`?H 0㿘H` Z `&@` &H 0` ?㿘H` =  ? ?> @* 2 2`H 0 @@((> ֘0 :`6 `62? "(+?&'?6"? "`0 `0   **` ? ?㿘@``!"  , *:' *`     `@"y  2` @"q  2`@"i  ޠ `   㿘@``!"  * (:% *`     `";  ` "4  `"-   `   2 (2* (  ("@ "`("`("`("` 0 "@ "` 㿘* * \ *@  *@ ɖ 㿘`?c `&``@ 24 !>+ L 2V` 2+  2 % #? ? L 2  2 >  E" 4 @" 4  ?倢  `@ &` 㿈` '>+  L   &`D 0@@ 0  @c &`H &a,0 @c &a,&`H &a@   6> >" > L @`D@  > h&a@>  ` `  >`x@Tv> >+L 2?> #0`D` * J`@`L L? 0>  `@`?a0" &a< @ #  $`0>`4í > #\ `@ a@@cy* &`P&`ha> ֔#p"$``"`" ">  ? a j> > ֐#c>'''' A@"$ 4_@"% <@@?0#F@ C@B@ E@ J@  "" 0" 8" ""? > \ :    &?`@8 ?@ >+La@ a4 a0(@a0@?㿘>+ L !< @ D@0(`Њ@@ Ъ@@0!Њ@@ ?Ъ@@0Ho o`!, `  ` ` *`!, ` *`H 0 㿘!D  L&'&!  @ !D  $!D !D"!D 㿘`?# @`&` @  >+ L  L> #X 0@bv?@! 8@ 㿈`  &`D  > ># >‰ >+ L  0> #0 " J  a  0a  ! &a   $ @bB&a,# @b< @&a0 @Ҕ   #$> #\`@ * @b' &`Pl&`ha> ֠#$ $``$ `>$ $ `0 >`4 >>L"?> > א $`,>'''' 㿘#A@"* 4#_@ ", <#@@?04#F.@ cB@"!0 #E$@ #J@""?cC@"!0?&!& 0& 8& &&@q @ 0? 㿘!4  L&'&> > `p l!@ !4 $!4 !4"!4 > \ :    &?`@8 ?@ >+La$ a (@a @?H`!,(H 㼘@``!"  *`;    *  "  *  $  *  ` 2`   `  㼘@``!" < ` 25`  2-` ,`#  2@ `  2@ ` @ 2@ ` !0*` 0 !0 @0!0 @2d㿘`?# @`&` @  >@ "   > #X  & 48@  㿈`    &`D    6>  >' >" >+ L  >>`@Q(L   ؤ  >`@QL >> > @ > v >  `0 `? @`@ `(&a8  %a,   > א `a8  p 2    *    + a,`  a,q >  &d<&d@d<@[* a8 $* a<"  @  $ s$  $ $  #p$> #\ `@ * @_ &`P*&`ha> נ $ $``$ `>$ $ `0 `4 > >  N? a ge> > א `>''''N 㿘#A@"* 4#_@ ", <#@@?0<#F6@ cB@!< #E,@ #J@"*?%cC@!<#? &!& 0& 8& &&   2 @ ? 㿘$L  L&'&> > `p l!@ $L $$L $L"$L > \ :    &?`@8 ?@ >+La0  a,(@a,@?㿐!8!< #\H`!8 `(!8(H 㿘!8  "    !< `*!8 !X  !8(㿘`?c `&``@ 2 >+ L 2  2  ̒ ?"    @ `@ &` 㿈` >`!&`D>+ L   > #0 " J  0 0   @^&`H a a, $ 2 *a0 @ $$ $?$   #$> #\`@ * @^a &`P&`ha> נ!0$ $``$ `>$ $ `0! x`4 > > "(ʔ?> > א!\ad>''''ϖ 㿘#A@"* 4#_@ ", <#@@?0?#F9@ cB@!0 #E/@ #J@"-?(cC@!0&?#&!& 0& 8& &&   9 2 !, f ? 㿘$0  L&'&> > `p l!@ $0 $$0 $0"$0 > \ :    &?`@8 ?@ >+La$ a (@a @?㿐!, #\!05 㿘ʒ 0 0 0` 0` 0t㿘`?c `&``@ " >@a8 2' >+!  L 2 2 G> #X  ,@]U?@g ?"  m ` `@ &` 㿈` 0 &`Da,   @]5&a8   @].&a<  *@](&a@ @]"&aD @] &aH   `* > "@*` `D@@  >!H>!0>+ L >>!0   >aX@M>!`0>!x>+ L ?> #0@`D   " J  L  L? >  ``?a<> bl: &dL&dP dL@Wݔ @Ԓ$ 2 *aL @ $#) > #\ `@0 * @\ &`P&`h`> #>>>>`T!&a&a&a &a&a@$a> נ!$ $``$ `>$ $ `0!`4  > > И"?`a d > > א!a>'''' 㿘#A@"* 4#_@ ", <#@@?0<#F6@ cB@!L #E,@ #J@"*?%cC@!L#? &!& 0& 8& &&-  ^ 2 @x ? 㿘$\  L&'&> > `p l!@ $\ $$\ $\"$\ !@?? !H`   !<`@"!8" " > \ :    &?`@8 ?@ >+La0  a,(@a,@?㿐!8 #\!L? H!@`!@ H 㿘!@ `0 02 ?#ߒ @`"!8!L !  !D``?""`㿘 ]!D` @ @ 4"@  4"@H `$ `$ `$$ $ $ $ $ $  *`3$  ̒$ $! `$  d$  4 ` ?$  d?$  `$  d$  ` 4 ?$  d?$  (  @㿘 n!D`k @@g D  4"@  4"@ S `  `  `  `$$ $ $ $ $ $  *`3$  ̒$ $! `@$  d$  `?$   d`$ ?$  `$  d$  `?$   d`$ ?$  (  @㿘 `P!D @@L D  4"@A K`  ` F `$A$ $ $ $ $ $  *`?$  $ $!?  `< h $! d$) `$)  d`$ ?$) `?$) (  @㿘 `!D  @@ 4"@G$`$`$`$`$`$` *`??$` c?$`$a> < h@$a @2   ( "  $i$i ?$i `$ d@$i `$i  d`$̠?$i 4 ` ?$i`( `@㿘  !D $   $$$$$$$ *`$ U$$ d@$ `@$  d$@@ $  ` @@ $( @!@(( "(㿘`?c `&``@ 2 >+ L 2  2   ?"    E `@ &` 㿈`    &`D @Y_0>+`L ` &`H> #0 " J  0 0  ?@YI&a,a  a, $* a0"  @  $ s$  $ $   #$&`h> #\`@ * @Y &`Pca> נ"@$ $``$ `>$ $ `0!5`4>#? > > א"lbt>'''' 㿘 #E@"O?#F@ "I?#H#@@ ?0@@;#A@" 48? cC@""!0  #G@*cB@!0(? #J!@!&!& 0& 8& &Ē   2 !, ! ? 㿘$0  L&'&!  @ $0  $$0 $0"$0 > \ :    &?`@8 ?@ >+La$ a (@a @?㿘㿘`@    >+ L    㿈` ? c &`D>a@HJ@ 2>>a@H>K!>  `@8`?4>!@4D>" Β >:`3"P8  @X0 "0 <   <&e0&e4&e,&e8&e<&e@&eD&eHa G `D   $_# > `8 > `@* D@4> `<&`8* &`<&`@> #\ `@ * @W” &`P`4>`8"X`0@e<   a,"  @ &`ha> ך"#`$``#``#`#``8  ?>> !> > א"b>'''' 㿘#A@"+ 4#_@ "1 <#@@?0I#FC@ cB@"$ 8 #E9@ #J@"7?2cC@"  80? ,&& 0& 8& 8 @? ! & & 2 !,@   2 !,@ߒ 2 @ ? 㿘%L   L&'& 8   >  p> Ɛ l!@ %L!  @ %L  $%L%L"%L > \ :   2?&? @8 2?@ (?>+L!$ ! (! 㿘 8 %, A*@0 q*@> #\  @ P @ * %8@!>5>   8 A%,*> > ଁ` %,  A  @   *㿘@``!"  + )% *`     `@  2` @   2`@  ߠ `   㿘@``!"  , *& *`     `֔  ` ϔ  `Ȕ   .`   *`%<a, "@ `㿘*`!/* !.* !-* !,*  㿘`@C    `?㿈` ?`# @&`D!>>"b@F >b@FJ@ )>>")>">  `0 `?a,$ !!  @U&a8" !@U&a<# @U$`D&a@`  $#) 2`0`8 2`0`0&`8:`4 y&`<&`@`0%`?&aL8!> #X 8 @  @U`8`&aDaL0 #X 8 @ @Uj &aH@`8  @e `8 2aHaD&`P&`ha> ה#P"$``"`""`8  > ? ǘ  a   \  a \ؒ`0>`4`Z">b@EJ@ >O"M"> > א#|c>'''' A@"* 4_@"+ <@@" 8)?F"@ C@B@ E@ J@  " "" 0" 8" ""? 㿘 8 V'!L !<."`\!< " X!8 "`p!8?" T!8 "`X!L !D@ !L' !<."`\!< " X!8!" p!8" T!8" X!L !D@z !L% !<*"`\!< %"`X!8?" p!8c" T!8" X!L !H@Ґ >5>  㿘> \>  @27? &4? @82-?@ (*? 8!0>+L!,(!L8@ >+L!,(!L 0@ 㿘!P  L&'&!  @ !P  $!P !P"!P @ @ *`@*`@`"#`*`!@ !@ !@ (!@㿘 8  `ڐ0!L'!<. \!< X!8  p!8? T!8 X!@? !@ !@ !@ <!@> >  ଝ㿘`?# @&`>@ "耠`?㿈` H  &`Da,80 @S &a<D  @S<&a8a<>  `@&d@< `?  "    "    "X # > `@ #\ * H@S~ &`P&`hÒa5> ג"`$``"``>"`"``0 `4"`8[a >!@D*ca@**.a@  aC? ***? @Ҕ! @  >>ؖ "Ɣ?> > ؐ ` >''''˖ 㿘#A@"+ 4#_@ "- <#@@?0=#F7@ cB@ !@ #E-@ #J@"+?&cC@!@$?  &!& 0& 8& &&  5 2 @k ? 㿘$D   L&'& 8   >  p> Ɛ l!@ $D!  @ $D  $$D$D"$D > \ :   2?&? @8 2?@ (?>+L!0 !,(!,㿘*` !@* !A* !B* @ !<*`! #$@!*#$@" #$@*` @""!< !#$@!#$@"#$@ @(""`H!<`"$@8"߆ < 8H 㿘>@c   `?㿀` ? c &`D 0>#0 a, z     @R  &aȐ@R *&a`">/#`0>cX@B>&#x>  ``D`?   >c@C7   $f#`8 0<> #X  `@  * @QՔ `8` &`P ``@  * @Qɔ &a@$ @2 `b*aԐ @ &`ha> ؠ `$ $``$ `$ $ `D  >#X&d&dd@L  >>|!<?a Y6a>#3`2` `#\``00`4`8#`> > ؐ `>''''  㿘#A@"+ 4#_@ "1 <#@@?0U#FO@ cB@"$ 8 #EE@ #J@"C?>cC@"  8<? 8&& 0& 8& 8 @? !,& *& 2( !> "   2 !Ԑj 2 D @  !Ȑ  ? 㿘!??#"h!" " 8  @2 ??!@8 * * @   #@??`>5>   8>  @0 !?(" > >  ଘH!̀`(! H > \ :   &&$?`@8 ?@ `8>+@ ((  L!0 !,(!,?㿐!Ȑ #\!Ԕ 㿘$䀢   L&'& 8   >  p> Ɛ l!@ $!  @ $  $$$"$ 㿘! `0 02 ?#ߒ @`"!Ȑ!Ԕ !몘  !(( "(㿘`?# @&`>@a#Ȁ >@[#Ѐ   `?㿈` > c&`D@@J@ ">"#>  `@`?H>#   @O &a8<$ @O T&a<a,8 >#&e@&eDe@@J  @w $#I > #\ `@ * @O &`P`0>`4 &`h `0# @ a> ؐ`" $``" `" " `0"# ?> >>`ഘ"a W0> > ؐ!a>'''' 㿘#A@"* 4#_@ ", <#@@?0<#F6@ cB@!@ #E,@ #J@"*?%cC@!@#? &!& 0& 8& &&@n  @ 2 @ ? 㿘%P  L&'&> > `p l!@ %P $%P %P"%P > \ :   2?&? @8 2?@ (?>+L!0 !,(!,㿘*`!C* !B* !A* !@* @s 㿘@``!"  + )% *`     `@ _  2` @ W  2`@ O  ߠ `   㿘@``!"  , *& *`     ` !  `    `    .`   *`!<a@ "@ ``"!8!8 0  㿘!8` " `  "` ؔ! !8  㿘"DD@  > "ap 0> !p @     ?"D D (ې>+L"@003f#"@0㿘 "D! D@" "\"D D2"D㿘 "D D*@ " "F"D D ?2"D㿘!̐ `  `1  " >+  >+' >+#  L 2 -"D " -  L 2 -"D    - L 2  "D "  "D>+"H L2  %D # %"`㿘>+ L !"D``D `l@ "D?"L`D "` "D p@"D D@ @" "㿘>+ L "D !      0 [0B0?㿘>+ L 2>"D -> Y "D D ">>O 0!̐  2>>F @1>@ X!̐  >>7 h >2 0> - 㿘`@D  " "`  8TȒ@ 㿘 >` @)> `? @>`?`@ 4`? "> 0> &a&bH0  @L &b@ ` 4  `@Д  2 `P 2  ` `H&a`L>&a&a$`P`@=^ &6a耤 >+ L   a   a @x?* @ @* >8!&a&a`6a&bD& @&bL '8>B#&b,b$T Tb$ &>0"d@   <@    ` >0"d@ ` @$ 91a>G> `<>G!>G>>>>@ haȘ b܄d@&a&a>>&a&a&a&a&a&a&a&aJm   # Jo J #0$>+ L bD   #J^  % JY   JT Js 0  % JK Jj %%C>+ L>C#d` &b0bD ">#x&b0&b4b0@F K㿘` @ 2 4 6  2   ʒ ? 0 Ē ?  㿘 L 4(@  d4(@ L(@?Ȅ 2(@(@(2(@ L(@2(@㿘 L d,  , L (( L(㿐`P􀠠"q>>>>>>("b@d>#@&a&a&a&aȒ  &a&a&`H0@KS `H> `&`L!? > ""D>!` `Hy &`D>!h#> cX`H  @n2 cX`D  @ "`H>!x&`@a̟€> `D ؒ &a&a 2 >Ԑ!> 8  В  @ ?&acX`D &acX`H" J&a>>>i!aД>i0#d@&a&a&a&aȒ  &a&`H&aЖ(H@J&`Lh@?4  @ * " `H@Jؒ &`@&`DhD !4hD?*4@ ? 4ga`D€`H`D`H$|# &a&a&a&a&a!0Wa7@: `>Ր!0K  > !x>$>?a̔ܖ"$$$48$?F!>!Fpa> ؒa*@   `0>#&`0&`4@E 8 4 8>#&`0&`4`04p 8  >aX@ ` @"$ 㿘>a L  `@:$ 㿘!!` ` L(@""!(D>(D"(F f (D!4(D! ` @ @] `P `@``@` > J"8 `@& ! ` 2! 㿘"! @ `,`!  ` ;` > Ȓ`?& -  $ 2` * @  +  2   2 +` *`*2+ 2`2* 2  @ @* 2@  & 4  4  4  4  Ȑ@ @ F&" *!*2 3  F ! #@ +`3 +` 4 @㿘#b bВ {6 6 *   >"P  4   @& '& >"p > " >"  >"   &  > "   `& & !Ԁ  " "*` @&! ` 2`@ ?"@& & & @ P㾀!.`!''2"`? 2`*  ` 2 "@: &`@5 &@   #& 䀢 !> A" "$"    |'''8’ $" PC㿘!"&*@ @ > bє @0!@# `` 2` * "2@ &*` ?# @2@Ӑ &㿐 8`@9%@ 2p`d6 8@ ,`| @ؗ*@ @ 2* *@  8&2@ؚ@ * @<#@@  2@@* @2 @@*` $`@" @ ' *  +  + @ +   3 @+  3 @+  3@(@``F#@ +`+`3  0@+  `F#@ +`3 +`a 0@o  $@`耤 R  $`$`$ `?$` Fb@b* @   @      *  2  %(  >#5`,2  @@*@ ؓ*`@ +`3` 2@ `2`@@ ?"@$@ $@ 1"@ l"@ h`| "@""ؗ*@ @ 2* *@  7b2"@"ؚ@ * @"<#@@  2@@* @"2 @@*` $`@" @ ' *  +  + @ +   3 @+  3 @+  3@(@``F#@ +`+`3  0@+  `F#@ +`3 +`a 0@  $@4`㿐H /f * ' !ܒ !̟€! !̟€! !̟€, @$@' `, ` * `*,@ F`$, 2 , 4` D @"@ ' ,` * *!@!@  d @ !@ `@W H 0  H 0 㿘H /f * '  >3#(  P ;6 '  @`` @& >#8 ` @ >#X `6 @A H 0 "x!`' 4 !!@>"`>+! @y'*  ܐ0@   㿘<%6`6`6@ F&@ *!*2`@ 26`  23@@ 2`3@!@ ` `$@@>#x`@># 0` ?>@ #`>@ # 0>  㿐!# !!̟€`!  3@x#< &> 8!,!,&`* @&  "А,`"  `` ?    @ + ,`!"   `@  ?+ ` @6 ,`!``@+*  F "@*`2 *` 4@,`  !?* @ ` 2`"ؐ,`"  `` ?    @6 + ,`&"   `@  ?+ ` @6 ,`&``@~*  F "@*`2 *` 4@,`  &?*  ` 2`,`" %`` ?   & &  & @ &  ,`"  2` @%' ! `*` `* *@ ?  F ! "  !bĚ&b̘?&*b&bȕ2*&  3 F&"@*`2 *`! 2㿘6@#6`<c! 6` *` !Ȑ"`**` ** 2`@ 6` F &@ **2! 3 f >@ 2 > Y P 㿘!< F#$ *`!*`2  4`4"4 4 !ؖ ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  - > 2 F>   0J!$ *`*`2  4`44 4 !Ȑ!     > >  0*/!@   `q F! " * @*!2 6 3`  !@ `ޖ !Ā`@ 㿘  Ж 㿘 H /f * '  a@" 8a @"  8C a2@>a1@ ; (!1 6 8  L PY0,@ #$! 8 2 8 8 ?6 8  @00@@ PAa P`4@   H 0㿘!  &&  4   @}  "   "6 a P  *@ "*`@ x  & 2    &!ԁ㿐" "树*@ @">+ @ `2*    @}@   ?b ҔÐ?"  *` ȟ؀"" |#!0|ڒ |֒ @ &`2Ғ  ᬀ@ @  @  @   @  @  @   "& & ᬀ@ @  @  @   @      "  2 &`s   r  " @  @  @  @   @       C A& ј >    "& &`21  ᬀ@ @  @  @   @  @     `  & @ &`  ࠰??$ݒ &@   ??Ȱ?0P & & & '  ց   & `    (8&  @  2 & > ` @ 8&   & &  $@&@`Ӣ"Ȳ `W- @@2 *`  !"@"  @ȟ&@ @   ȟ@&@  @ȟ&@ % 2 `2@{a!""$*` ?# @2 @{P $  P ֬ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 d լ լ 0 0 0 ( ( 0 0 ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ < H T ` l x ل ِ ٜ ٨ ٴ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬   , ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ 8 D P \ h t ۬ ۬ ڀ ڌ ژ ڤ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ڰ ڼ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬  ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬  ۬  ( 4 @ L X ۬ ۬ ۬ ۬ ۬ ۬ ۬ d p | ۈ ۬ ۔ ۠ ۬ ۬ ۬ ۬ ۬ ۬ ۬ ۬ $㿘 <""> A> ""\ H 0"& 0 0 ?& 0㿘`> A""""`(`?*   *  `>(``4@o > `+ `6"@`4`> `>`F! `6 *24``  64` F4` 3,` / ,`4`Ґ"$ (㿘` @x 2" "    ? .  Ѐ` "@ `$   `  x 0 @@y & &`X> "*` &`l>!P&`p + `\  " `x  @l#&`|&`x@t6#`x &`|&L e3  &`t>!X@t&&L  `x+ `t "@ `, `x =@ `  *``x`4 * `x `s * $`x` .a2&`.a3.a4.a7.a6.a5&`&` 0#\#`    @ `2`x>?!h0Г,`  S,,`* * `t  " >!>@ /!(>%!a5? `.a5a5a2 .a2 ,`t" a2 a20> ! a5? `.a5a5a2,`.a2 , * `t* @"`a2 2#`oa2#`#\    @" `2a5 ? `.a5Ya5,`@*``t@*` a2 .a2 , `t " a2 Ca2 !>!`@ 0F>."t&`0&`4`0) >`@ђb "@k 8 0 ?耦'?2 '`@2' @+ '    '@k" @+ a8>4b,9>+!*8@ `    㿐`0@s  > ؐ"$`&`&`X  6`6`&` \&` * "@ 2"`ȑH /d * %   `ƒ    `ƀ >`>"0&``Ȑ 6`#\#`   @Z   ! !5? `.!5!5, @*` t@*` !2  .!2 *  t " !2 `By!2`B`>"@6`!>"X>"p`Ȑ#\#`   @  2!5  ? `.!5Q!5, @*` t@*` !2  .!2 *  t " !2 `:!2`!>"`Ȑ#\#`   @  ,  x  2!5  ? `.!5!5, @*` t@*` !2  .!2 *  t " !2 `!2`!>z" 6`6`6`6`.`.`Ֆ <#*`2 `}2 `Ȑ#\#`   @  2!5  ? `.!5Ӑ!5, @*` t@*` !2  .!2 *  t " !2 `!2`!>5"`Ȓ #` #\ @h  2!5  ? `.!5!5, @*` t@*` !2  .!2 *  t " !2 `!2` !>#`@ 6`ƪ`0.`$Ԑ  `>`И#(``Ր` &"#\>: ϐ#H`Ȑ#\#`   @  2!5  ? `.!5<!5, @*` t@*` !2  .!2 *  t " !2 `%!2`!>F#`ή ``Ԡ`ՠ?KHD`Ȓ #\#` @  2!5  ? `.!5!5, @*` t@*` !2  .!2 *  t " !2 `!2` !>#@ [SQ6`    ?#@`2 `̐  " `̀@  `ԑ2  `Հ ~}`~>#'H 00) `P"  @)>  > @u- ` @"$ @kA6`  `ƑH 0? 0  > 2 * " ` `` ( ("` ( ("`` `"`㿘?2  > ؐb 2 b*@ >#`a 㿘? 2  @> ؐ 2@ ,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * %  "H 0e  !_  & *`` &!  @kK M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @k* , ƀ ,` 4 ?`4# @ `*  *  >- c @kN$   @ $  !:i/ @㿀?2  > ؐb 6 6M b*@"G ƀ  Ȣ'  @g" ?'y@h"ƀ  )  `6! . @  "   *@$ *@$  $㿘>->#" c㿘>->#" c 㿘?2  @> ؐ" 260?"*@    *@2   r " ?,` ?( 2` 2  d ?㿀 D? @2 > ؒ `@"2` "*@   T &   (@w. <  u& 4ƀ  Ȣ'  @g+" ?'@gI"ƀ  "  < D  " < O& 4 O @j\ $H + L >  .` 0t.` 0r 02 .`  o.`  Ր?.``.` .`   А?6`   Ԑ?.` 0Y 02 .`  o.` .` .`  .`  .` "6` .` .`0B` .`  0   o` `  .` &6`   2 6` .` ` .`  (@u.`  @u= @uش.`  @u5 `Դ6`  (@`  &` $@`*   = .`㿘` ` \ 02i !2 25!2 @^  2^ !2 (!2   !2  z 2M !2 > !5(!5  zv 2> !5 >!2 2 2!2!2 2?> 8 .!2 J , *  t* @@. \     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@㿘!2 2?> H .!2 M ,`*  t* @@ 2$>ː `("(& (?"D \ 2`  2 * D `T`*`   H @e< 2"<>   p!2`.!2 `- *  t* @"`!2  {|!2 &$($&(( "%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   Lk`0@  㿘.`*  X*  t -@P2!7c !* !7 @q !4.!7`  .!409>0G>0 @  y  @>?* @ * X2 *` X2 *` X2 *` X =*`  X *` !3  .!30>0P>  @  yK  @> @  㿘!4 @ X B B  a ?  B   `  ? @ ? ``?  @ 2!4- @!3 8!4" @Q !4 !3 .`*  t* @`!2 "    "!2x x $ x@k  x = @   *@ xР"@ `ː ` * | X*` X2 *` X2 *` X2 *` X*  X*   X ? $ x X   x "& X x!>  @  X *`  X  b@ ?  X  4 x>+  *`  xĔ 㿘!2` >!  X *`  X  b@ ` X ` ? t   t` 0  2j !3?.!3"V!6&` x/   * 2 *  `@*  t  8 0 "`0G "2!5C  "`4`0`0("`0`$`0* "`@`0`<`,@c`H t 0`@ `< 0Ғ"@ `0!2  .!2 * t" !2 2 y!2 y!5 .!5` ? @ &` ?  .!6!* !4 .!4   4@( `2 !4!2 "!4ye!2!4!3!2 !5  ` >! Ӗ  > >!Hʔ >ǐ!p㿘`"!4!J@ @o !4.!6.!4 P ">C! !4  X "!6㿘 X ` @ ` !> !@ ? >!>! `  *`     t   @-  x @ !3?.!3  2 "$  `$  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*  `@,@ &$ 4`  @h] 4`   @hX  @o `,`  ` a >"@,`  ( $`!6 ?  .!6!* !4`.!47 J   ` "6 ?`0`> 6 ?:   0`0 ($`4$`0 $* $`@$`@ ,`H@b`<`< `@ 0" !2  .!2 * t" !2 xF!2`  @$ !5`x;.!5  @$ !5 .!5 4 7`4 㿘 #>  a    0  D> `!`a@  @  @>  b>">"`  ` ` z@|ua !> @s" l >  2>> b"@>_"`㿘` ``?` ?`@&`!5 .!5`?&`!5?.!5? X` V `$ + ` `("  @ &`$&` &`(``   @gk զ@gf@n Ԡ@n@f=?- ` &`  .2 *  `@.2  .6`  ̐ ?6 `` `Ԡ" @g8. `@m `. !6 0?. `  `` : `&`@2( ` 4$  &` .2 *  `@.2  .&`!6 ?  .!6!* !4`.!4  0  H /d * % !4!!3!2 !5ؐ Δ H 0 W #\> "h@h/ >|"`$ >? >t"   , >l" $> >e"  *@ @mK ? >W"`    2  x,  @@ @2 t>  " #\03 #`<  `40 >!H0 H /d * %    t `  @" ?` ?"`  t  " ?4` > # ? x H 0>+!*!8{@ 㿈  ` {'>' *`      Q Ұ  Α* R  ǰ     `ְ 6?`!?>&#*`  ` @o `Հ   * @ %6   @o `Հ 2   0  @ot `Հ y  2s   @_r ``   @_0X `H /d * % `Ȑ #`#\`,`0 * *  t . t . !5? `,!5u!5 !2  ,!2 * t"  !2 2u!2   H 0 @_2 >'4* ># >#8>#P>#p>#>#>#>#>#>#> > (> @>| X>y p>v >s >p >m!>j! >g!8>d!H>a!h>^!>[!>X!>U!>R!>O!>L!>I">F" >C"8>@"H>="X>:"p>7">4">1">.">+">(">%#>"#0>#`>#>#>#> > 8>  H>  h> x> > 㿘\ `& & 0& & & & & $& (& & & & ,  ( T 4 @ L X d T T p T T | T T T T  $ 0 < T T T H T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T  㿘 <""> A>͐ #"h H 0"& 0 0 ?& 0㿘`> A"#""`(`?*   *  `>8``@_ > `+ `6"@`4`> `>`F!`6 *24``  64` F4` 3,` / ,`4`֐"$ (㿘` @h 2 2   ﺐ ? А@gb@ @  p  0@0 & &`X> "*` &`d>!@&`h&` *`\" ܒ  H@\ #?ܒ H @  'ؒ  @\ H H@\ؐ H  @>!H`0@d1 H&`t&`p  U.  &`l> !p@d!    *`" `p`l "@ `p 4 @  *@ `p @  *@ `p @  *@ `p@ ` *``p@ ` @*``p@ `  *`ٓ*`l&``p`h 0&`x&`| 0 #\#`   @ `| `2  `x " r`x`!>!@ ې>!0m>!` ">>!> !؀ !>!`@ 0T`X   >=>`!>">"P0D!&`0&`4`0 >`@} bx" @[ 8''쀦'?2 '`@2' @ ' z3   '@[" @ `>B`Đwv>+!*wu@ `    㿐`0@cJ > ؐ"`&`&`X  a&a6`6`&`&a&a*` *   l* @&` \&` * %@ 2"`ȑH /d * %  `ƒ  pH =`ƀ >`>"W``Ƞ 6`#\#`   @   x " q x``>=":6`>!>"82"6`6`6`6`.`.`٘ <#+ a^2 a\  }2 &`̐ &``̀  `#` #\ @  2` x " q x`2`̀` !>"`@6``>#`0.`} Đ  `>`Ԓ#(``ِ` &"#\>#@: ̒ + @ " `̀@2 ` ـ@ >`Ԁ@>` ؀@ >#x >?#  ܑ+ ``ؒW`Ԣ?QO`Ș@#\#`  @>  x " q  x`!>)#`Ү ``٠`ؠ?/,( `Ȕ #\#`@   x"` xp`` !>#@TQ6`   ?#@`2 `А  "  `Ѐ@  `ؑ2  `ـ  ~  }` ~> (H 00) aTQ"  @?  > @f. ` @"$ @\B6`  p`ƑH 0? 0  > l2 * " ` `` ( ("` ( ("`` `"`㿘?2  > ؐbl 2 bl*@ > (`a 㿘? 2  @> ؐl 2@ l,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * % !T죔"H 0e  엔!_  & *`` &!  @\L M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @\+ , ƀ ,` 4 ?`4# @ `*  *  >< c @\O$   @ $  !:Z0 @5㿀?2  > ؐbl 6 6M bl*@"G ƀ  Ȣ'  @X" ?'=@Y"ƀ  )  `6! . @  "   *@$ *@$  $㿘><>#" T㿘><>#" T 㿘?2  @> ؐ"l 260?"l*@    *@2   r " ?,` ?( 2` 2  d ?㿀 D? @2 > ؒ `@"l2` "l*@   T &   (@h/ <  K& 4ƀ  Ȣ'  @X," ?'@XJ"ƀ  "  < D  " < %& 4 % @[] $ P  l$ ` *  s"@> X$ 1 . \   $ $ $ $ $$ ($ $ ,$ $ $ $ X$ 0@G 㿘`܀> pD `T`*`   H @V< 2<>  ! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   yl`0 㿘 X  0P l "@0O>0!>0  k @  >T` А Eb@ 2>>9   2 @A 2  X#P"7 >$!*` X2 *` X2 *` X2 *@ X *` "@0>0P>   kM @  > `@c!(㿘 @^ ` l`x 0 ` p 3 "`h`"  & @ ` *`<@ @c$ &   , *` l*     p*`   $@  *"  ` *`2`  `   @b ? Ӡ` @㿘@  4  XBa     ? @ '   ?  @ 2@ @@  2@@@  " X`@ 㿀 |  |  *  2`  * @  `*` ߐ * | ` *` | `  *` |`  `  * | X *` X2 *` X2 *` X2 *@ X*   X뾐 ? $ | X    |  " X |!>  @(!Ph X b@ 2 |>!h *` |荔 㿘` >!xM  X b@  ?      l` 0  2J4"E4&` p@ ` *` ` `2  *`` - 0 "`0-4"'`)4 "`4`0`0("`0`$`0* "`@`0`<`,@U`H`0 $`"! l 0`@ `< 0w"@ ߐ`0&`kp` ? @&`4`? 4@ 㿘` ,  \ `" a"  `  2   ,  P㿘 X `  >! ? \ >!>=! ` @ @*` `  *`  @    @"  ` "  `  `2 "$  `$  @ "   "    @  B2A  <  $  (`"$ $ ($ 0$ $,`$ $  ` ,` ` ` *  `@,` &$ 4`   @Z 4`  @Z}  @a( `,` ` a >"@,` (@2` 4` 4`9   ` "+ ?`0`- ( ?)   0`0 ($`4$`0 $* $`@$`@ ,`H@T`< `$"a `< 0`@v" $ ޜ   @$ jz  @$   - @ 2X  㿘 #>  a  ސ  0  D> `!Ԓ`a`  `  `>  a>">"` ``@sa !> @j" >  2>> "0>!؁㿘`@``` ?`@&`` ?7&` R` P  `$ + ` `("  @ &`$&` &`(`` !T @Y ٦@Y@`U ؠ@`Q@X?' ` &`  . 2`  . .6 `  А ?6`` `ؠ" @Y|.`@`% `.0'`  ``` D ``&``@ `   &` .2`  . .&`㿘 H /d * %    l `  @" ` ?"`  l  " 4  > "P ?  H 0>+!* n@ 㿈  ' 6  0{&  v r n j "0d b  ^*  Z 2T   @R `   @R0= H /d * % Ȑ #`#\ 2 x  `. x . x" h x  H 0@Rz [>7* >U"h>R">O">L">I">F">C">@#>=#>:#0>7#H>4#`>1#>.#>+#>(#>%#>" > > 0> H> X> h> x>  >  > > >  "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,㿘` @] 2E >+ L 2@  ?2 &   24 >@]` 2- > 2 & >@]~` 2 > 2   = ?2` > @]i` 2    -(?  㿘`     2> > ""&e   (@$ ,> > >I>J>E>E>Eb"XĘ!b$  6`6&`L&`D6`:&`\&``&`d&`h&`l&`p&`t&`x&`|&`&`&`&`P&`X``'>>F>F>FeX `|&`&`&`&`>E>E#ؒc&`&`>G>G>G>G>G#L! a@&`&`&`&`&`&`i!e &` &`e  ` &` &`&et!@&e Iq  &e>M!(  e" &et>E &e&ex&e|  "  > ex@  >ex m  !@&e> !He>>!Xh`> " >!{> "`>@ @i6`>!4 @\  ?  `@ @ > 0hnÖ  @{ 㿘 " >!B& <M㿘% %t  `` "> *! >@ #!Ѐ` #  & ! #   >!㿘> " %t>"%``2" t 4 7 4 3 4 4 4 4 4 %4 4  t $ %$ $  $   $  t 㿘 ` @>i" % =  >Đ"H01 >"hT  % ``>G" $  & & & `/@   $   @O  &  > "$$` 㿘 ` 2 >"Ѐ ">" " $`   @PQ $$ $` 㿘  '%t#0#P妐 d%  > آ`>#V  $> " >#@K㿘@%t  4 %t? 0%t?c0c0 0 000 0 00 0㿘 `  @%t>#` )> "  &%># ? 4   4      4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  > #֔   d* t  \* ` @ *@ l d *@ t  \* ` @ *@ t*  4   " & >#؁㿘   %t> 0 ?& `?# @4``@" `>  "`, `{&  p`` %& %'> ؤ"℀ > @l4  > he  O& $ > "@ℐ& & > P :` 5> D ` `'?`  @0`?c 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` ` `* \*㿘@ %t  $ %t %t   㿘 `  @%t>#`y +> b &%>#Ֆ     ?%   b  >  <$ % $%  ` d* F >!  t   \* ` @ *@ l d *@`  >!(  t  \* ` @ *@ t* > ؐ %   b & >#p 㿘   ` %t>a 0 ?&   ?$   "  >R!H@ "`, `?&  W> "  $@> <4  >6!h  C& $ >Ð "& &  5 `   "> )c &>  ?2 * c2 * > ؐ 2 * " > ؑ2 * 2 *c  "c > ؑ2 *c "cc  "c $ $  `> @ *@ \* > 㿘>  2 # ? 2> >d!"H"H 24 4  `*` * " > ْc* @㿐>  !> "H O$"H 걔  6  6  * * > ِ" c* `@㿘> #$  >     >  > *` * " *   㿘> #$ >  "l  > l 2  3  * * > ِ" c* ` @  㿘  b@1> #$    MQ 2*&#$' > #$ >  "l  > l 2  0 * * > ِ" c* `@@㿘> #$  >  " >    > >  >    㿘> #$  >     >  > *` * " *  $ @@  ( € 㿘>  ` ``@㿘!>     €   € 㿘>   !> > c(?"c(#(  € #( $#(㿘>       ( ( ( ( ( ) + + +, - - - - - - - +T - - - - - +x + + ,( ,` , - - - - - - - - - - - - - - - - - - - - - - - - - - - -X -` -h -X `!,: ``> >I#\*` >!:`2> >}!Ȑ#P? > p' R(`` % >}!>}!! 4> b}” 4>"0~' ? RĘN&`>"P~ >}y"` B', `@2` >2` ??̀ >}f"p'@1 " `  !>0>0> ؐ ?> ؒcp* P @ 'R `'  R `}:"` Ñ, &`㿈@>2` ! "2`J2`8 ` @  <  @ &  4& >I#t,  , , @, *@- $  $ @@Ր  @ ,@  @ ,@ 0`& 0@h  @ݔ ,@ؔ@Z  @ϔ ,@ʔ@pL  @ ,@@    @ ,@@     p.9"Q$` M  @@ ,@`    @} @f  >   > ؐ#0J p.@  $ *$- `$ * ` $ * $ * $ 㿘  ,@,``2   @@Z ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  2    $`   $`   $`  B@#@$`@i ` 9$`?  @  @  @  b@#   `?$`$@  @>` "$`>{" b #$`$`$`$`@   , ,` " : 2"5 `2, ) &`` ` `     `    ( " 㿘  `,, `,@80`2 `@@n   `,  " 2` " "!``   ` @`  ` " `!`  ?" ` @ @@`&4  @4   ` ! @ @@`&4  @4   ` ! @ @@`&4  @4   ` ! @ @@`&4  @4     ` ` 㿘`   &  & & & @x&  㿘?.@6`2 `*  ?  & & & & @a&  `2  2&  & & &  ?& & & & &  㿘?.@*626`@.g<  & & & & @0&  g 2&  & & &  ?|& & & & &  㿘?#@#6*@6/ 6`..7 @ ?#  & & & & & @ @ ?2&  & & &  ? @ & & & & &  㿘.2`&`&` >0 >0=Ks  yϐ"2 &@` 2&@ &` & ?&@㿘``0`) ``(1 ` (`6`@20` 0  +"   "`" `  `'`  '``2'` @ @@'`'`'`'` '`'`'`'`  0    `?㿘@ ` "`` 4` r"@@ؐ "`` $``  2 0`1 ? #$`㿘@`* @ [N E2`M`4 Y Z"@@Z  `@2 9   @& `,@`@2>x"8 @`@"` ` & u "11 #`,`1?*@㿘@`* @X >M'@2`&J  ="@@C  `@2 @ 5&  @& ! @( <ܒ `@"' ` &  ?1@&1 & 4@`, &`1?@*@㿘@`* @ Q#@2`&<#@  "@@ @`@2 %@   @& $ } `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@  @㿘 >>& &&x&w"㿘   ,@ ,@   2@` $` 2``        `) , ,0`1 4  @ 4@D``  `) , ,0`1 4  @ 4@D``  `) , ,0`1 4  @ 4@D`` `) , ,0`1 4  @ 4@D. ``c  `) , ,0`1 4  @ 4`      㿘 ` ` `@Q`` ``` B : 1" `! B  +`"   B 3`` `   b`    B @ b`+` @  B 3``@ `   b`  ` B  b`+`   B 3`` `   b B `&    b`+`   B 3``    ` ` 㿘`  & >vi" `r     >v["! ! ! ! ! 1 `_  @   `?@   `$`  ` "2@+(@*@0@(0  3! ! ! ! ! 㿘`     `8"  @ 7`  7   /@+32*@@/` /   0@32+*@(@"@"""""?   LL      q q q qx q qȝ㿘>+ L  >`@O6  `?w#`>`w #(    9F (fɀ  ( 4("@`%>+L *>!> "T@J!> #(> B"!$ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ t >iА"P"@>@Jn!x!> $ H ƒ  \ d@# `L z >@#0  @1>@bc@ >u6#P>c@@I 2>u,#  >u&#$?>u!# , ,  0Ԃ`  ", > (u?P@@L ?, ,  0Ԃ`  >t p@8?p ?p`>"@@] 2 >@>@`Ȕ 2>>t А@`Ȁ 2>tِ!> ?* > """L  > #=@?P` ?P*㿘'> \@I֒!%> B` ` @@   }L -y ML`1L L` @ / 2*@*@L @? `L , : `L : >  L?$` $`> `h`  "`h \L /̠ \@,@  ` 2L -  L c"> J d a"> J4> J  L s> J c  "c c  "c c $"c >u!0۠ c  "c 㿀!>+ L 2N`>u!H0' (''x`J@ , L`pJ@ , L`h L N@ x>@N` d2>>!X> &!X!`> &!` . h?& & & `"h N`>ahuy@R#> ?`h& & &  $`hN@>N` apuf@Ry`h&  & /&  i l$*`N` e2 *`>!x#> &!x ?. `h& & &  $`hN`>N@ apu<@RO`h& &  :  sN` d t r> ">  >S 6 2N>>!`> &!` ?. h>& & & !`"h 6!>!x> &!x ?. h>& & & !`"h 6! . h&  & & "h  >!x> &!x ?. h>& & & ! `"h&& & & `"h  >s1!> # LJ 1 :  : N@>N`apt@QȐ> h&  & & ~"h f@N` d*`>!> 6! . h & & & f"h*`:  l#*`N` e*`>!> &! ?. h>& & & !В`"h 6! . h&  & & @"h:  s<N` d t r4>!#> &! ?. `h>& & & ! `$`h&& & & `$`hN`r >at?>N@apt8@QJ`h&  & & $`h㿘>s!N >> !s  !s `>"s`a N 2 >sڐ"> A  㿘>+ L ,> B!  '> "P@T ">@M  >"s `"?@` &` &@L *?Ѐ &@ $L 0` &@㿘!> #  > A>> A"Hc  $#> A# .  㿘!> #  > A>> A"Xc, $#> A#,.  @ > D" d> J# $#>+m`L W >,al 8 > #Ѐ@,  &> <@ <@ *`: * @al *` > !䀢@"  2$R  $ 2 2 >q"h' > cX '.'> "b>q"`L `L@>@b>@K!bȀ `L>"q > B@> B!`x>V" >"b'']r 2`L>qy# `LӇ `L  H o@@6@Z>+"!H/ />+!@Fq(0@7eH 0㿘>qJ#㿘@D#> A#P>#0#@Drѐ@K#耢  #@L~rĐ .,㿘`" 4> r#8 4 > 0`#H>#X>#`r{  㿘1> A# 2 &#@% 2&#>q#h㿘 " >c@@J~ @ > 㾘!@E>c@!?>"@^  @̐>@JWc " @N,  >>#r( [  >>#ؔr & &@Ms &  ,H>` @m ? &   >> q <  & (>`@@T @?"  >> Hq <  &!0>+ L 2?@ $@ ? ,   > pqΔ 㿘`@I `?P'>+L  !> > >>  pqa >> p@?c@NF>> !q`pL 6 @EN!D>"5>V' \@EA!D> >#\ax'''[ 2>>p!  ''[  2'0>>! L &@  5> B>b@>b@Iv @E!D>V''''[ @ >> B > B@D!D>">V''''[ > B!` `LJ ">> " `a@ > "``@>a> "bP>o!> #\' >"po'  >V[^ 2oL SL >>"@  @f>@HbȀ ;>c@\ @H 2 )g ">b0@HҐ>@HΒb8 > > cĐ "c> #Ā  >VH 0+>V'[ @H L㿈!>+ L 2&? "<  "<@ >"8> '''"@o > #X ' '耢 26 L? )>@  L`>ax >n"`@ bx@?">@>ْb8 >  "nϒ`@Ӕ 8>+ L >0 > #$ > #$ $ p"t > B!  " & 4%> !`0$" > n"`N Q>` $`$ @` A >"o`>#oߒ Ȳ e@>pa >nh# >0>#H>#n[" @!)`@K     @  $$    >n=#X>o#x㿘>+ L >#o > B!` €> 0#Ȓo~ 㿘> B!`€㿘> A#`ʖ ?" ,㿈  㿘> B!``@㿘> B!`@@㿘 >!>#bː@GV  ݐ >>mÐ##@GE %>"@= >@G6c  >@G.` ƒ 2 > 㿘!> B!` >n  `@ !`@ 㿘> B!`€8@ 㿘> B!  8 |@H |€0@0> B!` `  @ >>`@n&@`xnۖ&@&Ԑ  @  㿘>+ L? > B! x"> B! t㿘>+ L? > B! x"> B!`d@>m ȝ㿘> B! l㿘> #̀%# > ّ*" `4* `@`@?" >  `@$> $ > #` : * $  ?2 @ 㿘  > ئ#,`@H"@K5 ``> ذ? > ؔ*```> ؐ 㿘@! >n!3>> ؒcna > ]# > 2 a n   2>m"㿘`> @? , : ?.> ذ#@F > ]?# "%, 2 @E  2   >l_!0*?c *   *` & 2,㿘  2e  2>lA!@@AX $ $ > `d`d $" $ "`d>  h?`'p> *`#<@ -> > تĀ##? 2  @2!>!`x2` `M m >l!h 'pK> 쀢  > J# > Jc  "c > J# ">mR! >`!  a mD '>mAᨢx@  @Jy@G ?L@ * x ,@  t tx   t >  G>0 p >@ ;?9'pm! >`!  bllᨢx@̒ ޒܐ`>R `*` ?'pt? @2  `@?`v# @* ` * 'pp> t> %"c9"Ȁ 2,z ? ,` **` ? 2`   2 ` *`@*@ > %Ē?> "#'pp>  "#̀ \> >!alU>  >l!0`@0]> #)? 2  >bT> 2"> a3 !lp> #̚?%#̑2 2  2`  2 @2 2 2? 2`  2 @2###"? > cȀ@> > #"c>  d  2> cē2` `  @ 㿘 k ",> @ ">  % !>  #    >k",@ >"?k0ѐ" k0> >>k"0Ð"k,@`x> ]#>c0l@E@E >j]" @I@HY@C֒ 2㿐㿘>+ L<x> " @>   @ > "  Т@ * Њ@@ Ъ@@> >"k"@㿘> > > #\"* > "  Ԃ Ң  Ң Ң> >""@k`"㿘!> @= Ģ @= ܔ*> #\*@> "`> "  Ԃ  Ң Ң  Ң Ң Ң>T "`"  pК@ `к@>a  "`"a>k"@㿘>   @> #\> ?* > > " "!"8 @   ТA0ТAЂA  @ @ @] :>! !$ >` "`>i|"P  >j"@㿘!> @= Ģ @= ܔ*> #\*@> "`> "  ԂԢ> Ā  ̒ @ 6  ܐ ТA@ @  > ܀  @ 6> ТA0ТAЂA 2 @ @ & > >"`j"@㿘> >> #\"?* > "  ҂ z a ଔ 6a Т0ТЂ 2  & a { Ң> >"jm"@㿘#>``@<`@<`*> #\*@> "`> "  ւ`̀  @  > ТA@ @ > ܀  @ 6 ТA0ТAЂA  @ @  ֢&Ђ >>j$"> >"`j"@>  >`  > #X`8 #X Ģ0 ``8 ` Ģ> ``>+L"`* * 8>8  Ģ > >+L"* *`* 8*`>> #X8 #X Ģ@@0 8  ĢA@> >`  Ģ0 > X8  Ģ 㿘#>a >'> X>  `2 X@;"@`  . $ ТX0`" .@ ` Т 0c  2 `6 6 z `?06>> ଐ   ࠄ8 "  Ģ` > ``>+L"`* * 8>8  Ģ@ > >+L"* *`* 8*`>8  Ģ  >> > X`:? "` Ģ? 㿘㿘> cX  >     #>`cX2@;# @`.$.@ "` ТB@ 0c  2 `?6 6  `?0c  2 `s6 0\  Ơ  ƠƠ㿘Lɓ>>8? ? > A㈀2>{ ㈄ o ??  Ģ> 2   ? 0 (  > 2`  ? @0 ` `?> *  > 2`6? |> ߄ć* ? @ `2 ?@ (@* @?> 2` ? @ `2 ?@  (@* @> ߄ć*"?{> ߐ?㿘@2  ?6` " ` @:,&ɡ&` <* & 2  㿀`H   2` 2`> ߦ ?b  @ R 2  ' 4`H*   '* ?@ !  2` *`: '2`  ` '쀢 4`H*   '* ?@    4쀤`  '>!>f "W`!02 !0 *`='`* 8"2   ' 4`H*   '* ?@Ľ   2    $  4`H*   $ * ?@ Ġ  n Ębĉ  X"7 *  6 7?7y G`􀤠2 !0 | "2   * !0"@}!0012   * *  " `H  S  2    * *   " `H  8  㿈(  2 2  2| :2   ' 4`H*   '* ?@ `` 2` *`: '2` `  '쀢 4`H*   '* ?@   `7 2  `? ; `*> H€( % T  2   * *  " `H  ñ `      @   ?"@ ? 2    * `,+?%     $ (, 04 8<  @?܀             ? 2 2 * ` `2i `? 2 * ?2   8"  㿘 > > "evc > L> A㌐"  > Ac   "c>c#0 > A""㿘>  'J > Ho o> a"(""(H 0 * > />  J` M*` 㿐!>!8''€ 2  H>>  L#Hxe3  H  ?p>>#e>c 㿈"> c*> @c &`Ho o> A#:  > hc  >+>+ L 7> >+ x>+. `L!`>"!\>"!" : ?.) 2 @2(R@"> ?).   (R>#\#`#d cB. "@@  2 "&` H 0 x>+ x6` . !@cHo o> A#:  >> ߐ".  > c>+ L 2>">"!\!" : # ) 2 @2(R" @ ?).   (R>#\#`#d!bޖ  q8  '''  N@*   `H 0㿘H /: @ bڐH 0.  㿘! 2   > B>b!Hᘐ * > Ba+ "ᘐ & & " "@㿘! > Bᘛ2 8 2 >b!X> B!"` +`"&   * ( ᘁ t d 4 D T㿈 ?H@ 5>+L ?H?L W>+!> K> "cc#> #X>  1><>* c!@͐ @ *@ !8 >b2!@")> >b)!#4 * * #`+> B!8#\b ?ޚ? "b>b!3> '#4c8@5@@ :@  %&c8#4 c8@5@ ,X@    #4 #\    ݚ 2> >aא"# `4X@#4*b!8#\ Y > L"c,#> ??$`!> ?0 $ >  I > ߀`"#0>a"@  `" `@ >a"`>"#\  R > "`>a"%> X`>`"b*@ > #4!>X"Ĝc8b㿘%> 8  > #<> ĉ@5 d$81> #4  8  #4  #4 ̓*`#3@(#4$3#4> cX* @48@@4$8#4> D* &. . "a܁㿘!( !," !(`@> " ?   ? !4   $`!4 ?&!4!0  #>aݐ$a(d *&!0@6 P$a$= #$H$$$$,&㿘`    -03> c@>Sc@ c@  얐 0>+ L>i> B!$,! ! ``H @ !*@ `!!#!  'X'\'H'L'``'d` 'h@*@ 'l`?P'p`0't!   0'L'Dx9D?@*' Hm ? 7ݒ $`$`H$`$`$`㿘m@* 7˒ @`23   ", ` ` !,$ `<* @  #` # `# `# `# 0`# H@  $a  a ?"a `?" @&!?㿘>+! ' [> J "# > H > Ba > K""ai"H(>Ȟa~#H/` /!>5@f>5 9 ` " >>ae#(>a`#H>a]#h>aX#x  > A s*c  @> A# d*  -> A*##* > A*#> A#㿘> #Ȁ"2 > ٓ* "@4*` `@ @&> c`> ` *@  * $ $> > "cT"P> A  㠝㿘>+ Hr1> @#Ȁ?> #P %> T #? 2 2 > ` `##> ٕ2  `4*"@ `*` @>`ߐ#?#>`ِ#0`2` `*`" * T>`͐#ؒ@%͐@%> c`>* `> "> >" > #X= >`# :."@ @8> #X?- >#`5 !> A#@Ŗ ##ȟ@#>  @n@ 2 4`  צ  " >e!|,  >`o#0>`k 0>`g 0 >`c 00 >`_ @0> P`Z㿈s>`P `>`M x`%>  0> <   $ ( ,#\ 4#` 8#d 8`9#h 8 X 4@4 " 0㿘> A #> ?x"cX 8 `>^  @ ? ">^ cX  >+ L@ @ *@ . > #` cX& 㿈> B!`">>`4_!#> _!#> cX > !(    _#\e>_Ґ!h > *@ !_˒cX *@> 0> <!  $ ( ,#\ 4#` 8#d 8_#h 8 2cX>_!Ё㿘N@  t>0``>0>^0!>_!0 _"0 0_" 㿘>+ L >_"8 H/` /> B!`2a(>+!` {$` H p@` * ( 22#  *@ `  `" *`0*@2@  `*@㿘!,[ P 㿘!0> ߒ# O! P t t t t t t t t ? 0        㿘?  2 @а #> Ac #> $##! ?Ø # >!>   `$c><> !8cX$  2`>]]" ` ?``?&@ &`>]M" 2 @` >j *` ` @% %> X> ,`#> ` `>    И @` X`" @ 8 ` 5ϔ`X@e@ b`` ?G#@> #X?H @ > "d@ > "|@ : @` 2 @"@ @ 8  @@ 8 `@? ِ H *` A &`> >+ L $  ` %> Ā  > !> #X " #X@1$> `#X@ 8 5l `  "X@? 2  @ !> A# #@ $#? ->+L   㿘> B!  "  @ " @  㿘#  " &D, ?㿐#@2> "P &`%> A@> "P@> BHo o6H p@  $> B!0  c'@'  #@Nc@ܰ 0c@c@m 0Ҁ` Ho o€H 0 @` &  " 'Ho o H 0Um`o_  X xHo o H 0 @2_ ^A`C3 2SHo o€H 0@6ސ @ $&  i2"< Ho o@H 0> A`% ! Ho o@H 0> A"#& ""  "  㿘> !\@㿘!> ><> !8 a0#X#X >! @#Xސ#X` @ 2 㿘><> !8=X㿘 `#Ђ   ?.  $$Ң``  ? 1?`  ?1?** `  >?.  "Zْ 2`( $(2`  ?(:`  㿘>  0 Ҧ`z> @`  >l<*             ""@ "@"㿘 @   @$@ :`$@ * `$ $@> > ""@㿘%> > ""  뚐#>  $b  >ZS#b> "ഒ, `@> X @ഓ2@ b "#> b > ",     @  > #` 2@2Җ b > >  5 > ><`dP2 08@> * \    "  # 080??  > \* d( #㿘/>+L  >YՐ# > %?> +?"bd""|2 @> %?> +?"bd""|@H4*` > $* L`⌀`@Д`> c @&> \!a? > B> ! @2 4  , @ 2`>  ` * Ƞ? Є Ф> #X? 4&@&㿘 !Ђ* >`<  `T   Т@Ђ ```>0 >0> p>"@YO#P>YL#@>YF#`< `T  㿘?. #+ `$چ ` ( , (> (@ ?( @ ( `  `  (@ +  z@???$ ` @  ` Y#` ?˰ 㿘?.  @, @؆  " " > ?(   `   @(@ +` z@??  @   Xΐ   ?԰ 㿘?.  ؆  ">  >`* @.`@  z@X PX ? 㿐> ! ,!` "`" "@$ $  "& $ ` $ `"&`> " ,> "",0 "04 "4.`$> " ">Xo  `2> >Xh А @2>Xa ` "`" "@$ $  "> " & > "  4 0`" 0" 4 * @`$*` `2 >X:!* @@>X2!@1 @@ )`>>+ L 2``"Ң>Ю@>!P € >+ L 2   *`* #@ * : *` >+>+ L   "Ң>+Ю@>+ L   Ҫ`  Ҳ` >  Ā# :><!P?(` 2`@: @> * \ @   @  #@  &2`@: `2`?>   `\*`@ * @8 @" ($> #X@ !>+ L` >  >  * *`:   Ҫ`> `!   *`* @  * : *` Բ`> !5  ` "` $`  "@ @$ ` $ `"&``$.* @.  2 $ 4 4 㿐> .`bx"* @+   $* `>+ L 2+ * @+ : *` >+ L  Ҫ`  Ҳ` >  ހ#  :> ><!P?+` 2`@: > * \   `  @2`@: `2`?>   `\*`@ * @; @" > #X`` "` &  "@ 2> >Vא!h!*`>   2``""`> """@> b `0?"`0`""`> """@> b `4?"`4""> ! " "@" > b `, "`,㿘 0 6`*  $* @6`` ?*@@= >  ! @ `5 І@ "0?0.?@H /f * ' > " >+ L Ү@`> Ҷ@`>  Ц@> #X@`H 0 㿘>+`L   0 4H /f>* '>x   t #"x+: |@\@"|??""|`> ""|> | t,` "@!  `L@    `0&`44>+ L#& G&  @>!X $    ?>+ L  `> ``! Ъ` > ``! в` ? 2*>+ L - - : %*` *  аH 00 !>!` ,,` p: @  z@">!X "Ң`H 0㿘#>+>U!`L &"#>a` "aXp"aX "Ң`Ң/>% @>!    >X`L ">@>!X  Ҫ@>>C`L   "Ң>Ь@>`x$"`x㿘0H /f4 * '    H 00 @  `2>U!4`*` `$* @4` ?>U !*   > !   2>+>T! L 2<` <`  | *i$@ % >  `x@ `|@ X2 `?#@?#@(M` Ҫ@@>!L@   Ъ@@>+L + 2  Ъ@`L2  в@`L> `#`<`  <` ?* @  <  @& *@ >+ L 2<` <`  | "@    $ " ?$ 2g @H 0㿘mH /f4 * '    H 0_  @ P4`*` $* @4`` ?>TJ!* @ > ! "6  Ъ@@@@>!L@ Ъ@@>+`L  Ԫ``LԲ``L> `#`<`  <` ?* @ 6 <  , @2%  @H 0㿘  >S", +> " `  "`> & !&     & &   M& *  "& ` "` &  ?A& > b `  "` >S"( 2  2 > "!M{   !   > `   2 > b `"`  & T㿘 ` ` > b ` "` & & E& B& > " ` "` 2%! " " ! #"  `& ! > > ` " >  "!> !Ka 2>S?"8""" " " &㿘(H /f4 * '    H 00^" S"``>S"X7 $ >  `x ``|*5@`" ?#(?#((@"Ң>!L@ 0Ң`  " >"xRܒ: ` & *@}``  $` "@` ?$` @`2`"H 0㿘H /f4`* '`   H 0C "` `4Ò 2 >"S"" Ң pҢ`  2 `<    @>!L@ p Т@` ?|2%` "H 0㿘  >RX", +> " `  "`> & !&     & &   L& *  "& ` "` &  ?A& > b `  "` >R"( 2  2 > "!Kے   !   > `   2 > b `"`  &  㿘 ` ` > b ` "` & & C& @& > !I > >Q̐"А  `"  ` 2" `  "  `&   > `  " 2 $$ $  $ $ &㿘H /f * '  `+%>+L  "@@@@ L `"Ң> Ҫ@>!L@  2 >+ L  "0@H 0㿘>+ p!> $#X֠#X>+ L : > "`@@㿘>+ L'D'H`'L` L>  " > >  "`L> ߐ"c>>3> &bX5> &p>;> D>'`%>~>  c'>> ")>> "+>"> "->{c> L"/>|> "\> ?">>>!>#>> > " ` `̠"hb7> 9> > > > > ?&' ! " "` 'L " "`+> >  "`$  T> > , bX@ #"  ?>  `, * bX 2 ?HْLL> *`" > * "bx@%!>D$ t%`*@7> " &> """"`5> " &1> #X > @ * #X"@ @"ܐ@> "?> "`$ \   $ x$ \&> Ba$>?#"?"|@ >+L !2 <`  <` ?`>  Ȑ` $#>+   ?D4`D`  6 %D &%`% `""`% > `` % `""`> " 0 "0% 5 5   ? ?$5 @* @2`>  Ȁ  ? ?$@* @*` `   -`  @#X > `ȑ*  @#X Ф@ @ L>5 %`% `""`" ,L ",  > \ ,  @  >  <`   ?#8  ?>+L > ! Ь@`! д@`@> > \   Ҫ@>+ x>#|+@  #Є@ Ф@> #X@@ '㿘>`3> &bp>> b7> &Д >>"Ԓc1> ;> &"X'c+>ct> >"a" />}9> ' خ> )>"`̨"`> ""> >>!>#>%>'>->|"` > > > > > "` L> 5> & `!# #b""\ > " "$", `@$Y"(> "X@$U  T3> bX> *  " "@  ?* * bX"@?#>>  `\$`t1> *`& @$@$17> X $ `\* >  "! , @+̐&$`p <!> $"@$$9> ' ܤ@$ $5> & @$$  * "> "b` $(: $,``pz( $`+ ܢ -``$Ȑ`(-`@ 2  cz@%  2  >P)#(-` bX $ -` - @*`  ,2 @ , z@?$@ ``̬  *X> "``"`> ?> "">% \   # x% \&%>?#>"`@<"`|4`*`  $* @4` !@  *>@ !2`  > a@ > b`@ >+>+ x@ >#|@ >+>+ L <`  |<` @z@X@@ ɓ4`%>  !> !-> b`!" @Ðs㿘 "Ң!,   $Ң` p2  ?!Т@ $Ң`㿘>+ L   >  $ +> $+ 2   #  ! 2   @ ! 2  ,"@  & & p㿐!><!P   >  \+     " @> #\+`@ ><*@ !8?  2!P>M#@ 6> >  \+    @  "@ " *`@ > >!  ch#\ D >+ L> ߐ "c|!> ߠ#X> A>#Țcp$$  D#\> B>#\ c!! D 㿘>+ L > ! ҂`>!  ` > "`> #`"@ 2@ @a 㿘> @ #X> #@@ 㿘  "q @@"i @@㿘 " e++& >+ L & & $`&  & !& > A EO#Ƞ(& (& ,  (*  z$ ( > *  c#z> & 4㿘   ? & @a "㿘H /f#>+* '#>+`L    ">L#    >L#TH 0 "`L1 "`L   > A  >Lǐ#7> A (F#& ,& (  " 㿘 V>  > "\>  )>+ L  "0@H /f@* '@'  L6` ?`6` * ** :`* @ **  $* @ ` @  LH 0>+ L  "0@㿐. $* @@ / @ `  Ҫ@> #`&2  >!P €[@!  U@ @ O> 2H  2><>!L@><!P?,` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ <  @"   Ц@> #X@@ `(,>+L ../ @: /  > \  Ҫ@L > ! Ю@`! ж@` c ?, 㿐. $* @@ / ~@ ` z "Ң> #`&2  >a i aP€d@>!  ]@  ?@* @ S> <2E?>!L@><!P6` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ > @"  ? pҢ`@ ?*   z> #X@@ >` ,`㿐. $*  E / >K#ج 9 ;> >K#a @2d>+ L 2>` >`  | @G@ >> 28><!P?,` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ ”$@> #X@@ `-  "% ? ,  "$ > #`&2@  Ԫ@` >!P €!  @ z  Ъ@@>+`L  ``L``L> `#`>`  >` ?* a @ Z> 2H 2><>!L@><!P?,` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ <  @"  * Ф@>+ L 2<` <`  | "> #X@@@ 5->+L ./ .: /    L a Ю@`ж@`S "% ? , G "$>+ L   0@"& 0 4"& 4㿐.$*  `  / >Iʐ#ب  2>I# "Т@> > #`&2  P€c@` ^ ?*   U> <2E` >!L@><!P4 ` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ <  @"    pҢ` ?*  z> #X@@ >` 0- >+ L  / . ! Ң``/   z> B B% ` ? ,`  " Ң`(.@z@@s "`B$@㿈> cX>< 4  P2@2: > * \ @   @ #@  2: 2?>   `\*`@ * @ ` ` 0H /f4'* ''   H 0 0Ҋ@' ?4`- $*  4`  `?>H *`@ `2>H (-  7>   2` >+ L @<` T |Q<` @ߒ "&@ ? - ֒ "$    Ҫ@>!L@0  Ъ@@>+L *2  Ъ@`> 2  в@`> LX` <`  <` ?* ֆ:>  HHI `@ Ц`W>+ L 2> >  | @L">  2> \,  Ҫ@>+ L > ! Ь@`! д@`   ?+-  >+ L  Ю`ж`` " % ? - T "%>+ L   0@"$ 0 4"$ 4> !A , ' ' ' Ҫ@H 0 㿘 0 @H /f * ' @6`*  $* >+L@6` ? ** :`* @>G 8 ` + @@ ` 2`ز> !  2L @ >`  |>` @Ɣ@*@"> #X@@@ #  Ҫ@@@@> " $   "$(>aL "(@,Ц@> #X@@瀦@0  Ъ@@L *2  Ъ@`> 2  в@`> LX` >`  >` ?@y* X҂*@Т@ @ o@H 0 @㿘 > cX >  .@  !!`  @6` ?6`H / * ' *`  $*  2 >HP 0> >HI 0x `+  "`  > !   >+ L  >`  |>` @@ @Q*@F&@@@   Ъ@@@ @=  2+>!L@%Ъ@@>+L *2  Ъ@`L2  в@`LcX` >`  >` ?* @ @ .@ @H 00   `" H 0㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?>   `\*`@ * @`$`  0H /f4* '   H 00"҂'x 6`- $*  6`` ?>E ,`@  2?>E!,   " Ң>!L@ pҢ`>` @   ":>E֐!0 @  z@ 3>  . -,` ! Ң`,` z> B ? %@ ? ,  " ( "Ң` (-@z@  "&?g> !?` 2  ?% %%"ҢH 0㿘> Ȕ0 > `@` `h@"H /f * ' @_>+6``L+   $* 6`@ ?+ + :`* @>EG 8 ` *@  2ز " Ң)> #X '> &:  @"`$>` ?* @ @   (`" (  < >!L@ pҢ` ?*  z#X@@ޥ>` @H 0"㿘.> #\> `>  @ .@  '>  ` "`H /f * '  " Ң<  2p>!L@p Ң`"  ? ` "`|H 0㿐>  >`  > i > #| *  63 > ><#`aP6` 2`@: > * \ @   @ #@  2`@: `2`? > `\*`@ * @ > #`?6*   @>    @@ɖ  >D8!P@㿐6`,` $6`*  `?6,@ H /f * ' 5>   @"\ @6X #@  H 00G ><!P?.` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ ʔ   Ҫ@>!L@  ,  @ (@   )> " >4   - `\? Ҫ@>+ L  Ю@`ж@` >  ?@ Т> #X`@H 0 㿐p66`*  $* @6` ?H /f+>+* '+>+`L   0 4# 2  :  & & 4   & 0 2" " b  "Ր%-  ?> !4, @@>  Ȓ "*  G   $@ ,  - > !   `L 2>` >`  | &    Ҫ@@>!  @   Ъ@@`L  Ԫ``LԲ``L> `#`>`  >` ?* 6` #@  H 0 < ?& <K ><!P?,` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ ` >!L@  , < & < @ @> ! ">+   Ҫ@0  Ъ@@>+`L  Ԫ``LԲ``L> `#`>`  >` ?* @>+ L 2>` >`  | $H 0 㿘>   㿘!> #X 6@` #X>   q#X㿐@?x*  `@`<@6> #| 1><> #`aP6` 2`@: > * \     2`@: `2`? > `\*`@ * @ > #`>  > 6 *` @@ . "@@  @#@   >A!x    $ "  $ "㿐=6#@ >!A6`*`  $* @6` !@H /f * ' >` ?* @ 2S  <H 0t0]D ><!P3 ` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ Ք  "Ң>!L@  ,   7` 4/@p Т@` ?*  zH 0 㿐6`,  $* @66` ?H /f4* '  " "   ."$, $ 2> B 8  $ ? z@`ʐ  (2 , @  z@-`@`!@> B 8ސ 2$@  ,   ,  ? z姐 2 -`@  z@k >` @  2\  ?<H 0 < ?i& <I ><!P2` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @   >!L@  , < & <  7` M/@ " Ң pҢ`>`   zH 0 㿐`x* `  ``> #`6@><!P.`@` 2`@: > * \ @   @ &@  2`@: `2`?>   `\*`@ * @">  7 "㿘>  @>   㿘 r6`*`  $* @6`i ?* > !    D# @@  >+ L 2  "Ң0Ь@@ֆ@) >+>+ L   "Ң>+Ь@@>+L   Ҫ`L Ҳ`L> `#`>`  >` ?* ւ @ `>+ L 2>` >`  | @ > #X ? * *@  &   "(  $ 2`((  2` :`  >  `>+L2(?*@ o" 㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?>   `\*`@ * @ " s ?$  㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?  > `\*`@ * @`2`    1  㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?>   `\*`@ * @ "  ?$  㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?  > `\*`@ * @`2`    鱐  㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?>   `\*`@ * @ " / ?$  㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?  > `\*`@ * @`2`      㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?>   `\*`@ * @ " ꯐ ?$  㿐> >< 4#` P2@2: > * \ @   @ #@  2: 2?  > `\*`@ * @`2`    m  㿐> #| 8 4> ><#`aP4` 2`@: > * \ @   @ #@  2`@: `2`?>   `\*`@ * @ "> Q> #`?4* <> @Ҥ> #Xm Ф㿐%> X'>< 4  P4``42`@: > * \ @   @ #@  2`@: `2`?  > `\*`@ * @`>! X X ?4@4* P(@ 2: > * \ @   @ #@  2: 2?  > `\*`@ * @` X>! "XĐ X ?4@* > <@Ҥ@XՐ>!L@ ФФ@㿐#> Ac   4>  > A> "\ $c> #| :> ><#`aP4` 2`@: > * \ @   @ #@  2`@: `2`?  > `\*`@ * @`>! > _ > #X >4* a  > A# 0Ң`cz!> A#Xq## 0Ң`c z@㿐%> A 4 `4!>  > A#> `"#   $> A"#> A"c!> #X#>< aP6` 2`@: > * \ @   @ #@  2`@: `2`?  > `\*`@ * @`>! #X #X 6@aP6*  ` 2`@: > * \ @   @ #@  2`@: `2`?  > `\*`@ * @`>! #X鰐 #X >6@* a  > A# 0Ң`z> A#Đ 0Ң`> A#z#X> A#!> A#>!L@## 0Ң` z@> A#Ē 0Ң`> A# z@㿐>+ L 2i" Ң `">  &@  "><>:!!P4 ` 2`@: > * \ @   @ #@  2`@: `2`?  > `\*`@ * @`   猔  燔 " ?  0Ң`|@<2> >!L@> #X"0] \ &><>:!!P?,` 2`@: > * \ @   @ #@  2`@: `2`?  > `\*`@ * @`   # ,2> >!L@> #X㿘>+ L 2>:8" ҆`& >:/"8@Ҧ> #X> 2$$  ` *` (`"8> 􀠠@:88> " "@㿘>+ L  >* 0 >Ң㿘 H /f4> B* '> B!  >㇐0!`>+ L  "Ң0 Ҫ@H 0㿘> ">+ L*`  @> ! > ` * > #X  >㽀7>+L   "Ң"  Ҫ@"#ʤ 'Ѭ9> #X`)> L* "?$'`# # > !   "* @# #  > "X!@#  `> #Ȓƀ" `? 4@  #   > #Ȓƀ" `4  ?2'" +L> ",      ?? #   > #Ȓƀ" X`4"> L A/>   @0>+L  `> `>  Ѕ' #   > #Ȓƀ" '`4#X `@L>+ L > !  Ҫ`!  Ҳ`耣 > #Ȓƀ"㿘H /f * ' > #\>aH.€ '>+L  "L@L  "ҢL Ҫ@L L>  ݯ   H 00/ 0Ң`{. 0Ң`{L 8>ք H 00Ф.֤>!H €L  "0@H 0 㿐> cX`  @("`   2 >+! "`&&> > !a9 >  .  >"P8> B! 2 > K" $!, *!(  "_' L 0, \  0& #> ʀ ဦ $䀦 0 >  " ဦ 0 뀦 퀦 0 > ? ?n > #, > > !9.a'     4> !9!a 2'`&&     !0  >  * !> ߒc/!$!0> #t 2 '  ɖ   #>a G!0m$a &@ Œ  ` > ` > 7\" H` 4 @  ` "$`> 7L"0B@ݐ  H`  @  `X`` @  ` ?> 7,"@a$`!4 д "v' ] a> 7"P!0$a!0' M > 8 "p'  E ' ?  `'&&6 F> 7"A7" `'&& " !4 0$!47ݐ" `'&&      쀢`  ,(!@   > ! ,! 0    ,@ "0*@ $ ,`А;ޔ > B" " ,    쀢`  ,(!@  Đ  ,  > L a"; ! > T*c@>!*@&㿘!(` ` 2 x  x@ @ 2??  @$` 㿘H!(" 㿐'> X> B!` "> K"  д>  >  n @ @   @1. 2!(H/` /> > "7> 6# ">+ >'#D@K>+! 2H!(=#@ ><!8qΔ 9!($!,  @   W &( @O @q  Ԁ@  X> "2  Ȁ8& "  @0 + @ !(   ``H/` /> > #07"> 5# '`o'`@'      @b   쀢`  ,(!@   > ! ,! 0    ,@ "0*@ $ ,`А: > B" " ,~   T 쀢`  ,(!@    ,  > L ao": ! > T*c@@>!*@'@㿐)> #X > B` " > K" Ѐ + `` `>!t@`  `@  ` `  x@ #X> c4n"c4$Ђ`  h@#Ђ@ `@.  @` @2Z!(@3` 2!(H/` /> > #X6<> 4А# ">+ >'#D@8>+! 25!(=#@ ><!8p &!($!, p{  Ԁ@  #X> "2  Ȁ@8& " (@@"'!(   ``H/` /> > #5#> 4x# &k&   􀌠@b  S 쀢`  ,(!@   > ! ,! 0    ,@ "0*@ $ ,`А9{ > B" " ,N   $ 쀢`  ,(!@  a  ,  > L a?"9Q ! > T*c@>!*@&p> cX` "`> B!@ @">+>3#x H!(@"> 3##@@" > 3#$!,,``0 Ц 3`  0`0`4  >1#@  `8  . `* @@T`2 $"> 3 `Hؓ,  \* 22 *5`4''`И? ?0 2 Ѐ &`0 &`4$  `     @*@`&@&`&`  `+ @`@@&`0&@&`&` ^ 쀢`  ,(!@   > ! ,! 0    ,@ "0*@ $ ,`А8 > B" " ,Y   / 쀢`  ,(!@  l  ,  > L aJ"8\ ! > T*c@@>!*@&@㿘!,   쀢`  ,(!@  7 > ! .! 0    ,@ "0*@ & ,`А8" > B" " ,    쀢`  ,(!@    ,  > L! Ԕ7! > T*#㿐>  ؒ>   2> > 2 @" !> #X€> # #X@㿘><!8@G 㿘> #X` . > "t 2&@`4 p &@><!8 @& "Œ  㿘> #X`@.@@> "t `6@ H  㿀> #8 > #X##8> X @  8  :@ @ Ho o > #8 #\?@ #`#`#d ?0 #8? @#\ #`#`#d $H 0`; ??->  ؒ@ 5> > 1 PX >+* L '-  X>  Д>   @ X?@  ?'>a 2aH€㿘> #\>+.`L`.0>  H/` />  % > 3 pH 0>a aH€㿈 0@2 ,> 1 )>  #X H& L`8 "@  8   %><8 Hc''#`#\  & > `%& H>  ؒ 2>> 1N ! >  '>  Ж >  @ #X  @ '㿘 0@2> > 1, #\>< H8 " @ !8w^  L>& H& L   @ <H"@ 㿘> B!!(a(H $`> K"> 0 " !0`>!2 *  *  !&a0!0!%&a0% @ &a,x P& H $  & & 4& 0P$  " >'"Ԓ $ $ $$ 㿘!0  #>a2$a *"!G 8 !\&66&(!,; P!(!0 `'>!2!0b !0*!@!"(H ''   '#\#`#d#h#l  !\ #\ #`#d#l#hϐ   &㿘  =`>  @   > !@  .>+`L`$ ``N` s `L 4 `L  2 4N` s24 4*@, @  "$`㿘<  #&< 6 *" " * #" @&& W&(' D' T' @( ' 0' <@ 2 H~" ' 0- >1> 7!! @2 Y ", 6"@2@@ϒ! !W@@ 1> ! J! 5 @"1> !8 㿘`8 "; `( !25 @, !W@2- ` 2) r "  `* @ .* @   @2  @    ?! 㿘@ 3( H"$ D$ T$ @($ <$ 0@㿘`D `<*  @`8 ):` `(L6 `T 2 `0@22 $$`46 72`T  $`@ ,  $`4$`<`(  2` `T`8@ $`@`0?($`0㿘"  @`@ *  1> !H!W&`&@`v "&`(! &`,! &`0!&`4!!&`8!&`<!6`B!!&`D!`6`H!6`6`J&`&`ؒ$` $@,` > #@  ,` $  $`,` 4``a " "*   gG#ꀢ@216`  Ȁ@  @`@  2#6`  a?$  $, > #@  , $  $ , 4   6`M6` 㿘 ("2  , "  0 r   H 6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`T6aa  @  M@ $$@` 6"6a       `  "4(&`gG#&`!  @ \ ,`@ $`" ``Ȁ@  @`@ &`  ,`"@`"@&`b @ 6a@`@ 6a 㿘 @- @"+ =?  @28?@ƒ &  66  F6  26  .6   J6   B6  H6  F 6 6@   8` .  @  " 8 "@ C&& **`@ @  }* (@ 6?㿘> @!p 2 o@ P> aC> .> a;> @ƒa 0> .!0  q &`P<  k &`TH  e &`XT  _ &`\`  Y &``l  S &`dx  M &`h  G &`l  A &`p  ; &`t  5 &`x  / &`|  ) &`a4 " '> @kap 2'8 '> ?a@`P* `&`<&`@ "`<@`P`8*  "m d@`0բ> .'!аU!D8 `'` ''> 㿘> ! @   & L> ! -01 @ W& H @ LV H $ `< 6 H  L`8 @2     " `8 L  @"`` H㿘`>  -Ő" @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   &    "    (+  2 2 " 2+J " ?  #+ 0 `**   "+ 2# +  @(*`  *02 @"@ @b 㿐  `   ` @`>+ b    ?2    *2@ 2  &  4 @     `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  `   `  @  ` " @ ` ?  2  H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   & @@7  ?@3 @ ? @  &@k@㿐 @6``2  ?7 x 8" > c   @   @U XP    @'@"'5ک/@ @  x@@ 0`(` @/@:1@ #V@@ 7`/`  @)@@   ے@  7 /  Ĕ(@0os@ "@ 1 )  /@ @ =_#@ @ 0`(` @̔/@@ "*@@ 7`/`  @Д)@* @ "@ 7 /  Ԕ(@?Q@ !@ 1 )  ؔ/@ `&@  ؐ@@ 0`(` @ܔ/@"=@ #@@ 7`/`  @)@?֒@ #@ 7 /  (@"W5@ #@ 1 )  /@ @ !"@@ 0`(` @/@?f@ !@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =@ !b@@ 0`(` @ @0,@ #@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@ 0`(` @)@@  S@@ 7`/`  @(@@6(y@ "@ 7 /  /@@ 9#Ȓ@  1 )  / xs@ !@@ 0`(` @)@0@ #֐@@  7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@ 0`(` @)@@ ?;#@ @ 7`/`  @(@@@ "ِ@ 7 /  /@#J@  @ 1 )  ?@!B@@ 0`(` @@!}@"@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@ 0`(` @Ȓ@@#@ @ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ɛ@@ 0`(` @@:I@#@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@ 0`(` @@9@!@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= H "D@@ 0`(` @0@ʿ #@@ 7`/`  @7@*@ #@  7 /  7?$@  9@ 1 )  1V֒ !Ð@@ 0`(` @0@#3  @@ 7`/`  @7@?@  }@ 7 /  7!a@ !ѐ@ 1 )  1 "O@@ 0`(` @0@?9 "@@ 7`/`  @7@(P@ #@ 7 /  7@ !@ 1 )  Ȓ1=ߒ "@ @ 0`(` @0@/N "5@@ 7`/`  @7@ "@ @  7 /  :ᴐ7c@ @1 )     @& & & & @= @  `*@ 0* @*  @* `      +` *   (*   @ `   @* * @ * ** 8㿘 s ">    (`("`  ` `> ( ".%`> ("?آ> '"?0Π > > > '" 0Ð"('. J@   J@J`  ?*  8 B  ?*@    2@* *@ 㿘  `  `  @/# @*   & &@&&`84`"   ` 㿘?#@6 6` ` @ & $ @$@&@ 2   *  , "@@ 4 "  "  , @@ 4    -`@@ 5`  @@*  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X2J  J@ `2J 㿐@O㿘 J J 2" 2N@@  @` *N &* J " "  ` ?2  㿘@  H'T> #@R T ?0T2 7耦(7耢 2: # 4`44`44`4`ؤ466ȕ4'Ā66A ? 29`@`@`*  @@`*  @@`*  @T @T ;-`2 -,`- 2` ΰ "ĸ?` `"`` ?8   đ. ?2@ Đ"* c'Ā@ '.` @ '  @@? 7'7+ 6```+@, @@6*`2 .2, @ ( 6`? #  -. $$6`@?6"@ #? @ "6` 5  -. ?  @26`5ĺ`5  'T "`.  "@ : *  2?. 4@*  *`@T:̑*  ΰГ*`@     :( 2? + @( 3@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  ?* J" @ J2  @(*`   * 4 ?: :  *2@ :    4  * *  @    2J@ "J`  2J@   88 @@ @   `@ @ "`"  ?*@    2@* *@  @( *` @ (* * @ @ ` ``z @Z( 2 "" 2 @  &㿈@ '''㿈` @'''ɒvm_map_lock_read: intrsafe mapdrivevectmuxconsoleoffsetslotluntargetphychannelleveladdrbpfilterlooprdespFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_scsi_cmd] [0x%x, %d]->%d [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure %d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%d sense=0x%02x error=%d ncr53c9x_dequeue: lun %qx for ecb %p does not exist ncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p [flushfifo] ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] [wrfifo(%d):%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %dncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook%s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d rdramdisk: multiple attach calls? rd%dRAM diskfictitiousrd_idleMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUTncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad statencr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... vm_map_lock_read: intrsafe map;n vAMaX ֣d° xrndrdvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapcd9660_inactive: pushing activecd9660_reclaim: pushing activevm_map_lock_read: intrsafe mapRRIP without PX field? ..RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_1282IEEE_P1282RRIP_1991ASPvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] vm_map_lock_read: intrsafe map..cd9660_strategy: spectag VT_ISOFS, isofs vnode vm_map_lock_read: intrsafe mapexec: a VTEXT vnode has writecount != 0vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapexec: a VTEXT vnode has writecount != 0OpenBSDsys_execve: RELATIVE without basevm_map_lock_read: intrsafe map#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessarydiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/exec_subr.cocnt > 0vm_map_lock_read: intrsafe mapCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2002 OpenBSD. All rights reserved. http://www.OpenBSD.org swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d init: couldn't allocate argument spaceexec %s: error %d init: not found no initvm_map_lock_read: intrsafe mapacctAccounting resumed Accounting suspended vm_map_lock_read: intrsafe mapfileplfdescplfd_unused: fd_lastfile inconsistentdup2: fdallocfilefdexpandclosef: count < 0closefclosef: count: %d/%dkqeueplknoteplkqreaddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0kn->kn_status & KN_QUEUEDvm_map_lock_read: intrsafe mapexecve: argp == NULLexecve: no vmcmdssys_execve: RELATIVE without basesys_execve: falloc indx != ikernel mapping failed %d user mapping failed vm_map_lock_read: intrsafe mapinit died (signal %d, exit %d)reaperwaitvm_map_lock_read: intrsafe mapprocppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: LK_RELEASE of unlocked locklockmgr: draining against myselflockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pendingtemprp_addrip6rrNDPip6_options1394data1394ctlpacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRAIDframe dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey dataEXT2FS nodeadosfs bitmapadosfs anodeadosfs mountmiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostMFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pvmapVM pmapVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqmountiovioctlopsnameisysctlsooptsifaddrfragtblroutetblpcbdevbufmbuffreemalloc: out of space in kmem_mapmalloc: allocation too large???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) free: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freekmeminit: minbucket too small/struct freelist too big%d,%s,physbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenputphysbuf: private buf B_WANTEDprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0chgproccnt: lost userenterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curprocplimitplvm_map_lock_read: intrsafe mapsigaplpausepsignal signal numberprocfs debuggingProcess (pid %d) got signal %d issignal postsigpostsig actionpid %d was killed: %s sorry, pid %d was killed: %s %s.coreuiomove: modeuiomove: procureadc: zero residureadc: non-positive iovcnthashinit: bad cnthook_disestablish: hook not establishedpowerhook_disestablish: hook not establishedvm_map_lock_read: intrsafe mapsysctlsysctl_disklocksysctl_kmemlock%s,diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/kern_synch.cphztsleepsleep called with priority %d > PZERO, wchan: %p old sleepsleepwakeuppreempt: cpu_preempt not yet implementedmi_switchsetrunnablevm_map_lock_read: intrsafe mapdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeptimeout_add: not initializedtimeout_add: to_ticks < 0>>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s (root)%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failedconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %sconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureconfig_activate_children: shouldn't get hereevcnt_attach%s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs extentplextent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_create: storage provided for non-fixedextent_destroy: NULL extentextent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extntextent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignmentextent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not foundextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx vm_map_lock_read: intrsafe mapklogvm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimediagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/subr_pool.cpp->pr_itemsperpage != 0phpoolpcgpoolpool_destroy: pool busy: still out: %u pool_set_drain_hook(%s): already setpool_get: must have NOWAITpool_get: %s: crossed hard limit%s pool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistent pool_get: %s: page emptypool_get: %s: items on itemlist, nitems %u pool_get(%s): free list modified: magic=%x; page %p; item addr %p pool_get: nidle inconsistentpool_get: %s: nmissing inconsistentpool %s: putting with none out pool_putpool_put: %s: page header missingpool_prime_page: %s: unaligned pagepool %s is locked; try again later POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu page list: page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x no current page curpage %p no log cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) poolpool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULLvm_map_lock_read: intrsafe mapkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%d%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad base?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device enabled %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know%s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command User Kernel Config UKC> Continuing... selectpollpipespace: out of kvmpipelkpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrpipeclpipeplvm_map_lock_read: intrsafe map@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /dev/consolettnreadttrstrtttypendttyunblockttckoutqttyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk tty_detach: tty_count < 0putc: required clalloc b_to_q: required clalloc vm_map_lock_read: intrsafe mapWARNING: mclpool limit reached; increase NMBCLUSTERSmbplmclplm_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == 0 and not COPYALLm_copym0 overrunm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_zero: M_READONLYm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm == NULL in m_pulldown()unixsockplsofreesoclose: NOFDREFsoabortsoaccept: !NOFDREFreceive 1diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1aso->so_rcv.sb_mb == mreceive 3sonewconnsoqinsquediagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../kern/uipc_socket2.csb->sb_mb == sb->sb_lastrecordsbappendaddrsbappendcontrolsemi-panic: sbcompress (sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsbdropsbcreatecontrol: message too large %d acceptvm_map_lock_read: intrsafe mapuipc 1uipc 2uipc 3uipc 4piusrrequnp_attachunp_connect2unp_disconnectvm_map_lock_read: intrsafe mapbremfree: lost tailbufplbuf_dirtybuf_undirtygetblkallocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsizegetnewbufDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependenciescleanerClean buffer on BQ_DIRTYbiowaitbiodonebiodone alreadyvm_map_lock_read: intrsafe mapcache_enter: name too longnchplvm_map_lock_read: intrsafe mapcluster_read: size = 0cluster_read: DONE bpcluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memorycluster_callbackcluster_callback: too little memorycluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvop_generic_revokevop_generic_revokeallvm_map_lock_read: intrsafe mapoperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.vm_map_lock_read: intrsafe maplf_findoverlap: defaultvm_map_lock_read: intrsafe mapnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsleaf should be emptyrelookup: null namerelookup: lookup on dot-dotrelookup: symlink found.vm_map_lock_read: intrsafe mapvnodesvfslock%s_mountroot failed: %d vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svgetvref used where vget requiredUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drainedvgonemissing bdevmissing aliasvgonel: not cleanVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT| VBIOWAIT|VALIASED flags (%s) kinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwaitforiovwakeupvwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvpbgetvp: not freebrelvpbrelvp: NULLbrelvp: holdcntbuf_replacevnodereassignbufvfs_register called with vfc_refcount > 0 vm_map_lock_read: intrsafe mapsched_sync: fsync failedsyncersyncer vnode vm_map_lock_read: intrsafe mapvfslockmount: lost mountunmount: dangling vnodevm_map_lock_read: intrsafe mapvn_lockvm_map_lock_read: intrsafe mapdefaultvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_selectvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_whiteoutvop_getextattrvop_setextattrvop_strategyvop_bwritevm_map_lock_read: intrsafe mapdead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledvm_map_lock_read: intrsafe mapbpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpf_mcopybpfattachif_attachhead: mallocif_attach: mallocif_downif_up%s: can't handle af%d d;n &0vAkkQMaXPq< D֣ad°Ԡ xlo%dlooutput: no header mbuf%s: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_setifmedia_match: multiple match for 0x%x/0x%x rn_addmask: mask impossibly already in treeMask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtfreertfree 2rtfree: %p not freed (neg refs) ifafreertredirectrtrequest deletertinit: wrong ifa (%p) was (%p) /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../net/route.crt_init_done == 0rt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputrt_msg1routearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arpintrarp: ether address is broadcast for IP address %s! arp: ether address is multicast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arptfreearplookup: unable to enter address for %s revarpin4_cksum: offset too shortin4_cksum: bad mbuf chaincksum4: out of data in_controlinvalid argument to in_lifaddr_ioctlin_pcbnotifyin_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d interneticmp_erroricmp lenicmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout %d.%d.%d.%dKgipqeplip_initaeshmac-sha1deflateipintr no HDRattempted source route from %s to %s save_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %x %x forward: src %x dst %x ttl %x redirect (%d) to %x ip_output no HDRmalformed IPv4 option passed to ip_optcopyrip_attachrip_detachrip_usrreqtcp_pulloutofbandtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_output REXMTtcpcbpl߀tcp_usrreqIPv6 inpcb to udp_outputudp_usrreqipip_input: should never reach herevm_map_lock_read: intrsafe mapdev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cylffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ffs_freefile: freeing free inodebsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %dffs_checkblk: partially free fragmentstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapuid %u on %s: %s vm_map_lock_read: intrsafe mapffs_balloc: blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dvm_map_lock_read: intrsafe mapffs_update: bad link cntffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_indirtrunc: bad buffer sizevm_map_lock_read: intrsafe mapDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapffs_isblockffs_clrblockffs_setblockffs_isfreeblockvm_map_lock_read: intrsafe mapsoftdep_flushfiles calledsoftdep_setup_inomapdep calledsoftdep_setup_blkmapdep calledsoftdep_setup_allocdirect calledsoftdep_setup_allocindir_page calledsoftdep_setup_allocindir_meta calledsoftdep_setup_freeblocks calledsoftdep_freefile calledsoftdep_setup_directory_add calledsoftdep_change_directoryentry_offset calledsoftdep_setup_remove calledsoftdep_setup_directory_change calledsoftdep_change_linkcnt calledsoftdep_load_inodeblock calledsoftdep_update_inodeblock calledsoftdep_slowdown calledvm_map_lock_read: intrsafe mapffs_mountroot: can't setup bdevvp'sffsroot_deviceWARNING: soft updates isn't compiled in WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1ffs_statfsfs = %s update: rofs modinodeffsinovm_map_lock_read: intrsafe map%s: modeffs_read%s: short symlink%s: type %dffs_write%s: nonsync dir write%s: typeffs_fsync: not dirtyffs_fsyncffs_fsync: dirtyvm_map_lock_read: intrsafe mapufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_getlbns: Invalid indirect block %d specified ufs_getlbns: indirect block %d not foundvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapffs_inactive: pushing activeufs_reclaim: pushing activevm_map_lock_read: intrsafe mapmangled entryi_ffs_size too small%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapchown: lost quotaufs_link: no nameufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown opufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_mkdir: no nameufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld ufs_makeinode: no namediagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_amap_i.h(( offset) & (PAGE_SIZE - 1)) == 0amap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing therevm_map_lock_read: intrsafe mapamappl/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_wipeout: corrupt amapamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countvm_map_lock_read: intrsafe mapuvm_anon_add: can not allocate %d anons uvm_anon_adddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_anon.cpg->loan_count > 0anon_pagein: uvmfault_anonget -> %dvm_map_lock_read: intrsafe mapuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_aobj.cslot == 0uao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getpageuao_getpg->flags & PG_RELEASEDaobj->u_obj.uo_refs == 0TAILQ_EMPTY(&aobj->u_obj.memq)(pg->flags & PG_RELEASED) == 0vm_map_lock_read: intrsafe mapudv_attachdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_device.cuobj->uo_npages == 0 && TAILQ_EMPTY(&uobj->memq)udv_detachudv_faultvm_map_lock_read: intrsafe mapfltamapcopyanonget1anonget2flt_noram1diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_fault.cresult != VM_PAGER_PENDuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2uobj->pgops->pgo_releasepg != NULLflt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryva >= entry->startentry->next != &map->header && entry->next->start <= entry->endvm_map_lock_read: intrsafe mapuvm_fork: uvm_fault_wire failed: %dschedulerschedpwaitvm_map_lock_read: intrsafe mapuvm_init: page size not setvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_km.cuobj->pgops == &aobj_pagerUVM_OBJ_IS_INTRSAFE_OBJECT(uobj)(pp->flags & PG_BUSY) == 0(pp->pqflags & PQ_ACTIVE) == 0(pp->pqflags & PQ_INACTIVE) == 0vm_map_pmap(map) == pmap_kernel()km_getwait2uvm_km_alloc1: non-released pagekm_allockm_alloc1wvallocwaitvm_map_lock_read: intrsafe mapuvm_loan: intrsafe maploanagainfltagain2uvm_loanuobj: object has no releasepg functionloanzero1loanzero2uvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!vm_map_lock_read: intrsafe mapvmmaplkvmmapbsydiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_map.cnextuvm_rb_insert: duplicate entry?%s: %d/%d ownspace %x != %x %s (last)%s: space %d != %d %s: corrupt: %p >= %p %s: nentries: %d vs %d %s: lookup: %d: %p - %p: %p uvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)uvm_mapent_alloc# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekplUVM_OBJ_IS_KERN_OBJECT(uobj)(align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= lengthvm_map_pmap(map) == pmap_kernel()!VM_MAPENT_ISWIRED(first_entry)uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5(start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0map->flags & VM_MAP_PAGEABLEvm_map_upgrade: failed to upgrade lockuvm_map_pageable: stale mapuvm_map_pageable_all: stale map(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_page_i.hpg->wire_count == 0lcv != -1/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_page.c(pg->flags & PG_TABLED) == 0pg->flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapvum_page_physget: out of memory!uvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %d uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d obj == NULL || anon == NULLoff == trunc_page(off)free_list >= 0 && free_list < VM_NFREELISTuvm_pagealloc_strat: bad strat %dsaved_loan_count == 0vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pager_i.hrvpg != NULLemergva/usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pager.cnpages <= MAXBSIZE >> PAGE_SHIFTpager_mappppp->flags & PG_BUSY!uobj || obj_is_aliveuvm_aio_biodoneuvm_aio_aiodoneswap || pg->uobject == uobj!write || (pgs[i]->flags & PG_FAKE) == 0vm_map_lock_read: intrsafe mappagedaemon: deadlock detected! pgdaemonaiodoneddiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0(m->pqflags & (PQ_ACTIVE|PQ_INACTIVE)) == 0vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../uvm/uvm_swap.csdp->swd_npginuse == sdp->swd_npgbadswap_off: swapdev not in list swstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filesw_reg_iodonevnx->vx_pending == 0uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost flags & PGO_SYNCIOswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrvm_map_lock_read: intrsafe mapsbrk: %s %ld failed, return = %d growshrinkuvm_coredump: user process with submap?vm_map_lock_read: intrsafe mapuvm_deallocate with null mapvm_map_lock_read: intrsafe mapuvnsyncuvn_attach: blocked at 0x%p flags 0x%x uvn_attachuvn_deref: vnode VM object still has pages afer syncio/free flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressvm_map_lock_read: intrsafe mapiommu%s at %s unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB nameobiovmelvmesvme%s at %s addr %p vec 0x%xNNNNinterruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsvmesattach: can't allocate intrhandvmelattach: can't allocate intrhandvme: PROM ranges too large: %d: version 0x%x vmebus: no rangesvme: spurious interruptvme: spurious interrupt vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqauxregauxiliary-ioauxioauxregmatch no aux registeroclockeepromclocktimer delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d mk48t02modelno prop: %s (eeprom) mk48t08counter-timercounterdelay calibration delay constant %d oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz oldclk statintr;Zx0NWARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! power sun4cpumidsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s %s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dmmu-npmgmmu-nctxclock-frequencyvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typecache chip bug - trap page uncachedcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache [viking: PCR_TC is off][viking: turn on PCR_TC]UnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUsB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%xmemregmemory-errormemregattach %ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorHyperSPARC async cache memory failure at phys 0x%x%x store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. zsslavezsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmousebroken zs interrupt schemeintr%s: channel %dzs_set_speedstopping on keyboard abort ttydttycttybttyakeyboard/displaystdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. device_typestdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. fdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo drive %d[version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c fdprobe: %d stati: %x : %s %d cyl, %d head, %d sec : density unknown fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive fdc reset fdcresult: overrun fdcresult: timeout fdcstart: not idle %s: %s: state %d (st0 %s cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d timeoutfdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossiblehard errorfdioctl: impossiblefdformat: blkno %x count %ld fdformfloppy diskfictitious%s: %s Insert filesystem floppy and press return.sbusslave-only%s at %s %s slot %d offset 0x%x unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnamerelative sbus addressing not supportedsbus_establish: can't find sbus parent for %sreset %s:%s: dma card found in non-dma sbus slot %d: not supported zstty flags 0x%xinputoutput (console %s)i/okeyboardmouse: %s zs_shutdown: not enabled?%s: device enable failed %s: %d silo overflow%s, %d ibuf flood%s s '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| f Oh  iP f Oi^  iPzskbdkeyboard, flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%x : failed to set baudrate : failed to set modes : reset timeout %s: reset: invalid keyboard type %x %s: %d silo overflow%s, %d ibuf flood%s smii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failed mii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@mii_phy_setmediamiiautnsphy: %s, rev. %d DP83840 10/100 media interfaceqsphy: %s, rev. %d QS6612 10/100 media interfacescxsplgetxscannot allocate scsi xs scsi_free_xscould not get size scsi_donescsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossiblescsi_scsi_cmd: buffer without nosleepscbusyunknown error category from scsi driver DEFERRED ERROR, key = 0x%x Sense Error Code %d at block no. %d (decimal) %s(%s:%d:%d): probeReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sensex`8x`@(x@pH       h @(pX8     h@ xH(xH PhP0pP( !!"x$`%@& &&&'o((h)8* **+,,,P-(/0000h1P1822~3~6~7~9~:~h;~P;~ ;};};};};};}`;}H; }0; }; |; |; |;|=|h>|8?|?{?{?{@{A{hB{0C{ D{EzFzGzHzIzpJzXKz@LzNyPyPyPyQyRyxSyXSy@Sy TxUxWxXxYxZxHZx ZxZw[w[w[w[w\wh\wP\w0`w awavavbvcvdvpIllegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xCheck Condition on opcode 0x%x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02x%s, Error in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %dscsi_user_doneUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistrscsi_do_ioctl: impossiblescsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P4.21NEC CD-ROM DRIVE:2731.0gMemorex CRW-26421.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TEBCD-24XBCD-16XSW03DALPS ELECTRIC CO.,LTD. DC544CSENASUN V1.9SuperVista S-12 AT3 1.60 ULTIMA V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROP0001SD120S-200 NEC FC-1TEACG0661467ZIP 250ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171FCST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM C-OLYMPUS 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID CP16CP15DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1588-15MBSUN0669MICROP 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON CD-ROM PX-40TSPLEXTORCyberDrv1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-561 CD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:841CD-ROM DRIVE:5011.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixedDECTZ30TK50 not configured vm_map_lock_read: intrsafe mapcdNEC CD-ROM DRIVE:260 cdstart%s: not queuedATAPI CD-ROMSCSI CD-ROMfictitious b b cL bP ccd_scsibus_get_mode: Mode page %02x request bad size: %d bytes cd_scsibus_set_mode: Set mode request bad size: %d bytes c d4 d e\ edch02009000SPECTRA %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s%s: warning, READ ELEMENT STATUS avail != count %s: could not sense element address page %s: could not sense capabilities page vm_map_lock_read: intrsafe mapsd %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted mediasdattach: unknown result from get_parms%s: WARNING: unable to establish shutdown hook sdstart%s: not queued, error %d SCSI opticalSCSI disk%s %s%s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d %s: strange capacity descriptor byte5 0x%x %s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry %s: WARNING: cache synchronization failed ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled%s: already open %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d ststart%s: not queued %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d dmaledma[%s at %s] offset 0x%xespdmacable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameesp%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../arch/sparc/dev/dma.cR_PEND%s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d lebuffer[%s at %s] offset 0x%xburst-sizes: %dK memory nameqec%s at %s offset 0x%x#channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameranges%s: PROM ranges too large: %d %s: reset failed. be: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s %s: device timeout %s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting %s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid tcvr type %s: invalid packet size %d; dropping %s: bmcr reset failed %s: bmcr unisolate failed qe: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s %s: device timeout %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... %s: invalid packet size %d; dropping hmeSUNW,hmeSUNW,qfe: expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe%s: stop failed %s: device timeout %s: burst size unknown %s: setting rxreg->cfg failed. %s: reset tx failed %s: reset rx failed %s: link status changed %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP%s: invalid packet size %d; dropping %s: mii_write failed %s: mii_read failed dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintrespdepthwidthheightlinebytesfb_setsize: inappropriate bustypescreen-#rowsscreen-#columnsvm_map_lock_read: intrsafe mapwsdisplaydiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsdisplay.cscrdata->nscreens > 0%s: screen %d-%d added (%s, %s emulation) wsdisplay_forceclose: bad screen%s: screen %d deleted wsdisplay at %sdmuxwsdisplay_common_attach: no memory wsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %s !wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplaytty() on ctl deviceWSSCREEN_HAS_EMULATOR(scr)sc != NULLwsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wswaitwsmoused_sleep   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000wscons: copybuffer memory malloc failed vt100 d e| u f gdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsemul_vt100.cedp->console == 1wsemul_vt100_output_c0c1: ESC in kernel output ignored edp->tabs != 0wsemul_vt100_output: kernel output, not consolewsemul_vt100: invalid state %d [>24;20;0cdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsemul_vt100_subr.cedp->tabs != 0P2$u%s%d/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%%$ $ $ $ $ %%% %%<%%$%4%,%"d"e"`  "% "# #!%## # #  ""#*"d"`"e"+"4"""""<"C!!"a"""")"*"'"("!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsemul_vt100_chars.cnrc < sizeof(nrctable) / sizeof(nrctable[0])[34~[33~[32~[31~[29~[28~[26~[25~[24~[23~[21~[20~[19~[18~[17~[15~[14~[13~[12~[11~OSOROQOPOyOxOwOvOuOtOsOrOqOpOIOMOjOkOlOmOnOo[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCvm_map_lock_read: intrsafe mapwsevent_readvm_map_lock_read: intrsafe mapwskbdwskbd at %s (mux %d ignored for console) mux %dcannot load keymapdiagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == NULL: console keyboard, using %s !wskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry%s%dwsmux_detach_sc: not allocated wsmux_detach_sc: not found %s: connecting to %s %s: disconnecting from %s sun Ϙ T ڴ $diagnostic /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output_lowchars: ESC in kernel output ignored wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %drasops_init: font table is empty rasops_init: couldn't lock font rasops_init: fontwidth assumptions botched!rasops_mapchar: no font selected????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not locked bwtwobwtwo/p4model: %s, %d x %d cgtwocgtwoattach: impossible bustype: %s, %dx%d cgthreecgRDImodel: %s, %dx%d cgfour: cgfour/p4, %dx%d cgsixSUNW,cgsixcgsix/p4modelcgsix on mainbus? : %s, %dx%d, rev %d cgeight: cgeight/p4, %dx%dcgfourteenmodelname: %s cgfourteen: expected %x bytes of control registers, got %x cgfourteen: expected %d registers, got %d, %dMB, %dx%d, depth %d cgtwelve: %smodeldev_id (%s) %s: %dx%ducoderev, microcode rev. %spnozzp9100: rev %x, %dx%d, depth %d cmsizetcxSUNW,tcx tcx: expected %d registers, got %dmodelTCX on bus 0x%x? : %s tcx-8-bit%s: %dx%d, depth %d, id %d, rev %d, sense %d vigravs10vs12model: %s expected %d registers, got %d, %dx%d %s: lost carrier on UTP port, switching to AUI portAUI port, switching to UTP port %s: lost carrier sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundaryUnknown3e/vmeonboardmultibus/vmeieie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s %s: device timeout %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions %s: receive descriptors out of sync at %d %s: tbuf overflow %s: reset %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed xdcxdxddummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrxdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xdnfreexdsubwaitxdcmd nfreexdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq%s: off-line: %s xdc_reset%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE xdc_start%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout Software fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown errorxycxyxydummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrxyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xyc_cmd%s: stole control iopb xyc_startbuf null buf%s: warning: out of DVMA space xyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq%s: off-line: %s xyc_reset%s: soft reset %s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]%s: watchdog timeout Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown errorsisw si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p si_minphys len = 0x%x. si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC si_reset_adapter si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO si_dma_free: no DMA handlesi_dma_free: free while in progress%s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d sw: DMA error, csr=0x%x, reset sw: short transfer vm_map_lock_read: intrsafe mapcnopen: recursivefpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2WARNING: matchbyname not valid on sun4!%s /obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertieskernel has no debugger twas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecdbootpath: /%s%x/%s@%x,%x:%c WARNING: %s map is bogus, using default sd-targetsst-targetscpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configuredPROM sync command%d%s at %s %saddr 0x%xiono PROM root devicenameproperty lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector  X ` led p h X H ` @ (     virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error x `    @    eccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsfindzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%dpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d search_prom: null nodeiommuWARNING: opennode not valid on sun4! %s ' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !PROM exit failedPROM boot failedraidrdstxdsdxyuse one of: %s[a-p]parsediskno memory for mountroot_hook%s%dsetroot: device name too longroot device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right  %cconfig_attach: device name too longcache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent vm_map_lock_read: intrsafe mapfp align without being the FP owning processstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsAsync registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmiintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xintr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsetrunqueueremrunqueuevm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cacheunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory WARNING: not updating battery clock attempting to power down... WARNING: powerdown failed! halted rebooting dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @%p:%d device bad device not ready area improper i/o error succeeded error %d Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p mapdev: zero sizemapiodevcurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed warning: ldcontrolb called in sun4m vm_map_lock_read: intrsafe mapmmrwmmrw: out of space in kernel_mapvm_map_lock_read: intrsafe mapVA2PA: Asked to translate unmapped VA %ppmap_page_upload: no memory?mmu_reservemon4_4c called on Sun4M machinemmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typeme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptesme_free: no segments in pmapctx_freepv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLpv_syncflags: no segmentspv_unlink0pv_unlinkpv_link_4_4c: allocation failedpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%xpv_syncflags4m: no pte pmap: 0x%x, va: 0x%x pv_link4m: allocation failedpmap_bootstrap: unsuitable number of segments (%d) rp->rg_segmap == NULL! pmap_init: no memory for pv_listpvplL1 pagetableL2/L3 pagetablepmap_release: segment list not emptypmap_release: releasing kernelpmap_rmu: no segmentspmap_rmu: no pagespmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_protect: last segmentpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEpmap_enter4_4c: can't fail, but didpmap_enter4m: can't fail, but didpmap_enk4m: can't enter va 0x%lx below KERNBASEkvm_uncache: table entry not ptekvm_uncache !pg_vkvm_iocache: 4m iocache not implementedkvm_iocache !pg_vtrapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b syscall cpcb/ppcbsyscall trapframesyscall nargsvm_map_lock_read: intrsafe mappagemove 2dvma_mapin: null page framedvma_mapout: extent_free failed vmapbufvallocwaitvmapbuf: null page framevunmapbufcpu_fork: curprocsdcddisk label read errordisk label corruptedno disk labelSunOS disk label, bad checksumxboxSUNW,xboxmodel: model %schild-presentfalse: no devices write0-key ranges%s: PROM ranges too large: %d %s at %s  %c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzOpenBSD3.2RAMDISK#153 @(#)OpenBSD 3.2 (RAMDISK) #153: Thu Oct 3 21:13:51 MDT 2002 OpenBSD 3.2 (RAMDISK) #153: Thu Oct 3 21:13:51 MDT 2002 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/RAMDISK Hsun4c compatible0 0 f8000000 15c6a0 map-pagesHspurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(4"5wD @1vEHIu@@HG-|F  0 0      \@ABCDEFGHIJKLMNSOPQTR9:;<=ijabcd#$%/01 !#$/0fg345'*k8233c3c22L22L22L2$2<L22L22l<2l2L2l2l<2l2<22<22<22L22l<22<2@2X<2@2X<22l<2D2\L22L22l<22\<22d<2 28L2 28l<2 28t<2 28<2 28L2 28l<2 28|<2 28<2 28<22L22l<2t222L22X22\22 2`2@22`22`3H3`3 3 lT3 X3 plT3 3 lT33lT3<3T$<3<3Tl$3<3Tl3h3l33l$33l33l33@#3,3@#3D3\l3p <3p l$3p *#3p l3p #33$33lDN3[3[l$3[3[<3[3[<3[3[<3[3[l3\T3\l HQ3\3\l3]3]<3]3]<3^3^,l3^3^,<3^3^,<3^3^,l3^3^<3^3^<3_$3_<<3_$3_<<3_3_l3`43`Ll3`3`l3aD3a\l3at`dT3at`hT3at`l$3at`<3at`6T3at`l3a3a <3a3a<3a3aHQ3a3aHQ3a3aHQ3a3aDHQ3a3aPU3a3aPU3a3aPPU3a3a8PU3a3bY3b(3b@,HQ3b(3b@HQ3bT3bl0a3b3bHQ3b3c<3P3hlR  p`XPH8(8XT -Pa5$85$8XdXXYhPXpqdTFu<vPNvRRwCEwSTxpNMs,tDCLt0PLt0REu(@RRwCEwSTxpSLqRRwCEwSTxpERxxCEwSTxpL$,ltg]ڀ^]0]\(ۈ0۴8h P8d]ܐ]ܼ@l]ݜ]]0]`]ތ޸ <i`hiߔ^LH4ڬDp]p5+Ĝڀ@O0O\@ۈML۴8h P8CddFܐ]ܼIJ@lKhݜOOO0O`OތO޸OOO<i`hiߔMHLڬDO(pOp5*@ l4native ǰ@ ddnative ǰ dd% ] ` !P ,  L   R<4UShS| G DGP < O N(@pdRLLr S3 idSn<ZZʌoop c %  l <%H% " ,  SXR`T < (gT \ ;$ @@ [H x <K< o  HdL ^ a T8D`KxB,!D"@lh TTH ><&'WTX4V( (a^#D  pT| Rt % o,S R  XtNx'`(x Px$0TаƸưƨƘƐƈƀp`XH8( ŰŠŐŀxhXH80 İĠĐĀphXP@8( øèØÐÀph`XP?? 0 lB@lhP@PL h &T 80( xph`XPPAtdw}}d~|"|ttyclsttyopnttybgttyinttyoutl(<h]x]x]x]x]x]x|]x]x]x]x]x]x|]x]x]x]x]x]x|]x]x]x]x]x]x|]x]x]x]x]x]x|]x]x]x]x]x]x| ݌ݴSlSl@4P_@ed#<%#<#$d% Pnetconnetclsnetionetlckxffs`dcd9660THT|2lockf@`  ڀۈ]l<h]ߔڬ5-.02D3/2ڤ  ( T ۀ ۬  ( 80H\X܈ hܴx 8dݐ   ( T ބ ް ( 8H4X`hߌ x߸  <hDlڀHpڬ0\ۈ۴ 8dܐܼ@lݜ0`ތ޸<hߔDp ڀ<?40?4\=ۈ]۴?,?, ?,8= d=Lܼ=t=l]ݜ?4?4?40?4`?4ތ?4޸?,?,?4<]h]ߔ>h>H=?ڬD?,p?,p]5<devopndeviodevwaitdevindevoutdeviocdevclsڀ@O0O\@ۈML۴OO O8CddFܐ]ܼIJJ@lKhݜOOO0O`OތO޸OOO<Fh]ߔMHLNڬDO(pOp5 a<a20123456789abcdef^^#$%&'()*+;,-.;/;0;1B@C= D$E= F$cdeB@LK@B@ @ֈ 4X $P,2r$LP^L_mH0d,Լ(˘P\Dx9Dx5BDxPDx 0 \Dx@   dX}E#(D<8Q @X,2(@AAA==(A* d @@@@@@@@@$?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@PPPPaprtv wzzh|H| MK<P8,AY ڀTd80\xۈ۴ 8}Pdܐ]ܼhpՔ@l,ݜH0`ތ޸̰<hxߔDH͌ڬpDXpp6$ڀ@O0O\@ۈ۴ 8ϐdܐ]ܼIJJ@l,ݜOOO0O`OތO޸OOO<hxߔDMHLڬpDO(pOOp6$ ... ...T֤,$xt@TdLD\p $ & ' * 3( 3 2x )",  ھە (=   @=׍{Y( @@4 /mnt^__@@<@`dT (=   @=׍{Y( @@=@@<@`dT U=@@7x((0pLl UA ==+=+02A=/=1-=1-)A֓}6=(=C=+8@HPX`hp ^K=5 R==*^==&6=&6L`= S+=I =)'1 |i =C= U= Ux@==#F=#F-X@!~;LS Y|>(9 sh7E XTuz{Faq7e4c Ik0CNPb[PUg6[# vj0x2A[RkDL #*Y<{ JzgP x4]}i\6",42[m"roʥ/]piuVxrc0("e^J75;:=?7 . .. ftpgzipgunzipgzcat sedgrepegrepfgrepless`more export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh MODE=upgrade . install.sub THESETS=`echo $THESETS | sed -e 's/ etc / /'` resp= while [ -z "$resp" ]; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} if [ ! -b /dev/$resp ]; then echo "Sorry, ${resp} is not a block device." resp= fi done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV > /dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem ... " if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "Done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done HOSTNAME=`cat /tmp/myname` FQDN=$HOSTNAME HOSTNAME=${HOSTNAME%%.*} FQDN=${FQDN#${HOSTNAME}} FQDN=${FQDN#.} [[ -n $FQDN ]] || get_resolv_fqdn /mnt/etc/resolv.conf hostname $HOSTNAME.$FQDN ask "Enable network using configuration stored on root filesystem?" y case $resp in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit fi ask "Do you want to do more, manual, network configuration?" n case $resp in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; esac ;; esac cat << __EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Only filesystems with a fstype of ffs will be mounted read-write. __EOT ask "Edit the fstab with ${EDITOR}?" n case $resp in y*|Y*) ${EDITOR} /tmp/fstab ;; esac munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets $THESETS finish_up MDSETS=kernel MDTERM=sun MDDISKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' ARCH=sparc md_set_term() { } md_installboot() { local _rawdev _prefix if [ -z "$1" ]; then echo No disk device specified, you must run installboot manually. return fi _rawdev=/dev/r${1}c if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_checkfordisklabel() { local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac disklabel -W ${_disk} disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_congrats() { }  . .. bin@ dev@ etc mntmnt2EsbinEA tmp usrvarinstbin$.profileN}hupgradeinstall install.sub  install.md#!/bin/sh FILESYSTEMS=/tmp/filesystems MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while : ; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab rm -f $FILESYSTEMS else ask_which "disk" "do you wish to initialize?" "$_DKDEVS" [ "$resp" = "done" ] && break fi DISK=$resp rm -f /tmp/fstab.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 for _p in $(disklabel ${DISK} 2>&1 | sed -ne '/^ *\([a-p]\): *\([0-9][0-9]*\).*BSD.*/s//\1\2/p'); do _ps=${_p#?} _pp=${DISK}${_p%${_ps}} if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" > $FILESYSTEMS continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -f $FILESYSTEMS && -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done < /tmp/fstab.$DISK fi : $(( _i += 1 )) done if [[ $DISK == $ROOTDISK ]]; then if [[ -f $FILESYSTEMS && -n $(grep "^$ROOTDEV /$" $FILESYSTEMS) ]]; then echo "The root filesystem will be mounted on $ROOTDEV." else echo "ERROR: Unable to mount the root filesystem on $ROOTDEV." DISK= fi if [[ -n $(disklabel $ROOTDISK 2>&1 | sed -ne '/^ *\(b\):.*swap/s//\1/p') ]]; then echo "${ROOTDISK}b will be used for swap space." else echo "ERROR: Unable to use ${ROOTDISK}b for swap space." DISK= fi [[ -n $DISK ]] || echo "You must reconfigure $ROOTDISK." fi [[ ${#_partitions[*]} > 0 && -n $DISK ]] || continue _i=0 while : ; do _pp=${_partitions[$_i]} _ps=$(( ${_psizes[$_i]} / 2 )) _mp=${_mount_points[$_i]} ask "Mount point for ${_pp} (size=${_ps}k), none or done?" "$_mp" case $resp in "") ;; none) _mp= ;; done) break ;; /*) _pp=`grep " $resp\$" $FILESYSTEMS | cutword 1` if [ -z "$_pp" ]; then _j=0 for _pp in ${_partitions[*]} ""; do if [ $_i -ne $_j ]; then [ "$resp" = "${_mount_points[$_j]}" ] && break fi : $(( _j += 1 )) done fi if [ "$_pp" ]; then echo "Invalid response: $_pp is already being mounted at $resp." continue fi _mp=$resp ;; *) echo "Invalid response: mount point must be an absolute path!" continue ;; esac _mount_points[$_i]=$_mp : $(( _i += 1)) [ $_i -ge ${#_partitions[*]} ] && _i=0 done _i=0 for _pp in ${_partitions[*]}; do _mp=${_mount_points[$_i]} [ "$_mp" ] && echo "$_pp $_mp" >> $FILESYSTEMS : $(( _i += 1 )) done done cat << __EOT You have configured the following partitions and mount points: $(<$FILESYSTEMS) The next step creates a filesystem on each partition, ERASING existing data. __EOT ask "Are you really sure that you're ready to proceed?" n case $resp in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac _i=0 unset _partitions _mount_points while read _pp _mp; do newfs -q /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done < $FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >> /tmp/fstab munge_fstab fi mount_fs "-o async" ask_until "\nEnter system hostname (short form, e.g. 'foo'):" HOSTNAME=$resp FQDN=my.domain hostname $HOSTNAME.$FQDN ask "Configure the network?" y case $resp in y*|Y*) donetconfig ;; *) cat > /tmp/hosts << __EOT ::1 localhost.$FQDN localhost 127.0.0.1 localhost.$FQDN localhost ::1 $HOSTNAME.$FQDN $HOSTNAME 127.0.0.1 $HOSTNAME.$FQDN $HOSTNAME __EOT ;; esac _oifs=$IFS IFS= resp= while [ -z "$resp" ]; do askpass "Password for root account (will not echo):" _password=$resp askpass "Password (again):" if [ "$_password" != "$resp" ]; then echo "Passwords do not match, try again." resp= fi done IFS=$_oifs install_sets $THESETS set_machdep_apertureallowed cfgfiles="fstab hostname.* mygate resolv.conf kbdtype sysctl.conf" echo -n "Saving configuration files..." if [ -f /etc/dhclient.conf ]; then cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf echo "lookup file bind" > /mnt/etc/resolv.conf.tail cp /var/db/dhclient.leases /mnt/var/db/. cfgfiles=`echo $cfgfiles | sed -e 's/ mygate / /'` fi hostname > /mnt/etc/myname cd /tmp grep "^#" /mnt/etc/hosts > hosts.comment cat hosts.comment hosts > /mnt/etc/hosts for file in $cfgfiles; do if [ -f $file ]; then cp $file /mnt/etc/$file rm -f $file fi done echo "...done." remount_fs _encr=`/mnt/usr/bin/encrypt -b 7 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "Generating initial host.random file ..." dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 echo "...done." finish_up ELF44 ( ##OpenBSD㿘a 26 @Z"a6@S  @D* @ +#@㿘 " l@5ဢ  &@ / &@ & l@@@*`:` J " 㿘 % @? @`     , `2 ?, @??@@??㿘 % <`  <  㿘@ J 2@@6@@5 /  @!`"@Đ 2     #66`ؖ@o!x@㿘 ?@?`Ŕ㿘 #66`@V!xa a)6+6@ݝ@  O4x@C!@x@>a `@ x@6!@` 㿘@㿈 % % "a`"`!"  # % $`H% %C+ %)75777/6-A37@H $H8@Բ @  = 2,`H H@ԩ  L `H`H`@Ԡ  '0 @Է X H@Ԓ  "`@Ԋ  €$X  $HX`@"@ $XX` @7@JА X` %7`@a !Ԁ`7`@Y aC!D!!"@! D !C!$X%a7a@=  %!Ԁ` !`7`@4 C!<%aؠ!` 7a` %7a8@#  ? @ɀ  2` $ 87`  @o`   `$  7a @?㿘@@㿘@ % %"ap"㿘@z %"aԁ㿘@s % "aА?"aЁ㿘@h"`㿘 %!X`@\ %"ap % x㿘 %!X`@M %"a % 㿘@ %:㿘@ %:㿈 ,'D)7%7!B'7#71 %D@J# '  @ӭ!  %(@ӈ X`"`c@@ ` `"X&!D ߐD㿘@ @㿐@ ?2 % H7ch@In 2J % H7cp@T `k`m`b". `w . . . 8 % 'J`x 4 %``*2 % @S % H!7#@/ "@  H7cp@ 㿐 @w     % H7ch@I 2K % H7cp@  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @" % 'J`x 4# %`%`*2 %  @ʤ @ % H!7#@ "@җ  H7cp@Ғ 㿘 %! %  %a`  "@    *a```$   $ @Đ   $`$` %h % 㿘 % L?`$) %!`  !`     !`!`" "  !`@ "@ !`!`?"`"`%L %!`! "@  %! ' %`Ԁ@8 %!܀    +@ `  0 +@`    !``Ԁ*`!`` " "`?"`Ԁ ܀  Ԑ @O" *!` " "` %` !`   %!``? "`  !`` ? %L"`!`` ` $` $`@ ` `!`!` @ " 㿘 %!`` %! % %!` "@ "@Y  %a `` `  ` ! % !@" ! "㿘 %!+ % %a`  ??  @? ?,@ a`Ԁ@ <a` %!   Ԑ@?*" ?   " " " @@$$ $*@` $@~ Ԕ @ " % a`   a`@"@ a`  $ 㿘 %a`  2  7@Gj#a`  % %   a` ? *a` "?a` $  `@ᴔ``@$`$` `"* "㿘@H`@ H`@ G@t" %aЀ? 3@<`??&`@@= 㿘 %!`   9!$  $ @) $ 9 a@F `@ `  %   %9a@А !  9! $ $ ') % %aX# "& @! $ !X" & @! $ `$ ` ` 9@Fpa@!X @2```` @L? $`9a@FZ $! % !Ԁ@*!@L@  $``!@L{@ $9b@FA ```$"`$ ` " @  $@!X@!X  !X   @      @9 !X"@L %`!&b %  % HXܔ *  +@ ( 5X  %"Xܔ *  +@ ( $X  % HX  % *  +  X  %"X  % *  +  X ܐ@S  @ ` h9 a@E <     a@f     @ӵ ?    `  & 㿘 ) % % %a`!!/19 %!Ѐ!`  %!X - %` @`` @``  @*  h$ 6. X$2  !@E] !@E@   X      @\ @X @EnX %``$` !@  $`%!  X $ !@  $ %! $  $  $ ` %`X` `@_&`$`@@ ``"`` %``@G` %` ؒ@€$`x %㿘 %aC!<@C} %!@D;  %!@ % %!X ! %!`!@  " @) !@$ !`"`! `@ 㿘 %! !`` %!3 %59/9+9-9  ?# !`   %P 2 `` "P@Db0!` "$` @~X@, a @q  ` @Dz a  > B; Ǥ@2   # !  " &   #   !@"@ !  & Ȑ@ؒ  %bb" '"@ 'Вb@ ?9# 9c( F B H?8 ?8` 9  d x#\@@D @ֲ'@ $ 9" 9"9" @ْ d-`@֚%%  %! (9" 9"9" @ d-`@ր%%``!9"@˒##\@ė9c B d8-` ª`@;`@_%%@E 㿘! l $ 㿘f@ 㿘 %a` 2   @ŏ     @Ѯ ?CA9c0@C  9 +9-9`@)  "  &!D?D?  %` ?"`8@] !Xd @Cc0 c0@C] `㿐 %!      @4      @S ?vt9 c0@C:   $  '7a@ c9 c0@C)    X $ Ta a@(  4A6 9 c0@C   7 'a@Կ?9 c0@B  D 4a, $ (aa @*   9 c0@B  D 4a $ a0  D4a $a㿘@5%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%ܝ  '+I) '9%:/ 5: 0* `@€     |X@F @8@K??Ⱃ* & @ @)@?` '' ' '''@<   `-::`@/ `@B; @ۮ 㿘 #:`@|!x@ۦ 㿘@  @B( 1': n L  o  @c = 2*`"@u 2  : @2    &*@&a@  @ 2L@HF㿘@))T))))))))))))))))))))))))) )),)<))H))))))d05J% %! %' %; %/ %-+ ):+9: $&* (@€ $ $"  $ $" $ 'b %  %"b Ȁ :a8@ @`|@@f!(?Ґ? "*@` &  %b :@AƐ`@@͒  2@:a@Ah  !@Y@ܩ@ `R' @@)G  @j@ @@Ar!=`< @ @2 @@@ @ 2-`%a@&@ !b  @:@@Au`@U D 2 a:aؔ@@AgD` @@A6!`@  @`  @ә 4?a` $  % @60@@] 㿐@B  @6  @b ` T@! 㿘"Ȁ  b`?  # %@     2b@ 㿘 :N  n:a@ʏ   %N  o % % "b "" %  @Ւ , ` @F*  $Ȑ @@ $@ , `$@  @ , 2*@, $@㿘 %"`"Ȁ`  %"` @ѷ ., ' D" @"!x  %"`@ϝ! T@&a!!:&' :.  ::B#  ::(B 0 ::8B @ ::HB PB 8㿐?Đ?:" B::@"X0"  :"pJ  :"`@ 0"pJ  :"x@ 㿐 ' :"B B? ' B?  D?㿐:  @u" %"   " ̒F: :` "@6 @u@  @m@ە ` @ @a@ݐ @Y@ہ` @ @M@J  @E@m @$:"' :bB':bD?@  @   %b (: : "Ȁ`"@ ' :B'`:bB: B?@  @ :@ܐ":"@ؒ T㿐 %"`:#@я'::#0@Ĕ % %" ` :#@$'@z'@,ڒ::#P0@ %"`"::@#x:@#` !x %" `:#$:#"@E::#0@{`n T ` ``" 2'@  ?;'  ‰ F?@!`:#` @6 `@k@` ` `@a@ډ` ` @6 `@U@R #\`@M@u#\`  @  @@@=` #` @8@``#`#l#d#h@a!a㿘@Þ :@>O!?@H @  @  ? 㿘 @@#}   #!x;`(  @@4  㿘!; #`8@'!x@Q 㿘 %"(  F\!T@"&;?4&0&(& 8@̘ d &<(#  ; @<  @ d$"@&@,?&Ȑ&& &$ ; pT@S Z@O Z;D`x@  㿘# %b( y b(!b@"&E?  d& &   "@ 2 &    $"@ 2 & T @ف" @Ӓ d& $ 8 &  " : && (& d@k $&& &$e ; T@ Z@ Z;D`@  㿘- %( $!$  ;`8#S@H?`L (&B?`$*&`4 * &@؄`(``` $@{4 ?@u`@$& ` &`"@ &(&`& & &$ ; T@ע Z@מ Z;D`@2  㿘@=>H>H=>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H>H=>H>H=>H=>H>H>H>H>H>H>H>H=>H>H=>H=>(>4>@㿀;!    7O5 -# %/ -+;2'쀢 8-* h@€ (  %&8"`|J@ @ 쀢 ;a@Y @;`| `|@  %, ?@@8a?ː? b * & ^@   006.`? @ƒ ; @ ; @ @  ; @Β @     @#\ 2 @h ;0@i  @;b@<  @ D "@ߐ!@f쀢 @@S@@v@ ';@b @̐ @[ T 2& ;@bH@ ) T@N@  ;@4@ ;;@bh@Ű  @G ; @A  ; @; " ;@b@ř    #\ 2`;@@r ;"@@4 2`@#\ @b@`&@$ !;b;@q2谒 ;"@  @=] ?  ` ;b@;^ @E@ϐ㿘N@ n N` o `@ #; n J` o  `@n "   @nے 2 `?  @c 2J@@AX@ބ `;#( ;#8 O@ ;!;#8@Ӑ@;c@@ \@( %@ Ӣ@C Z @;   -",`;;#Xcpn@  ;@c;@ڒa@;@Ғc;$@'h $'@ -* $  '* $  8* '$ ;@s#  6 ;#;,  @hc , ;@a#n @ ?  0-;@:#@@А^  ;;9 5;$cȘ@@@Y `ؒ@:  2  `;#@:|@ǐ @@@ <@:n +   >   -0"  !<@ @:  -",` @ ;#H@:G 0@ h<  T  @ D ->b, *   <<; 8`@@դ #` D#3;# `-<+<)<@`  2 8`@ H@ ,@`  뀌@`< P< @< H@< h;#8 @,   4'Ԓ@~< p@/b@8 << 8!< @< H "<<  @n   @:  8< @< H@Z   8< @< H <<  @F   , 8< @< H< @5  "  8< @< H< @#  @"  8< @< H< @  , 8< @< H< @,  ,< < @< H< @,  $,< < @< H< @Ք,  (,< < @< H< @,  , ,< < @< H< @,  0 ,< < @< H< @,  4,< < @< H< @,  8(< < @< H< @ka@ <@&̦<! < @< H!<!x@!0@Ja8@ 7<,  ! l < p ,<!@< @< H << lP p@$!X,  t̀<!`< @< H< @pax@ {<,  ! l < p ,<!@< @< H << lP p@!X,  t" x<!`< @< H< @Ԕp x < 8< @< H< @Ô x < 8< @< H< @ x < 8< @< H< @ x K< 8< @< H< @=@<a 7! l < 8< @< H< @v l < 8< @< H< @e l < 8< @< H< @T<!;#@K㿐@˒  @6  @  @ T `@! 㿘#쀢  b(`?  # -@    2b(@ 㿘 "`" @ 2    `*@&`  &` ;&` 2? Ȁ` Ȣ @ 2    `$*@&`$  &` !&`$ 2@!0`!0 @ 2    `*@&`  &` &` 2 Ȓ& `@``" @@`"@@@"@"@@" @#@#@ƭ@7 @# @@#@@@`@@|#P" @@u#h @@#p! 4 @#x `@@  4 @# `@@$ 4 @# `@@  4 @# `@@  4 @# `@@  4 @# `@v@ @# @l@  4 @# `@a@ @ 4 @# `@V@  4 @#Ȓ `@K@" 4 @#ؒ `@@@ @#4 @6@4 @# `@*@4  @# `@@4 A `@@4 A  `@@( 4 A  `@@4 @"A ( `@@A@ސ 0  4 A 8 `@@! 4 A @ `@Ր@ @ 4 A H `@ʐ@  4 A P `@@4 A X `@@" 4 A ` `@@$ 4 A h `@@( 4 A p `@@4  4 A x `@@ A @{@  4 A `@p@  4 A `@e@  4 A `@Z@ "  4 A `@O@ A@>  A @A@  4 A `@6@  4 A Ȓ `@+@ @ 4 A В `@ @  4 A ؒ `@@  4 A `@ @  4 A `@@ "  4 A `@@ A@ (2 #4 A! `@@ #!"A"  4 A#4 AA@ѐ!4 @͐! 4 A@Ȑ!4 A@Ð! 4 A!( `@@4 A!0 `@@4  4 A!8 `@@4  A!@ `@@$ 4 A!H `@@4 @A!P `@@4 A!` `@u@! A@b!h<#8`#8%A` @@ dp@@[` @ 2`@G 0C@D <#8#8`2 AA!a d,`` " ` @%@`( @W@ 2 ` @ ݐ @ ِ` @ ؀ !A!@ ͐@ ʒ(㿘! -"` @@ #h$"` -""d㿘! -"`   -"dA@ !$"`@n"`@`H AA@ !A!@  $"`@ !"`@$"`㿘 ?  1 -"XA@ 0% -1A ! "X M."X -*  ^* ? *4* ^*@**"XH 'H"" '# 'H@Z?2 e"  f a b+ gb% !  |@Ғ  'A |a@/Z  b@H*` A@RabH*`@ AbH* @'H Aa@' `@ Aa@/- `h@ `A@/K!` `H H` H,HH''@ GH -A+Ab 4H .H (H "c  `  @` @0ِ@ '@w'  H`'b@/@&H 'H Ő  @/ Ab(@.    `g@b A@.͐"8 㿘!A #bH@!x@ 㿘@2vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv8+]) -' -% -! -#A5 / -9c7i -* ax@€  %"l  $h $p $"x@@c ??t"x* @ &#܀ "  . " `. @A@c(@- @ǎ @(@@lj?@ Ac0@. <  "@@y@  @@  `@@@e8 -"x` -@ْ AU#0 -"l` -<   -A@.##8G "p` s#€  -<   -@ /  AP@}$ -"h`  -@ U  -  `2 A -"t€ A#0@- 0 㿘!A #cX@ɐ!x@ 㿘@O}~ ~T~@x|||||||,||||||||{p|||{||||{|||||||||||{{||P||||||||||||\||l||||@㿈 '7^!) 7' 75 # ?- 7+ ?% 6/B9 ?_'쀢 8Z* @€!Ā  @ l $!N'!Ā  @ b E$!!Ā  @ Y  ':$!  6% Đ 2$!Ā  @ F )$!!Ā  @ =  $!|'`А $` %!Ā  @ )  $!`ؐ %`$ $$@ @ሀ?? !đ*@`&  $!Ā `Ѐ  Đ   !Ā " 7@ ! 7 @` "Ȕ  `@ޖ Ԣ !B Ԓa@, ?`^*` € @ @p @ @ے @ @`  @֐ @ m @ @N @Đ   # @ 0 #a @ܒ@ R?  7@  7 6В(@אB`@a B`a@,' @ 4/`؀ . @В`m 'Ba@, ? (`@ j`  ` 6(@ 7 В@@^!@ b @@c㿘@b BaȔ@Ґ @E!&&& `&$@ 㿐 6#  ` B@,!! 7 B@,"  B@,"XB@,"  !W&&6@ ^ ?`Ѐp6 ?`؀   e`f@^   6   Bi" 6#$`B"ؘ  aD + 3` @;   aD + 3` @ ;  @R؀ 2H'  @ 6 B#' `m@ 6B@!@e B#@ 0%؀ !' `m@  B@Ԑ!  ? ؀`2  e`g@  B#@ 0 㿘    B0 B0B@+k#(0B@+g#p0 B@+c#0B@+_#0@+2!㿘 ? Ѐ`t 6#$`  * 2`   :  @@C  8 @Ř  @  ? 7 Ц@Yc 4 @ ? Ba@*Ӑ  !W@ @ C  6@ m*  b 6 C@+   6  >#<`C"   !W !C2  2    h@ G*  8В h (B@*!2  7 ` `s@@  7C`@*  7 Ā` 6#(e`r@. C`@*p #(e`e@"  C`@*d C @*& 㿘`( 2 @"&`&`( @!@ƪ !Ԁ@ CJ a@3 *J㿘N`C`!8Ca@ @|`N` Ca@ @s`C!H@VP`8 C * Cap@c`(ax@^`(C@Ya`,C@Ta`0C@Oa`4Ca@J`8Ca@EC`<a@@`HCa@8Ba`JCa@.Ba`LCa@$Ba`NCa@Ba`PCa@Ba`TCb@ `\`'C,@,` L !)@9C7C5C/C-C+C@ 7C@8= @" @۔`(@֔ ` a *@@ʒ0 ` @Ē8 `  2` ` ,`@ŋ< H@`@bP`@ ¢` @!@  `*`@R`K  H. `@    b*   /??* : C@ ` "^"*` €' C"B`('`C"BD?' C"B'`C"BÉD' C"B`8'`C"B?' C"B'`C"B' ?C"B?`($@>' C"B艠?' ?C"B?@%$' C"Bg' ?C"B?`(@ ' C"B؉?' ?C"B?В@' C"B4' ?C"B?`(@ؒ' C"Bȉ?' ?C"B?@ÿ' C"BĀ`C"聩/ C#\bXa@|  : C#l #\#`#d#hbh@la  !* Cb@a Cb@[  CB!C "@B !#C b@@;b@5 .mCb@+i `8`d!C@H"Д@@`8  ?`&  @& * *@S?`&  @&  * &@S!C"`8  @??@`8@ː  ?`&  @ * ** &@S{ ?`&  @ ) )* &@Sj ?`&  * &@S\ 㿐 ? Cb@` *  Cc@CCc@C`c @ Cc0 @`Cc@@`X`CcH@`X CcX@}`X Cc`@v ?`&  * & @S`(C@ccp`,C@^c`0C@Yc`8C@Tc`4C@Oc`<C@Jc`HC@Ec`JD@@``LD@;` `ND@6`0`PD`H@1`TD`p@,D`@(`\`    ,``"`&  4 `'D, @  $, `D@` bD!#`DD`И!#\@` @    U``@@Đ!@?D@ޒa ?B@B!@&| D@Ȓ"@`@*s  Da @Da0@@P-B/B+ 7P)D !@¸@ @ ْ@!`z @0@# #a @m?`? "`@ؐ ?  $? ? n% #`? $`@Ð  $Ȁ` 2` n N@  ᨐ@[ƒ 2`@&-@ᨰ 㿀DDc(0D''#8'@' D#@@a@ @, DD@&#PJ h@' @  @  @ 1  #D@Ɛ @/ & D#x@@ @%ߐ#p@,  '@,@C  ``@%:  @  @  @ 䀠 `?㿘D@ǎcL  㿘D#@IL   , @uL  㻐&`  &`c@\ ,ɐ "@{ : D#@% ,Dc@{͐ 2DDB  c@Xܐ B  `<@@ "`@Xɒ v`@*@@Vڐ 'D#@%fn6`c@{ :E'􀤠3L /-D+D'E#E|@{耢  '@{zc  '@{q  '`@%0 L 0&`X` @{Y  &L "`\@V,`$ = `L `E`0@k ? E @@$ 6``6`EB!``@{ E ``h@{ E`@  `p@{  E@V: 'a"&`(E @$’˨ `@z E@V$  'E @$ &`,`@zߐ E@V  'E @$ &`8`@zʐ E@U  'E @$ &`0`@z E@U  'E @$py w&`4`@z E@UА  'E @$[d b&`<`@z E@U  'E @$FO  L6`H`@zu E@U  'E @$09  66`Ja@z_ E@U  'E @$#   6`La@zI E@Uy  'E @$    6`Na(@z3 E@Uc  'E @# &`Pa8@z 2 @UN  'E @#ْ &`T EL  E*`: `@ `EȐ!P6`*` @@U   'E!@# &@E!p@# ʐ@U  'E!@# $4, a `P@  @ "`@V͒ `@*@ "c  `  @T֐'$@ : ' E!Д@#\' ,  "^#Yx@T Q$E!p@#?H g@T@R'>, E!p@#,5 T@T -$E!p@#$ C@T@-'􀤠, E!p@#  0@Tn 4$@: 6`"@" #@V >D@`?㿘 (  E"  , 2 0E"0 2 4E"H@"Ӓ   2 HE"`@"ʒ   H 2 8E"x@"  8 2 < ,@ 0& 8 < 2  8@{ 4& < E"@"  @ ( E@"" E"@"  @o ( E@"" `E#(@"   \)@ 7E5E3E/F-F+F  a `@"q= @I 8 ,`:`@"h @@ 8 ,`:`@"_cȀ2  "    F@"R   <@,`:`@"I@  < ,`:`@">h 2    ,`:`@"2` @  4, !Fa  " @" Ф h`!@Ȓ!@Ȑ'`LX'P'T7'@ !x'BFဒa @@3# #ax,Fa @ېFa(@֐Fa`@ѐ!F!@?@ȐFa@ÐFb@FbP@Fb c@FFb@Fc@FFcP@@ΐ  (   @*`2 \TH`,4Th͈̀Ͱͤ͘߸(8HX޸ߨh߈xߘ``'P0@!P    @  G @   G @  2GG`@+ G`@ ,@X((@ $@ @7  Ga @  䀢 2GG@/!P`8$  7$ l'$ , 4 , G@!`' z'z 2G 7zG@ "(`@Q!05 #G @Lh$@S? G  ?`$  * & @K  q/0/1G"p@ G@ @*`:` p=* j@€ G @ aGȒ!@ @!`@ @ @!@! `@!`GِȒ!@!@@ `@ٔ! 2GАȒ!@А!@̐@d@”! 2uGȒ!@!@e`r@ G@ ϒ\G@i"xȒ!@@!`@ @ }@ؔ@! `@!`3GkȒ!@x!@t@@k! 2GbȒ!@b!@^,(@A@R! 2GIȒ!@I@E!`@ +@ (@@2! `@-!`G` G #"@JaxG@ @ @G@ " "G@ G  L@єG @ G@"ؠ GL GG"Gb@ G!#0@ @@"@@ G ? ؀`G#`P@ @! 5GG#8@oݰ %G#G Ph@c    `H*  R  y n    H*`@ R` y  7 Д^ G@! @w# @ G@6#4G GGG#Вc@ʔ GL $GGb@S H @(G@G@W! Ȁ` @ a H@ GȒ!@E!@A!@=@ _`@ H@ 0G ? ؀`G@ݐ#G`P@ S@!  7G@ʐ#8G Дِ G@#G@!G .H`?H`"H XH h@f GȒ@!@!@ OGHL@@S pG㻘 H # @Iax0 N    ,  #H!x`@ p0 `E  `A #H!x@a0 -H` +H   , @`2  "    a//% #)H'H@v p8@aH N,  ` @ x@a!px x  6 ,     6 & &&& & @ &.  . $  &. 6@  " {&$&@.   +  ". +      "  +  2  `+ . @   2N& ϐ@ H!@ a&&@  28&@ ` 21& .#`" 2@ ^ 2"&@  2&@ Ґ 2& ." & @? @㿘HH!b@ 2JH #"@@Hax07*   &  #H!xa@`0&    ` #H!xbX@0 `   * b*@  #H!x@obx0@ 㿈HH"b@Д 2JH #"@@H:ax0,`    `' ' '' @&   #H!xa@>`0     #H!xbX@00@ \ w    `  " ` `       #Hb!x@ , &" &@ɒ D@  2T$ N$@ H@#@$ $@ Q # .#`"'   2! @ M @ r   2 @   $$ $ $   .c @h? @㿘HH#hc@ 2JH #"@@Gkax0q*!  j" `  " "``""` &"`"`"`"` `0O   . #H!xa@\`:` `  `  #H!x@JbX(`  H ##@G"ax`  .c .#      ` &" " " " ` .@ @!(&@㿐 ? Է.I@ h "D* I@ xI  @ I  @  (I@  ,I@  0I@  8I@}  4I@y! <I@u!I@q!0 HI@m!H I@i!X>8Ia#\II!pᨔ@Y  # #a >+ 㿐@b  .b# .c .# `@@   * @  8? @ ?   + @@  @  #@I    "&@+  "@ @    +  +   `+ &@@ Z㿐II!a@ 2JH #j"@   , #H!xa@.`0o `   #H!xbX@"0cI@@"I@"P ` I`"`#\`  #`@ɒ??H #/"@2@I #)" 9 `   # @  #I!x@b0'" &@"@ @ &@ ` < I #"@Eax0` .c  $@@? @㿐@i  @ . .#c  @ # `@@@"@㿘 - I#*b' #G ؒ@Ȑb$@MJ 2b ` ,b X ?4  " X* $ X @E  $ b@ $L?L ", L ?@# Lb Lb@#,#Lb ?b㻐 8` \@  # /+I@c($@L  ` /X ?4  "X* $X @D Ӱ?@^ ?L@ O ,@O ?O@ΐO ? *`O `tr p`&? @    H*`@ `?* : ` k \*` € 8 (,@  ($ ( (@,@O + -   ! '$ @{ "4?J` $ -? I' B#` '@Đ 'I #` 7ā@' B'-:  + -"'`@?> 'I#hB 8' I#hBI#pIB#`7ƅB' B' @""8@" @"I#8@͒㻐@  0@= @`@ s #!  I-`,`@@   `l?l""@2 2``a`ax@I@Ր#  k   d Ŧ/I - #`'%"$* @sؠ/$@K O X` ?"` X* $ X@Ct # O` ڐ?*  *  @ @ @&`@ -`(2 @@ `!@ ?J@,  ;J9J7J5J/ # J*`0D `@ "IH@J    bD  , @Jؐ 2  )@ࠐ@CS  # #)JbD%J, @ ؀ @CEa   , a ` ?"`a * $a @B   JJ6  ` 2 H #"@@C ax0" &@H #ax@C"@@N!0ޒ@ . ')J'J%I# # ,#\#` !@P ?〤?@Bax ,& ,)J'J%I# # 0#\#` !pʚ ?ˀ?@Bax 0& 0)J'J%I# # 8#\#` ! ??@Bɒax 8& 8)J'J%I# # 4#\#` "( ??@Bax 4& 4)J'J >c <"@  #J!x@b <"X 4 h@  4@ #\#`i ?j?2  <I #"@B}ax <# .Δcˀ @$ @J&@@["c8$c& <)J'J%I# # H#\#` # ; ?!x% 2 .b@>!x ` # !x@#P `  .# !x@ ` `!x@ ` $` 㿐.` %I%#R``2   < I #7"  "N$ " @&E$ #R!x@a  `#\``  #`p? ?H #"@@>ax&  I #"@>}ax "  #R!x@`   .c  #R!x@a  $ 㿐.` -R+R)H% #'I`#\#`b- ??"@@>Ex @>?x` 2$`R@&"@$` 㿐.` ` 9R, J H #"@@>#axC 7R) #5I/R-R+R @@#\#`"p†?߀?@: @!x@ @ @1 c8@=!x @',  㿐.` RRcx#)H# #%I   #\#` ??"@@=ax  24 @=ax  㿐.`  ` `("*` RR#2cȰ   , @@E 2 ,` 'R@># !,` H #"@@=ax +S)S'I% # ` #\#``8 PZ ?ꀤ?@=qx ` ,`  㿘. `E A ? = ;.#S!S /S@ @|@g *&@G`@   # @=Bax@` S ǐ  SH #"@@=1ax `@D 2N@  @P&@ 㿘 2 @@ 2  2@ `?@gi8@!? Sa@Ґ @! #eG`@ `r@} 6 &@`e@v 6&@Sa(@ &㿘  SSS!@ahb 2 H #g"@?* : `3dk!h*` €2(S #U"& (,& ,0& 04& 48& 8<Q& <`2`(S #B"& (`,& ,`0& 0`4& 4`8& 8`<>& <2(S #/"`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ S #"8@ #4R !`N @R K#4  S"Ȕ  "a$#4&@/!  $#4  Sؖ@= #4 $H#4+ !`' @+ $#4  S"Ȕ  "a$#4 @! $#4  S@=  #4S#  ""@#4 ?1 ! " ?@   S! @=  ? #4@ 6     !S8@= #4< @  !ScP@=Q #4@??$#4$H@2 #4a@   @#4 $8  @C ?2 $82 $8  `2$8 8`2$H 䀢  ` !  ""c@s#!i{#P*` €c? 䀢  ` ! "#Z"a` @>c? !  "! "a 䀢 ! 8 !>"#?;"c 䀢  ! !  : `@ 0@ %! ?"!%1>$!!  : `@ 0@!   $! 䀢 ?! &#&#ؐ" "c"% $@ 㿀c4    ? ? "!"`" à # #8`# !`'?`" * " @:e  "4S@c@#cH  ? 4@  <    4 0  @a$cH 䀢` "` !#L @7 #L@֔ @4!̀`#8`2  ?! S@:Y#  @W"a ? ?$4 ?䀢   "`"c< "c<!̀   f"!!`'?`" * " @9 $!`耢 !   !b4Sc@3@ >"aS"4@dj#耢 T  Sc    @%  @0"4@dK % ` "4 Tc<`ᰘ?#\#`#d@#h@$?c#8`c@   %#?4@? 44$@㿘#8"cD 1#4  @    #4@w     TH@; ?㿘#8` ?T`h@;c ?!P`   !T"4`@;V ? 㿘#@ 3#8 c4@   ?  "" !" ?"!Pc4@  ? "` $#@  T#<@;I 0#<Ta@; 㿘#@ c4 @   ?"`"D6$#@$#@#8 @ & : !c4  @ .  > b c4@v $  $#@   ?倢` E0    Ta0@:Ð $#@C    $#@  "D ? "`D  Ta`@: 0' #<Ta@: 0   T#<@: 0 ``"T@А TTa@: 0a@: 㿐 ? 耢`g?c@ b `? TWb0 ?  ? "`#8 4=# 9 ?!0 # 2$@c47  a'@ 6&$@%@ # c8 %"%4  @D  > @@ d4@6   $@# @ Tb@:  Tb`@: ?㿘  >2@ `(= #@ 45#8`21 !#4  @   . install.md set_term() { [ "$TERM" ] && return ask "Specify terminal type:" ${MDTERM:-vt220} TERM=$resp export TERM md_set_term } welcome() { local _query cat << __EOT Welcome to the OpenBSD/${ARCH} ${VERSION_MAJOR}.${VERSION_MINOR} ${MODE} program. This program will help you ${MODE} OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an ${MODE} can leave your system in an inconsistent state. __EOT set_term cat << __EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat << __EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _query="Proceed with upgrade?" ;; install) cat << __EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _query="Skip disk initialization?" else _query="Proceed with install?" fi ;; esac ask "\n$_query" n case $resp in y*|Y*) echo "Cool! Let's get to it..." ;; *) cat << __EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit ;; esac } get_dkdevs() { bsort `sed -ne "${MDDISKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_cddevs() { bsort `sed -ne "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_ifdevs() { /sbin/ifconfig -a | egrep -v '^([[:space:]]|(lo|enc|gre|ppp|sl|tun|bridge|pflog|vlan|gif)[[:digit:]])' | cutword -t: 1 } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while : ; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until () { resp= while [ -z "$resp" ] ; do ask "$1" "$2" done } ask_which () { local _name=$1 _query=$2 _devs=$3 _defdev=$4 : ${_defdev:=done} _devs=${_devs% } resp= if [[ -z $_devs ]]; then echo "Done - no available ${_name}s found." resp=done fi while [ -z "$resp" ]; do ask "Available ${_name}s are: ${_devs}.\nWhich one $_query (or done)" "$_defdev" if isin $resp $_devs ; then makedev $resp || resp= elif [ "$resp" != "done" ]; then echo "'$resp' is not a valid choice." resp= fi done } isin() { local _a=$1 _b shift for _b; do [ "$_a" = "$_b" ] && return 0 done return 1 } addel() { local _a=$1 _b _seen=false shift for _b; do echo -n "$_b " [ "$_a" = "$_b" ] && _seen=true done $_seen || echo -n "$_a" } rmel() { local _a=$1 _b shift for _b; do [ "$_a" != "$_b" ] && echo -n "$_b " done } cutword () { local _a _n _oifs=$IFS case $1 in -t?*) IFS=${1#-t}; shift;; esac _n=$1 while read _a; do set -- $_a [ "$1" ] || break eval echo \$$_n done IFS=$_oifs } cutlast () { local _a read _a; set -- $_a [ $# -gt 0 ] || return eval echo \$\{$#\} } bsort() { local _l _a=$1 _b case $# in 0) return;; 1) echo $1; return;; esac shift for _b; do if [[ "$_a" != "$_b" ]] ; then if [[ "$_a" > "$_b" ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n $_a if [[ -n "$_l" ]] ; then echo -n " " bsort $_l fi } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } get_setsdir() { local _mp=$1 _dir=$2 _mounted SETSDIR= _mounted=`mount | sed -ne "/\(.*\)\/\(${_mp#/}\)\/*\(.*\) type.*/s//\/\3/p"` if [ -z "$_mounted" ]; then echo "No filesystems mounted at or below ${_mp}." return fi while : ; do ask "Enter the pathname where the sets are stored (or '?')" "$_dir" case $resp in "?") cat << __EOT Sets could be stored on: ${_mounted} __EOT continue ;; "") ;; *) if [ -d "${_mp}/${resp}" ]; then SETSDIR=${_mp}/${resp} return fi echo "The directory '${resp}' does not exist." ;; esac ask "Re-enter pathname?" y case $resp in y*|Y*) ;; *) break ;; esac done } makedev() { local _d=$1 isin $_d $IFDEVS && return if [ ! -c /dev/r${_d}c ]; then if [ -r /dev/MAKEDEV ]; then (cd /dev; sh MAKEDEV $_d) DEVSMADE=`addel $_d $DEVSMADE` else echo "Device nodes for $_d are missing, and MAKEDEV" echo "does not exist to create them with. Sorry." false fi fi } get_rootdisk() { local _defdsk _defdsk=`echo $DKDEVS | cutlast` [ "$_defdsk" = "$DKDEVS" ] || _defdsk= if [ "$MODE" = "install" -a ! -f /etc/fstab ]; then cat << __EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi ROOTDISK= ROOTDEV= ask_which "disk" "is the root disk?" "$DKDEVS" "$_defdsk" [ "$resp" = "done" ] && exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a } addhostent() { sed "/ $2\$/d" /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } addifconfig() { if [ "$3" = "dhcp" ]; then echo "dhcp NONE NONE NONE $5" > /tmp/hostname.$1 addhostent 127.0.0.1 $2 else echo "inet $3 $4 NONE $5" > /tmp/hostname.$1 addhostent $3 $2 fi } do_selection_list() { local _next _elem for _elem in $1; do if isin $_elem $2; then echo -n " [X] " else echo -n " [ ] " : ${_next:=$_elem} fi echo $_elem done : ${_next:=done} ask "\n$3 (or 'done')" "$_next" } configure_all_interfaces() { local _IFDEVS=$IFDEVS _ifs while : ; do _IFDEVS=`rmel "$_ifs" $_IFDEVS` ask_which "interface" "do you wish to initialize?" "$_IFDEVS" "`echo $_IFDEVS | cutword 1`" [ "$resp" = "done" ] && break _ifs=$resp configure_ifs $_ifs || _ifs= done } configure_ifs() { local _up _if_name=$1 _if_ip _if_mask local _if_symname _if_extra local _dhcp_prompt _mediaopts set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` _up=$1 _if_ip=$2 _if_mask=$3 [ $_up = "UP" ] && ifconfig $_if_name delete down [ -x /sbin/dhclient ] && _dhcp_prompt=" (or 'dhcp')" resp= while [ -z "$resp" ] ; do ask "IP address for ${_if_name}${_dhcp_prompt}?" "$_if_ip" if [ ! -x /sbin/dhclient -a "$resp" == "dhcp" ]; then echo "DHCP is not supported." resp= fi done _if_ip=$resp ask_until "Symbolic (host) name?" "$HOSTNAME" _if_symname=$resp if [ "$_if_ip" != "dhcp" ]; then ask_until "Netmask?" "${_if_mask:=255.255.255.0}" _if_mask=$resp fi _mediaopts=`ifconfig -m $_if_name | sed -n '/media:/D;/media/p'` if [ "$_mediaopts" ]; then cat << __EOT The default media for $_if_name is $(ifconfig -m $_if_name | sed -n '/supported/D;/media:/p') __EOT ask "Do you want to change the default media?" "n" case $resp in y*|Y*) cat << __EOT Supported media options for $_if_name are: $_mediaopts __EOT ask "Enter media options for $_if_name:" _if_extra=$resp ;; *) ;; esac fi if [ "$_if_ip" = "dhcp" ]; then ifconfig ${_if_name} down ${_if_extra} cat > /etc/dhclient.conf << __EOT initial-interval 1; send host-name "$HOSTNAME"; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "hostname-associated DHCP attempt for $_if_name failed..." ifconfig $_if_name delete down cat > /etc/dhclient.conf << __EOT initial-interval 1; request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT dhclient -1 ${_if_name} set -- `ifconfig $_if_name | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p'` if [ $1 = "UP" -a $2 = "0.0.0.0" ]; then echo "free-roaming DHCP attempt for $_if_name failed." ifconfig $_if_name delete down return 1 else echo "DHCP attempt for $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else echo "DHCP configuration of $_if_name successful." addifconfig ${_if_name} ${_if_symname} ${_if_ip} return 0 fi else ifconfig ${_if_name} down if ifconfig ${_if_name} inet \ ${_if_ip} \ netmask ${_if_mask} ${_if_extra} up then addifconfig ${_if_name} ${_if_symname} ${_if_ip} ${_if_mask} "$_if_extra" return 0 fi fi return 1 } isalphanumeric() { local _n _n=$1 while [ ${#_n} != 0 ]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } enable_network() { local _netfile if [ ! -f /mnt/etc/hosts ]; then echo "ERROR: no /mnt/etc/hosts!" return 1 fi for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done DIDNET=y ifconfig lo0 inet localhost route -n add -host `hostname` localhost > /dev/null route -n add -net 127 127.0.0.1 -reject > /dev/null for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|""|"rtsol") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down cmd="dhclient $if" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -n add -host $name 127.0.0.1" ;; inet6) continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done < /mnt/etc/hostname.$if done if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route -n add -host default `cat /mnt/etc/mygate` fi echo "Network interface configuration:" ifconfig -am if [ -f /etc/resolv.conf ]; then route show echo "\nResolver enabled." else route -n show echo "\nResolver not enabled." fi return 0 } glob_selection() { local _selection=$1 _src=$2 local _action _nomatch _f _action=addel case $_selection in ""|+|-) return ;; +*) _selection=${_selection#?} ;; -*) _selection=${_selection#?} _action=rmel ;; esac [ "$_selection" = "all" ] && _selection=* set -o noglob for _f in $SETS; do eval "case $_f in $_selection) GET_FILES=\`$_action $_f \$GET_FILES\` _nomatch=false ;; esac" done set +o noglob if $_nomatch; then cat << __EOT The file '${_src}/${_selection}' does not exist. Check to make sure you entered the name properly. __EOT fi } get_sets () { local _f _file_list=$1 _src=$2 SETS= for _f in $THESETS ; do if [ "$_f" = "kernel" ]; then if isin bsd $_file_list; then SETS="$SETS bsd" fi elif isin ${_f}${VERSION}.tar.gz $_file_list; then SETS="$SETS ${_f}${VERSION}.tar.gz" elif isin ${_f}${VERSION}.tgz $_file_list; then SETS="$SETS ${_f}${VERSION}.tgz" fi done if [ -z "$SETS" ]; then cat << __EOT No OpenBSD ${VERSION_MAJOR}.${VERSION_MINOR} ${MODE} sets were found in '${_src}' __EOT ask "Search for other *.tar.gz and *.tgz files?" y case $resp in n*|N*) return ;; esac for _f in $_file_list ; do case $_f in *.tar.gz|*.tgz) SETS="$SETS ${_f}" esac done fi if [ -z "$SETS" ]; then ask "There are no *.tar.gz or *.tgz files in ${_src}.\nSee a directory listing?" y case $resp in n*|N*) return ;; esac echo "\n${_file_list}\n" return fi } get_get_files () { local _files=$1 _src=$2 GET_FILES= get_sets "$_files" "$_src" [ "$SETS" ] || return for _f in $SETS ; do case $_f in base*|bsd|comp*|etc*|game*|man*|misc*) isin $_f $SETSDONE || GET_FILES=`addel $_f $GET_FILES` ;; esac done while : ; do cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT do_selection_list "$SETS" "$GET_FILES" "File Name?" [ "$resp" = "done" ] && break glob_selection "$resp" "$_src" done } install_get_files () { local _f _src=$1 ask "Ready to ${MODE} sets?" y case $resp in n*|N*) return ;; esac echo for _f in $GET_FILES ; do echo "Getting ${_f} ..." case $_f in *.tar.gz|*.tgz) ftp ${_ftp_active} -o - -V -m "${_src}/${_f}" | tar zxpf - -C /mnt ;; *) ftp ${_ftp_active} -o "/mnt/${_f}" -V -m "${_src}/${_f}" ;; esac if [ $? -ne 0 ]; then echo "'${_f}' did not install correctly." else SETSDONE=`addel ${_f} ${SETSDONE}` fi done } encode_for_url() { echo "$1" | sed -e 's/:/%3a/g' -e 's/@/%40/g' -e 's/\//%2f/g' } install_url() { local _f _file_list _url_type=$1 _url_base _url_login _url_pass _oifs donetconfig : ${_proxy_host:=none} ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" "$_proxy_host" if [ "$resp" = "none" ]; then unset _proxy_host ftp_proxy http_proxy else _proxy_host=$resp export ftp_proxy=${_proxy_host} export http_proxy=${_proxy_host} fi : ${_ftp_getlist:=y} ask "Do you want to see a list of potential ${_url_type} servers?" "$_ftp_getlist" case $resp in n*|N*) _ftp_getlist=n ;; *) _ftp_getlist=y ftp ${_ftp_active} -V -a -o /tmp/ftplist ftp://129.128.5.191/pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/ftplist > /dev/null grep "^${_url_type}:" /tmp/ftplist | cat -n | less -XE ;; esac resp= while [ -z "$resp" ] ; do if [ ! -f /tmp/ftplist ]; then eval ask \"Server IP address, or hostname?\" \"\$_${_url_type}_server_ip\" continue; fi eval ask \"Server IP address, hostname, or list#?\" \"\$_${_url_type}_server_ip\" case $resp in "?") grep "^${_url_type}:" /tmp/ftplist | cat -n | less -XE resp= ;; +([0-9])) maxlines=`grep "^${_url_type}:" /tmp/ftplist | sed -ne '$='` if [ $maxlines -lt $resp -o $resp -lt 1 ]; then echo "There is no ${resp}th line in the list." else tline=`grep "^${_url_type}:" /tmp/ftplist | sed -ne "${resp}p"` url=`echo $tline | sed -e "s/^${_url_type}:\/\///" | cutword -t' ' 1 | cutword -t' ' 1` host=`echo $url | cutword -t/ 1` path=`echo $url | sed -e "s/^${host}\///"` path=${path}/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH} eval _${_url_type}_server_ip=$host eval _${_url_type}_server_dir=$path echo "Using $tline" fi resp= ;; *) ;; esac done eval _${_url_type}_server_ip=$resp if [ "$_url_type" = "ftp" -a -z "$ftp_proxy" ]; then case $_ftp_active in -A) resp=n ;; *) resp=y ;; esac ask "Does the server support passive mode ftp?" "$resp" case $resp in n*|N*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi if [ "$_url_type" = "ftp" -a -z "$_ftp_server_dir" ] ; then _ftp_server_dir=pub/OpenBSD/${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH} fi eval ask_until \"Server directory?\" \"\$_${_url_type}_server_dir\" eval _${_url_type}_server_dir=$resp if [ "$_url_type" = "ftp" ]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _ftp_server_password=root@`hostname` if [ "$_ftp_server_login" != "anonymous" ]; then resp= while [ -z "$resp" ] ; do askpass "Password (will not echo):" done _ftp_server_password=$resp fi IFS=$_oifs fi if [ "$_url_type" = "ftp" -a "$_ftp_server_login" != "anonymous" ]; then _url_login=`encode_for_url "$_ftp_server_login"` _url_pass=`encode_for_url "$_ftp_server_password"` _url_base=ftp://${_url_login}:${_url_pass}@${_ftp_server_ip}/${_ftp_server_dir} else eval _url_base=${_url_type}://\$_${_url_type}_server_ip/\$_${_url_type}_server_dir fi if [ "$_url_type" = "ftp" -a -z "$ftp_proxy" ] ; then _file_list=`ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_ftp_server_password" "$_ftp_server_dir"` else _file_list=`ftp -o - -V "${_url_base}/index.txt" | sed 's/ //'` fi get_get_files "$_file_list" "`eval echo \\$_${_url_type}_server_dir`" [ "$GET_FILES" ] || return install_get_files "$_url_base" } install_mounted_fs() { local _f get_setsdir "$1" "$2" [ -d "$SETSDIR" ] || return get_get_files "`ls -l ${SETSDIR}`" "$SETSDIR" [ "$GET_FILES" ] || return install_get_files "file:$SETSDIR" } install_cdrom() { local _drive _part _fstype _directory _n ask_which "CD-ROM" "contains the ${MODE} media?" "$CDDEVS" "`echo $CDDEVS | cutword 1`" [ "$resp" = "done" ] && return _drive=$resp _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else resp= while [ -z "$resp" ] ; do ask "CD-ROM partition to mount? (normally 'c')" c case $resp in [a-p]) _part=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT Two CD-ROM filesystem types are currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= while [ -z "$resp" ] ; do ask "Which filesystem type?" cd9660 case $resp in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: '$resp'" resp= ;; esac done fi rm -f /tmp/label.$_drive if ! mount -t ${_fstype} -o ro /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive." return fi install_mounted_fs /mnt2 "${VERSION_MAJOR}.${VERSION_MINOR}/${ARCH}" umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { local _drive _def_partition _partition_range _partition local _fstype _fsopts ask_which "disk" "contains the ${MODE} sets?" "$DKDEVS" "`echo $DKDEVS | cutword 1`" [ "$resp" = "done" ] && return 1 _drive=$resp cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 1 fi fi resp= while [ -z "$resp" ]; do ask "Partition?" "$_def_partition" case $resp in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs $MDFSTYPE __EOT resp= while [ -z "$resp" ]; do ask "Which filesystem type?" default case $resp in default) ;; ffs) _fstype="-t ffs" _fsopts=async ;; $MDFSTYPE) _fstype="-t $resp" _fsopts=$MDFSOPTS ;; *) echo "Invalid response: $resp" resp= ;; esac done if ! mount $_fstype -o ro,$_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk." return 1 fi return 0 } install_disk() { if mount_a_disk; then install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 fi } install_nfs() { if [ ! -f /sbin/mount_nfs ]; then echo "/sbin/mount_nfs not found. Cannot mount NFS filesystems." return fi donetconfig ask_until "Server IP address or hostname?" "$_nfs_server_ip" _nfs_server_ip=$resp ask_until "Filesystem on server to mount?" "$_nfs_server_path" _nfs_server_path=$resp ask "Use TCP transport? (only works with capable NFS server)" n case $resp in y*|Y*) _nfs_tcp=-T ;; *) _nfs_tcp= ;; esac if ! mount_nfs $_nfs_tcp -o ro ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server." return fi install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT ask_until "Name of tape device?" "${TAPE##*/}" TAPE=/dev/${resp##*/} if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." return fi export TAPE echo -n "Rewinding ${TAPE} (mt rewind)..." if ! mt rewind ; then echo "FAILED." return fi echo "done." resp= while [ -z "$resp" ]; do ask "File number?" case $resp in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= ;; esac done if [ $_nskip -ne 0 ]; then echo -n "Skipping to source file (mt fsf ${_nskip})..." if ! mt fsf $_nskip ; then echo "FAILED. Could not skip $_nskip files." return fi echo "done." fi cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= while [ -z "$resp" ]; do ask "Which way is it?" 1 case $resp in 1) _xcmd="tar -zxvpf -" ;; 2) _xcmd="tar -xvpf -" ;; *) echo "Invalid response: $resp." resp= ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [ ! -d $_zoneroot ] && return if [ -L /mnt/etc/localtime ]; then TZ=`ls -l /mnt/etc/localtime 2>/dev/null | cutlast` TZ=${TZ#${_zoneroot#/mnt}} fi : ${TZ:=GMT} while : ; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [ "$resp" = "?" ]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [ -d "$_zonepath" ]; do echo -n "Select a sub-timezone of " ask "'${_zonepath#$_zoneroot}' ('?' for list):" if [ "$resp" = "?" ]; then ls -F ${_zonepath} else _zonepath=${_zonepath}/${resp} fi done if [ -f "$_zonepath" ]; then TZ=${_zonepath#$_zoneroot} echo "You have selected timezone '$TZ'". ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { if [ ! -s /mnt/bsd ]; then cat << __EOT Warning, no kernel (/mnt/bsd) installed! You did not unpack a file set containing a kernel -- this is needed to boot. Please note that the install kernel is *not* suitable for general use. __EOT elif [ ! -f /mnt/bin/cat ]; then cat << __EOT You still do not have a /bin/cat in your filesystem (i.e. a sample random file which you probably want). This seems to indicate that you are still missing important distribution files. __EOT elif [ ! -x /mnt/dev/MAKEDEV ]; then cat << __EOT No /dev/MAKEDEV has been installed yet. __EOT elif [ ! -d /mnt/etc -o ! -d /mnt/usr/share/zoneinfo -o ! -d /mnt/dev ]; then cat << __EOT One or more of /etc, /usr/share/zoneinfo or /dev is missing. Did you forget to extract a required set? __EOT else return 0 fi cat << __EOT You can now try to install the missing set(s), or you can enter '!' at the prompt to escape to a shell and fix things by hand. __EOT return 1 } install_sets() { cat << __EOT You will now specify the location and names of the ${MODE} sets you want to load. You will be able to repeat this step until all of your sets have been successfully loaded. If you are not sure what sets to ${MODE}, refer to the installation notes for details on the contents of each. __EOT while : ; do cat << __EOT Sets can be located on a (m)ounted filesystem; a (c)drom, (d)isk or (t)ape device; or a (f)tp, (n)fs or (h)ttp server. __EOT ask "Where are the ${MODE} sets you want to use? (m, c, f, etc.)" case $resp in c*|C*) install_cdrom ;; d*|D*) install_disk ;; f*|F*) install_url ftp ;; h*|H*) install_url http ;; m*|M*) install_mounted_fs /mnt ;; n*|N*) install_nfs ;; t*|T*) install_tape ;; *) echo "Invalid response: $resp" ;; esac ask "Extract more sets?" n case $resp in n*|N*) # Perform sanity checks... sane_install && break ask "\nDo you want to extract more sets?" y case $resp in n*|N*) break ;; esac ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do case $_dev in \#*) continue ;; esac case $_opt in *noauto*) continue ;; esac [ -f "/sbin/mount_${_fstype}" ] || continue [ "$_fstype" != "nfs" ] || continue _opt="$(echo ${_opt} | \ sed -e 's/^softdep$//; s/^softdep,//; s/,softdep,/,/; s/,softdep$//;')" [ "$_fstype" = "ffs" ] || \ _opt="$(echo ${_opt} | \ sed -e 's/^rw$/ro/; s/^rw,/ro,/; s/,rw,/,ro,/; s/,rw$/,ro/')" [ "$_mp" = "/" ] && _mp= echo $_dev /mnt$_mp $_fstype $_opt $_rest done < /tmp/fstab > /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } cleanup_on_exit() { echo "\nCleaning up..." if [ -f /var/run/dhclient.pid ]; then echo "Stopping dhclient" kill -HUP `sed -ne "1p" /var/run/dhclient.pid` > /dev/null 2>&1 rm -f /var/run/dhclient.pid fi if [ -f /etc/fstab ]; then umount -av elif [ ! "`df /`" = "`df /mnt`" ]; then umount -v /mnt fi echo "Done." } remount_fs() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done < /etc/fstab } check_fs() { local _dev _mp _fstype _rest _fail echo "Checking non-root filesystems..." while read _dev _mp _fstype _rest; do [ "$_dev" != /dev/"$ROOTDEV" ] || continue [ -f "/sbin/fsck_$_fstype" ] || continue _rest=${_dev#/dev/} makedev ${_rest%[a-p]} || continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done < /etc/fstab echo "...Done." [ "$_fail" ] && exit } get_resolv_fqdn () { [[ -f $1 ]] || return FQDN=`sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' $1` } get_fqdn() { get_resolv_fqdn $1 if [ -f "$2" -a -n "$FQDN" ]; then sed "s/\\(.*\\)[[:space:]]\\(.*\\)\$/\\1 \\2.$FQDN \\2/" $2 > $2.new mv $2.new $2 else ask "Enter DNS domain name (e.g. 'bar.com'):" "$FQDN" FQDN=$resp fi } donetconfig() { local _nam [ "$DIDNET" ] && return DIDNET=y echo "::1 localhost\n127.0.0.1 localhost" > /tmp/hosts rm -f /tmp/hostname.* rm -f /tmp/resolv.conf.shadow cat << __EOT If any interface will be configured by DHCP, you should not enter information that will be supplied via DHCP, e.g. the DNS domain name. __EOT get_fqdn /tmp/resolv.conf configure_all_interfaces if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf fi get_fqdn /tmp/resolv.conf /tmp/hosts hostname $HOSTNAME.$FQDN resp=`route -n show | sed -ne '/^default */{ s/// s/ .*// p }'` if [ -z "$resp" ] ; then resp=none if [ -f /tmp/mygate ]; then resp=`cat /etc/mygate` : ${_resp:=none} fi fi ask "Enter IP address of default route:" "$resp" if [ "$resp" != "none" ]; then route delete default > /dev/null 2>&1 if route add default $resp > /dev/null ; then echo $resp > /tmp/mygate fi fi resp=none if [ -f /tmp/resolv.conf ]; then resp= for n in `sed -ne '/^nameserver /s///p' /tmp/resolv.conf` do if [ -z "$resp" ] ; then resp=$n else resp="$resp $n" fi done fi ask "Enter IP address of primary nameserver:" "$resp" if [ "$resp" != "none" ]; then echo "search $FQDN" > /tmp/resolv.conf for n in `echo ${resp}`; do echo "nameserver $n" >> /tmp/resolv.conf done echo "lookup file bind" >> /tmp/resolv.conf ask "Would you like to use the nameserver now?" y case $resp in y*|Y*) cp /tmp/resolv.conf /tmp/resolv.conf.shadow ;; esac fi if [ ! -f /tmp/resolv.conf.shadow ]; then echo "\nThe host table contains:\n" cat /tmp/hosts ask "\nWould you like to edit the host table with ${EDITOR}?" n case $resp in y*|Y*) ${EDITOR} /tmp/hosts ;; esac fi ask "Do you want to do more, manual, network configuration?" n case $resp in y*|Y*) echo "Type 'exit' to return to install." sh ;; esac } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } set_machdep_apertureallowed() { [ "$MDXAPERTURE" ] || return ask "Do you expect to run the X Window System?" y case $resp in y*|Y*) sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf > /tmp/sysctl.conf ;; esac } finish_up() { local _dev set_timezone echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DEVSMADE; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/${MODE}.site ] && /mnt/usr/sbin/chroot /mnt /${MODE}.site trap - HUP INT QUIT TERM EXIT cat << __EOT CONGRATULATIONS! Your OpenBSD ${MODE} has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=32 VERSION_MAJOR=$(( $VERSION / 10 )) VERSION_MINOR=$(( $VERSION % 10 )) export VERSION VERSION_MAJOR VERSION_MINOR dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' > /var/run/dmesg.boot DKDEVS=`get_dkdevs` CDDEVS=`get_cddevs` IFDEVS=`get_ifdevs` DEVSMADE= THESETS="base etc misc comp man game xbase xshare xfont xserv site $MDSETS" SETS= SETSDIR= SETSDONE= GET_FILES= FQDN= HOSTNAME= if [ -z "$EDITOR" ] ; then EDITOR=ed [ -x /usr/bin/vi ] && EDITOR=vi export EDITOR fi trap 'cleanup_on_exit' EXIT trap 'exit 2' HUP INT QUIT TERM welcome get_rootdisk 8@HPX`hpx(08@HPX`hpx8@HPX`hpx(08@HPX`hpx8@HPX`hpx(08@HP ? @ 0C 4 2 > 4(>0@ b >0  #4@     T @9Ȑ?$c@?㿐#@ 6#8 K  T{ `(y$@ @9bp? !n `(l$@#4  @     T @9(X?b #<`T @9cXI?    #4@ B   T @97?@< 1  "!0 `(.$@ :`@D@ T@9Xc? 7@'4 a@     T @9iؐ?$@?$@ ?c#@ `'?c4 @? 4    U@9E }?  7'4!  @ƒ!     U @90 h?7'4!@  ?  UH@9 W?#4@g?  4  Ux@9 F?@Y? 44    U@8 6? 7'4# a@    U @8 #?!%c@@ Tc@8 ? 7@'4a@_    U@8ɐ ?㳈 aؐ @ǔ   U@8  @ι   ?  U@8  ?`耢  #D` T4 @` 4U@8=! S @`bȀ aS@`b {#8 w u  #<aU@8!!HU@8!p #<aU@8!U@8!`?  UU@8 ! ;U $#P @8";U7U5U/U9!U+U3U'U)U4@7b @7H@7p@7☐@7, @`b  O ?%4b@7'#@ "!`O 2"؀`Y `s`S"0 `y"a a@74@7#'U"@74#<U@7#@'U!U (@74@7`@7#@7, Ub@`O O ?4U"%@7##@ 8"! 2UU@7#4c@`5 U@7|#4@=,U@7s#4 V!#P @a$#P@`V X$a? "@V%`@7 ?㿐@ V`H@ u @`"#LV`X@ j @0@@@0" @ @ V `h@ @ V`p@@@  V`x@ : ?#p@٠@ \ `D T``  N !̀` @ G E@ _ @@_  x % #@7 (`@&7 #`@*Q @% `@& `2@9  @B ``( aؔ @  8@%y?#p@@r  `D ``  @0H  " `@.A @_ f/ @)  x @# b ? !`8?#@В 0b  a 8 #@ ( xq@a  ? `@(  `` `8 V`@% `@&J `  @, x E@a   !Ԁ`B ?#@| 9 a  !Ԁ`8 + @ ( % x@a  ? `@( `8   `@`x @ @B0!̀   @A  @  "a  "  "@    V@5   6 4? @1@ x @ @ @jB`@,̀ n !`j  `?"`@* "@@3 Y$!@ ` x @ @ @=B@+0F? < @̀ ` !`  `?"`@* "@@3T $!`2 ?# x @ @ B      @b   V@5m @n `@$n ``(ؔ @d @/,@#㿈 ?`'@* @o   `,    ` 0@, @]ݐ / 5 @@*       @U  '  V @50@$ϐ @@+3`  "(` @   @@+ 0 !̀   @   @Ԑ   "a `ŀ" @`|` à  !`  `?"`@* "@@2r $a@A0H  @ @5à   !`  `?"`@* "@@2J $a 6耢   @耢 ( x`  ` x @ `@ `@'  "?+'@+, $` `4@Dؔ @I v܀ @. @ ?cp@    耤 V`@3 0w `D q `  k b  @* b   @+ X à   ` V4@xa  "a x b  @* " @+  @א  @&  @NB  `(@*1 @O ̀  ! !  V@1!H$!U  "`@*/ @  `D ?#p@6 ?b?@?#@ ? '  @[,lV ?L+ /?b&aP#@M / /*@-`,"b@    Vbp@3J 0I<  Vba@3 0>@( :@b 5@, 0 " `@* '@5 0'??'@&F  # b 2  !`; * :  /`? @[-Va@2Ԑ 0@ !-b  a  8 @ a  @ 8 @p@( ɒ@" Ē?c @#k  a   !Ԁ`( @В 2" !  !Ԁ` 8  @ !  @ 8  à    @  "a  !`"@ @ !̀ f !`b  `?R"`0U   ? @ @P !@(!  @ ?b  '  V @2<0 @ 6@˒@(h0"@Đ@&@!̀  !`  `?"`@* "@@/Ր $!@I ؔ @ <@+@㿐  ?`X ? ' 5V-1V9V "b?  @  `P 䀢 A @1"8 X@ 䀥 `X $€ #`` ``8 % ` 䀢  @1" `@4 Ӑ` " `8@  0Vb ?Vb`@1b ?a  "a㿘#"` "(*` * & 6@  ?o?@* @*`@"@ےc aX " 97V TV@x N"  aX 䀢 K? @1⸮ @u 4 c@ " c ?!X@*` *  . `@  2  䀢 ? @0⸮  @""@Ơ"aX¤ Vb@0А ?㿘 a  @ !X "aX `&!!? Vc  !VcH   "" Vc  @0?0 a ""a  !X !X ? !  @  8"a\#!` 㿘  @ aX"!X !? Vc W` "@0g?0 Sa     ?a !X    #!`:#a\  @?X   X"!"c؝㿘 !`W`0  Ḁ    !"Ḫ "c"#ت  s \  !` " cؒ  @ :; F@b@  @cؒ :@ D5 E@d  (!X`%!Xcؤ@$`@ %!\`᠔ -`!\ $``X"  : Xcؔ $`%!\c$`@ %!\ a @cؐb  %;a08   "` W`h @/?㿘#ܤ`L  䀢`W`@/ C? !   7?  ;  !XB@   "!\8"a`(   :! #  : !X%cؘ ܀   W`@/g 0 !X  ?㿘 a`" "a`@㿐  p? a\  `" :   2 @!`  !`@fU%!` ! :`@  @q@   :? @ f @ B D (8. !`"@:`   ` @^:   2@!`!`  d%!`a\!` 㿘#  a`aX ! !\ "@% !\c@[$a`㿘`$" ' # %\a`"@  @@Jؠ @?a`@ a`&@@$a`` 㿘`$' # \a`"@  @ &@ a`@a`&@$a` 㿘'  !\`"  @cؠ &!?< 2 @` `@ `@ < f $`  `  8 H@'  !\`"  @c؀ &G>: 2 @` ` @囐  `@ :d $` 4 `8    W   Wa@- !>@@   W @@. >?8 WaX@-ݐ > ( H@  '@ "  ؀ 2   O>  W @-  >'/ 0-  :2 @   `#\@   "(` : !`   #!` `: $`  @ d \` `"@% @ Ē   H`4   `@ 4  ` "(  ?"(`2   @Wa @-C  (HP  * 2`  *` '     "2  @   @g  ؀ 2  ' W @-;'# 'aX@ #\@ P <@ EaX@nؠ 怦!   W@- 0 H    @   Wb @,і @   8  W0@,   WbH @,   H`4 `@ A㿘c  )  $% #  !    :aX5#ذ    "a? aX> B@  "!\8"a`㿘 !! ` 4+   1%  !!!  !'%  @3'Wbp@,K       =ai"# !X    "a\@=a] && % '  =a M X "a\&& Xآ@ `a <`B=a  !\@mXX ؐ &"a`$ X  "!`aX@ <`C &! =a@P$!``X @$!`@}&    "a?㿘! ,  1 < 2?!=@  $ ,   <W & <b@+ ?㿘! 0  1 @ 2? @  $ 0   @W & @b@+ ?㿘! 4  1 D 2?!=@ؒ  $ 4   DW & Dc@+ ?㿘! 8  1 H 2?!=@  $ 8   HW & HcP@+d ?㿘 ,` >1W!=@ ,* @ "!`$! $2 !`28 `2'1W3  $  @e  $`$ $ @a (@    & W& $@q `21W#2& $  @S`  &㿘 0`J >1W @' 0* @ "!`$! $2 !`28 `2'1W3  (  @  (`$ ( @  (@0   & W& $@q `21W#2& $  @S  &㿘@H "[?N V`4   &N?@$!=4* @ #  @S  # 7?! $`$  @ `$`$`$  @$̔!=@ (4, "@  @ ?` &@ @R @  $` $ $&@ $?㿘@ "[?N V`8   &N?@$ 8* @ #  @R  # 7?! $`(  @Ő `(`$`(  @$k @D (8, "@  @ ?` &@ @RQ @  $` $ $&@ $?㿘@㿘Wc@Rm   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@i ? !?#p#` @Đ`" $ `$ 4 Wc,@Q`0@㿘lWc@)M ? 2 WL 2WN   Wc@)8 ?㿘 H   @   4!  H H@ X@)`? H,  x @"&,X `(,@ N,  X`H@) ?㿘`K X`h@CJ   ?㿘 L h! x   :` @ '  & `  @ !  & ` @   6` @   $& ` @   (& `$ @   "6 `* @   ,& `0 @   @&  H 8&  0& `A@ ^ : `;@  ` &L < (  @ &,., Y ?  W㿘@ Hc@  ư?``x   :`,& ",    A4  #`H  A @ U  `X`p A @   !ǒ @   ~#`   @   t`   @   k`    @   b`$   @   Y`(   @   P`"   $@   G`,   *@ x  >`8   0@ o  5 ; @ g  - L  `  ``X`     2 ,, 6 `X`@'  ? X`@'  㿘`m Xa@A   ?㿘`m Xa @A   ?㿘  @a"b(㿘 "(` n Ӓ n #`x  :` @  `& ` @  ` 6` @  `$& ` @  `(& `. @  `@& `8& `0& `6 @  `H:`& @  `"6 `> @  `F @  !?# @ `*  * `& `N @ o `V @ j  @ `*  , `,& `f @ \ `&`^ @ V  ??& 8 n ` "  .< (  @   @  b  `:&,.,    @  b  ` ?  |㿘  @"b((?@,? #?` ``,& "(`!’ @ '  `   ! @     @   ` "(`x  (x% #x#`H   `  b `x ;@ 6 @ q  `XÒa(,   ;x   ;@ 6 @ Ԗ  %   @ ʖ      @   $   @   (   @   8   .@   "   &@   v `  >@   l'? @ `2 @ F @   _, `  N@ |  U V  2  @ p  I ^ @ h  A n     n  $ Z  X"aP    # 2! ,, & , $  8 6 Xax@%  ? Xa@%  ` (:`((!Dž0: 2`(0 ? h   h?㿘ڒ   !h! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``*#`8`@`0& `B&&] :` ] 3` < @ (@ `H   &,.,   `  b`x ;S   @  b , ` ?  &x?c@ؔ !D?  ?  ,& ؀ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) Xa, x; ;  , ; *  ` **   : .`.`.`.` )x   :(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8: ::*` @ `*  * (`(`(`J(`<  *` @ (` ?(`         X"b    $ 2" ,z,   , "   6  Xb(@#)  ? XbP@#   `axaaaaaaaa㿘%   c*`.@zx4` 6*@M !?!  ` ( $ @m  X@#  ?&@zQ4 & 㿘`@ @l     X @"  ",`  ( $ @  aЀ  ``  36 Ѐ  @  쀢` ` 08  @U 8, @~֒    X @" ?<   @B Xb@"s ?㿘`    @+  8 @~  !䀢`  2    Xc@"?   8@~{ >%  !䀢`2Q @@`@ Xc@@" @?<   @Ӑ %   @Ð % +   Xh@", "?@"$ ?#   ` @k` X  @, aȰ 8  c   ` Z#L*` € X @! +? "4X@JD# , "$`, @{E#?" ,@} < ( ,2`@ǐ 2' &,*  2`@P,2`@X cؐ, @q Y`@!q ?$ !   @ `` !Ȁ` Y $ ( @Ґ Y8@!w ? ",`` $( @W ( @) `t aЀ  !В  36 !Ѐ  @[%`J) "4Y@I P B@\  *!А@}G   Y X@!# *`2`@60  c@1a!Ѐ  6@ @ )   쀢  `  @k @  쀢 2 `"  08 @u  8@| ! !䀢`2&?<  @` 6 `   Y x@H     Y@  ?8L /? " /",` @i@Œ  6,@| 2 , c@a$@' , @H / ,@| @|!  ,?8 " Т%$ 3`쀢  ``А@|w  `쀢 $` ` ` $  Y @ F`@    YЖ@ : 㿘@ 6  "43 Y@H! `  Y !̀` `@ 2 ?Y`@  ?㿘@ 6  "43 Y@Ha! `  Y !̀` `@] 2 ?Y`@ ?㿘o@!   Y0@ݐ 㿘\H% -Y+Y 2 '&"&`"& N  @ `@ L@ "`@ 2'<   @   P@{a`@ ?2&㿘??@i     Yx@z 0`@T    Y`@l 㿘@ @?&@ !܀`  0   8  ?c8  `  &a  X @8 :D  ? @  @?@y  #`H `   `Ya?#@y.  `8` Y   `Ya@Ґ ?  @~ۖ  ` Y @ ? & rr,rrHrqr`rrr|r|rr㿘 "$   "al  "l "0`l "l " `l @"l!(`@,  "apYb@ ?@   ?!܀` @k? 6 㿘 YN b8@  YbX@] ?@?`$N /". a($$  $ $ a, " "a,"!,"a( 㿘!0` "` "`  "ax !쀢` ` !4a$ @U 㿘 !܀` @!( )Y' #%Y  4   2 `2 @" x@bB 2 㿘!$ -@$a$1 + % #)Y'Y(`! !p,@#Ȁ #!p@F 2/*. !0 "$!0 $!0+?!0` "@ @Nb !0 "@ ?@y@ (!0  @԰?0 ! %ap !l @!p $a$ 㿐 ax %"ax  %#@$  $a4 а? 8?` 5 ܓ*` € !܀`a4 @ @ a4 `"0a4Y b@_ 0a4Y  a4Y 8@} 0a4Y X ., a4x   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X ;`X< "9("140NOa4a4K -0 H?a47:a4 !ܒ 2&  8 0@ (a4$ " @ & : & , @vk, 6 ,a4  Yp@ 09&,  & a4 @E,a4&` & 0 !̀` @Ӓ?`& * & @@|Ɛ0 `@  "2  ` ;!@@YY##@2n` @* @ /`  `i `  #h #`#dYc#\ @` ` ? ?` 2  Y `c@`Y`0c@`@q`&@  * &@& @\ ?` Y@S#, @O  2 Y@G#, @C?`& * & @@|6@ "  8;a @DӐ 4YY##%8@1ܐ@*/ @ "/  @ԒY#@ 㿐@}V` N N N @vl@ N 2N0@   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0*2   0*2    0* :* ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? 㿘 !|  "`|`4`I?"|J@ -   a *a "b J!`@sr3| . :  "|"|'?@Bʒ  :2J @ #Z!x` :2.  Ⰰ  #@Z!x`@^  ?*@$|"ⰱ. > \PPPPPPPPPP$P0@`x(<\|,DXld,t|Pd 4L\h\\$4@P\xĝ㿘@@H / `""4`@$"4Z"4@A @ Z@0"4@A X Z@F0 h$"4@P  5ZO-`8J"*` €E# `|@! $!`=`|Z`@3 @5  "a/  "a*  | "a$  "b    "a@  "a  "b `|@r  0  |-* : `"`*` €"    " ","# "    "b,   "aZL`@א @' L  ӤѤ @`| ɤ  "!ä   ""    "! @!  |" ' Đ @t H "` |Z`@  # Z @ax 'Z+Z@!x@\Ӓ  `H!x@a0PZ! "a! @4 | :  |  aZa @i @a a Za8 @]"@]  "!W ! Z | @@Ԑ!` ?J"c@ | D"cZah@; 0 @ `| 7  ""01    ""$+  @""$&  @ x`|  @ `|   ""    "!    "! @O@pٔp??B   #sې! "` !%qȐ   @@  !  @  ! " % @@@ 䀢 `#"`䀢`A"L*` €! ! "7" *@@ "@" $"0& "@Za@ @?. @ "b"" *@ "@" $""#܁㿐 " '    )7Z;`J#*` €# `|@! ` $!`|Z`@P @!* $! % "#  `|J@ -2 |J` | "! ' "!'}" Z@! w @s    "b,m"  i"b f%  @`| a@]Z%  a̐ U"a  Q"b  " L% Z0!  | D"a  @"b0@W-`   Z @a@U  `| ,"?'"?  #"b$!'   "b Z"  "aZ"0Z "@Z "PZ"`Z"pZ" "a@eḀ?I?  *`@ &  䀢 2 # #!x #! '` ?   䀤?@  ?  #@ "`# "`Zb@y @* 䀢   y  - ;Z9Z7ZT5Z` 7Z@>؀ )Z # Ȑ@b࢒ !  "@P@ ! @Ò  @@n "@>ǐ !@R"! ! @2@@@>( 2 @`@ )`% `@` 6 @@ Z@@>Ѐ  `@ 2` "!! p+  k+@h` D u  !Z@!Z@>b"؀  # Zb@ ! Zb @ǔ@x ! T @o@ "@>> !@Q! (Zc@ @Y!Z@@>)c( 2@`@ ".%cܲ`(  @C  ` @9@ Z@@=bЀ  `@ %c ! ! "ZJ Z@ZP#0 $!J Z"0$!8Z#8%Z+ @J@L `?,@. ` @xb! @@- ?<  @ @K  ?` /,`ϐ P   !   ? #,$! ""a#a"#!     /Z9 `D ē*` €  "a"h&!  "a %`  "a &" "`%` %`  "b  #! "`%`&  "aZw! ~%` z"a @p`| t"a! Z |@eb࢒  % Z |b@ @`% @ @Ő @P~`V |Zc@ @KO `|J - J  |B% |?%!  |" ' Đ @p{ H /"` |Zcp@e  # Z#@ax %Z)Z@x@X  `Hx@{!@  "b$Z"   "a" "`@@mH?@?"`* `G@ *` €@ ? @` 6@@@ 2@01@   Za@ @@ "b `@@ @"#% ! # @" Ȁ   Zc@ @@㿘 "4! #Zc@X(!x  !J 6 Zc@X!x@ym 2@ !x`?"`!x * $!x@ 㿘@@0,@` @@L  @,@L  $]`x@{ $ OP OP   #]!x`@R OP]!x`@ROP  @6& 㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @/:&* &p 0`㿘] @eq    "b  ] @" e!]@R ]L@ ]!@r '  % J?`/"?@   $]a@ Ґ A @o/ " /* "G@N &+@ d % 䀢`#*` €. !`]a8@ߜ ْ =\㿘   "à "]aX@  0]a@ ~ @y !܀`@@x h @Ò   ?@Ě @   ?@ď @   ?@Ą @ 2]?@y ]@R2!    "@    ?؄ؔ"!ؠ  '''@"   Ȁ    @ Z  @  Ȁ    @ H  @  Ȁ    @ 6  @  Ȁ    @ $  @ڔ  Ȁ    @ϔ   'ؐ @Ɣ @      ]@  ?l4㿘!H`@s 2 !L`@ې 2  !@`" @   㿘 "S?N #aH   !=@yȒ  $aH]8aN # \N  #" @ 2 ]b @ c ,?  @ߔ @١!=@oaH, @ " 2@y  aH]b@@ ? ?, "  "" 㿘 $!=@o[aH* `"  @ 2` `2@ 㿘 "S?N #aL   !=@yV  $aL]8bhN # \N  #" @  2 ]b@  ,?  @m @ѳ!=@oaL, @ " 2@  aL]b@ ͐ ?, "  "" 㿘 (!=@naL* `"  @ 2` `2@ 㿘  N ]b@l / "N,@`N &] ?А , *: * :  .2c 2c @ t ]J 2 @㞐  `]c0 L@ 2$  *$ L@ & @]*:  M"  c C"  L@ m2 L@   $   $ c`@ ; S]`L@  @@4  N$`$ @ 6 ] c $ (L $@~  6  ] c@ @c$]  $  @ ]cȔ@  @Q?a@ $ "!D"a@  aD " "aDc@  ?@`A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@ @2ݒ . "$@, @o' 2a?L?Г* @L *`В@ `=$@T?@o?`8N? *` €N?Г* @N *`А@ D$` d$` N?Г* @N *`А@ $`?$` N?Г* @N *`В@`$`  N?Г* @N *`В@`$` N?Г* @N *`В@ `;$`@#&@?? 㿘1! 2 )@wk  &! ^`(@  ?㿘!`m%`"`b )@m+a-  5      @ 2  @ 2  ,@2,, ` &,  &  ? $  $@@$ @  ^@2  $``$  `"$  - a $ @ $  "@ @^`X@  ?㿘!! 8#`"`3` / - +`@l)!*  "  2  `   @ 2  @ 2   #@@Ố㿘a   ጑*@  "@`@@ᤐ`2ጁ㿘1! 1A !G@v  &!^`x@ 2 5?^ " 1 * * * * * * * * * * * * * * @N" "a"@ 0   ^"@ ) ?㳐!`  1@CGᐑ- @`;+ -^@2&``!!  @h ` ` !`@ [?@AE@# ```2@`  8`  ?$`= @ݐ  .!!  @h  <`!@¥  8- ᐰ $`$@ $`"  ^  ^0@  `  ^^aP@w `?@ɐ?㿘1! 2 "@u  &! ^ax@] ?㿘!`^a@P I @"a, @`0` `@@0Ő 2```@0 + @`@0 &`^a@W ^@0 &@@0  &`a,   &` " @e@@c^b@ ?㿘!! @@S"!* @ @0| 2  @0>&@ 2㿘1! 2 !=@u'  &! ^b(@Ӑ ?㿘` @  ? 㿘!`-!=@ja, @` `2` " @Ր  a, ""  "" ^bX@  㿘! ` }  @ 2  " *     +2$`& `W& `R   B`25"5@߂ 9^"" "$ 5  &z   @!q  ^bx  &a ^@W  a"" "$  &   &^bx @ ^b@   㿘1! 2 !=@tM  &! ^b@ ?㿘a   *@       2<㿘!`6!=@i,`@     2  2  @  ^@/|  $,`$ $ $ $  $ " @^c(@ 㿘!! &!=@iÐ!*      "  2  2     "@ & &@@̐0?㿘!!?2 ^ " 1 * * * * * * * * * * * * * * @KL"  $!"^c`@@ ?"@ x! /  @f?  ?^c@' 0"`' !7'' @#'؀ ^!@ ^ a "acД@ pa R  9' @r >ؖ ! @e 6! @cЀ .ؖ ! @e & !Ѐ`쀢  쀢` `倖 ሀ !??@e˖  !@qM!ሐ? $!_`@ 㿐`@  @6` `   *  `'  * @hlP 8PPl8888888888888888888888888888888888888888888888888ߠ8l`llĝ㿘 ֹ$ $  J" ?`   " @ 2(* * * *( ( 0(2    0( :( ?   @  2*( ( ( (* * + 3` ` 03 *   0*:* ?  !    㿘a$?N _`H!@ʔ    跔 Ւ"? ?㿘- )_'_+_/_$%_@, !_ @,ޒ`   `h@M   ``?  @@  ? % ۢ P 㿘" !?  &   "6 & @,r,&`d `  / 6`l Y  $& `t S  (&  `|蹒  H :  F` @&     ; 8& 0&  x:N` `1`2,``5"'.,   & `,@,.,  (  &  6`,@,",  @ 69&,@  & 6 6., .&,., &,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& 㾐 ` -!ԓ*` € !`$%°  _` _a  _aH _ah, d_, a%   c_ a !@q  d@+ x :?, /,  2  1,, @+v d l   c!H ,l=  _VaȐ" @  b a:!   `d < $  `l 3 (  `tޖ * 8  `Ֆ  !!>` ˖   !  V  ?       _a@  㿘 ?.  ?㿘 ?  ?㿘a$?N _`H!@ܔ  2?  Ȕ "? ?㿘ߒ"  ?# `"6  `& `& &NaY   aY@*, /,  , @*"&`d 搔  /` 6 `|  `H :  悐``@& `8& `0& `(.aHa) 6`$`t p &`$.a(a v ``l c &``x  ;@ :`,& ., &,N``7m!*` €  @ 6 x&     "  &6  6 L /2g &c,N` 4 `  ` `  ` & 6 aI   aQ ?c , *`  ,:&N` 2 `  (` &  6 `   `"` &  6 6 `, @),&,`H@`  a"@   b  6` `x& ` a: : 㽠`  `_b    , c_, b8 @ _bX !@o'x    :,Y@)  /, @) d ?` E*`" € 53,` ` 4 3,` , ` aI"  ? @ `2 @aQ     6,` ` 1 2,`,  d@)[` `|   %_ `  0 7,`! H @" a  b  x ;@`|    _bbx_`H @a_b @a!   `dĖ  J $`l   A (`t   8 8  `  2/L  @a ՝  @a)!`   ђ!    ?       _b@{  `c`  H /" J J/2 J" `4 ` 㿘_"@W  _@Db!  $"0_b@D  "b4@<&"0@kҐ " `_ bb@0 ?㿘!"0'H'L'P'T'X H@H@`I"0㿘` "4@% 2. ?@(Q 2* 㿘'L'P'T'X L  "a !̀` ! #1 ! @``!x@ &! "4!x_c@D)@G̐@ 㿘'P'T'X P  "a !̀` 1 #! ! @_`!x@ $! "4!x_c@C@G` !_#@@C@j 㿘@[t\t ,Ll|Td L \ l |         ( 8 H X  p p $ p  p p @ P t     , < L \  //'  @W   /'"`L_c@0 @{Դ @t-# @{% @+b Ȓ'T'`'d'h'l'p'X/ 9''\'t'x'| 3* P@€`| @[  "P_`|c@@Z  $/$ @$@{  !_#h@ߐ @Zʐ  #`$ @ʒ _`|@ @`| 2 _`|cp@Z  / -  -  - "$`|@S `☁ =b`b `_`|c@Z " b@{A  b!_#@ @Z `b)=b $X/ {%X@{% " `|!_#h@x @Zc  @є i__`|c@ZX  _$`|@4$X_ S$ O$ K$`| @ `"_`|c@Z2 ?#@9_``|`@Z(  $`|@  )'``|` @Z  $`|@ /``|`8@Z  !$`| @s   "``|`h@Y @e_@Vc ?? b* & @ @Tb`D #cc""  8’    H`D" @l:@  *8-`@  "@ 2 ``@Y -` @_) @&! #`  ``@Y "`  "T` @' ``@Ϥ   @ ,`@@?c  ##c`< 8  X %X (" ( L +`( *" "" @  ``@j  @?Lc @W  ?Lc @W  <` 8 X %X$ d $ d``@Y- $L  @W  #<* @ *@@  "cc, `4 4 4  `, $ , $  <` 8  `a@X   '///L T @WP ( 6X`@#!P@hn X L ` @W?  X`ah@ X L d @W/  X`a@ِ X L  @W   `a@ɐ  'L!?#h#l@C` `a@θ @1?L#p`@V  1?`a@Χ ! #`# < '# a@Μ L# # @V  # ?@4 ``@ܔ `  ` `'@HX`bPb@Q  `p@I’`@i #@i @i @2 2L@b L 2 * @ԅ  ``@K |#'  @ ''@jL 2 * +  &   @q'  'L \@St  x  `@"b'@C \@ݐ @;   P` $ @S@5 @gm 㿘  @8c@i  `P  H@    c @V7 $ $`  @M) `" "’`@h @^$㿘!   @ƒ $ ?c+b -- " H  5 `5 "H, 4 5 # c@L: @L   @*@ T*  ,@!?#@ @[@#$@@" @b* * * * * * * *" @\ `  5  # 5 @O5  `L  8 @h   `@!ސ" `?`@B@_ڐ@F   b @= x @Z `*`@   a !`'"@@h0&@  #@  $ `T   V"$  / / / / / / //?" "@ ''Вb@ ??*`" * "* * :@B:@Nc # #B;c(8# #1 @":1" #@K: L@K <      $`?" ' $@K֐: "@KҐ   *@ ,   `j`b @ y!`'@9# @D`@@#@`T`!`#H #@K  @M># @+ ``@&#`"  `E` @ b@#hb  7)`#`  2 @# @cb  &  ޒ`  a  *  @&@M !`@#@ې@N + )`  "a   a `E "`a @#Ƞ   ` '`#`' # ` ?"` * " @     *   @ *   *  @@5@c`Ӥz    n b8 'b@@g '   'a@_  S%'b@$b8@Za$b8a@M  '`#``'3 # ` ?"` * " @P     *   @ *   *  @%@ͬ@cऄԲ`@ @#  `@ "  5    # a `?"`!  * $! @  @YD! `  ` `? (?888* 2 ?cx?`*  # a `?"``!  * $! @А @Y !   a`8@ !?  a@@??@?)  Ha`@?? ?@ `$ a@?@ `   a@?r@ H"`$ $ "a@?b?*` *  !a  @ar* @?R?? @|??c?@"@a@m``$k!?  T`"g : @I @I @L/@ @Vd)?? +a` #@I  @K#  #@I|  #@K #\ #@In#` #@J#d #@Ib#h #@J#l@>֐?c@@@!?@\@ 㿘     (   @I3@B: 2   B* 2`@ : b`D 8 怢`  㿘 @d  ƒ   $ @`? $ @c*`?㿐`ޓ*`"` €a@!@0 `Oa" *` €a@r!P0a@n!p0a@j!0a@f!0 `a@_!0a@["0a@W"0a@S"00a@O"H0a@K"X0a@G"p0a@C"0{a@?"0wa@;"0sa@7#0oa@3#80ka@/#X0gd#pa@)#0a  " ab"ab@# a@# a@ #  @# @  !b' @@@01b@ P0Mb@ `b  @ 0Db@ 0@  b!b@ڐ 0b@֐ 0  bb @͐!(0 !h@@ 0b@!0b@!0b@!0b@!0b@!0 b @"0b@"(㿐b ` *`@"@b 2` 2`  @" 8 b?* 2` @" b " @) # !b'"@m@z @f'@s` !b @k"ؒ`! `?"`!  * %! @p 㿐  ` ' @  2!_'#h@3# bh@=:!bh!b"'@%# bh@=+!bh㿘 * `  * b*`@ @"0`   * b*`@ @#(N@ ĠȢ̂ЈԖؘܚ "b  `D`H@Q H 2#l;pb#\#`#d#h;x;#cx@ ?#" 8  @ @ `. @ (   `b@# @ a#b@bز`@&a@ < @2 2 2`((   ``? 㿘 #bc@9!x@a 㿘@$4DP\l㿘c`P@v /% # ) ! + - 1 #'c5 -9 8"* h@€ $x!$`| % t$ d $`| %` %h$ d! @G   $ d!c #!x@9``@` @N X?А?x* `@ t `|  ` h  d @0@_@1 ! c`@ @` l㿘 #c ` Ȳ "p+c)c'c%  ` @`Ȁ   @ @ $l   %p@ @0 2㿘   % #$`   `` 2    |`  x``  c`@9  `@2 ` `   t` ` $?"``  $* $ @ $Ò `+   h` ` ^?"``  ^* $ @s ^ ` I?"`` I  I{* d`f`/ ` M?"``  M* $ @I Mz ` -?"``  -* $ @3 -"e ` "c ` ` / ` ^?"``  ^* $ @ ^E` ?`@ `? "`` *:    *  `? "`` ,`:    `* $ @"  ? & @3  &  @   pc@    "l 6   `@c`@ǐ 㿘 # cR  ` "p+c)c'  ` @9   @K  @$l T` %p@T` @_- 28 #Ra.  ``)+ @M̒   pc`@{ d*$ @˨%`\ % `c`@n %c `@@r 6@b @ `@`\ 4    pc@{   "`l㿘@H   @J`e@`@°? eE @@` e < @@` e@@` e  ,"#@@` e@@` e  "# @@` !   ?"c `@@!@I ?@!@C ?` 7) 5 Ь; dcd "!x@ " !x@c@ 2`$$!x?`!x" ` * &܀ $ @ @K@^7  "@  @= @^) ?"p@"t  @^ Y) 5e/ec!h`"@&@ 2  2  at " $ e  `@Nt 4  +? @ ` @Na ?`@` "``@NN ?`@ !p %!p? `@T܀   ea @ 8 ܀    >a7  8a@/3   - !ڒ  @S  @Sa|   !ڒ  @Sw  @Ssa|  @LW "   e@*a(  @? aЀ  `@F a|`@U`  ` 1e  e@a@Ԁ  ` @) a|` @U` e@aP@]A 㿘#c耢?! @]Y!| @ڔ $!|?$c$c㿘c !| !0ea`@ç !@U\ 6V e@Ɛ!h!? "aa|!@UN 6 e@ø!x "! "!a|0a~@U> 6  "" "" 㿐@   ea@p `  ! `@   2q@`@ - ` `     @_!  `"""$ $ $ $ $ $ $ ` @`  @R @` ` ` &C@` @ < " ` `@ 25@` ` `!x`"*@!x  d` T   @ ` cd cd` T   2 $ @  $ 2` ` ` " @` @j􀤠  #e !xa@5-@\W 㿘  t !`"t"# "! !x8  2`X   x????R ''@ " !e@eǠ!@L  @  !e@e!@L  ` ` " ea@L !e`!b@Lx  "@^ߐ a @Ґ@Q@Q a| @T(aJ e@“"(@p@n㿘 a|  aI@T e@€"8㿘 !x` € 㿘 !x` € 㿘@ v    """cԁ㿘 !t`! !  `6$! !x` ` @Q `$!  "!" "!Ё㿘e@"H㿘  !x at #atx "@SƔ  a| 0a@S eah@  a @:W `"! @@"  7|a@S eb@ϐ `   d dd d㿘d"8@ 㿘d"0@㿐@ @) @ eb@K !xR`deb@K b0@ d !@" p " h@ b8  !@" t" l㿐 !xR`  eb@K^  !ɐ X`@]˔  eb@KQ @l ea@Y ) '?%?   `2 @Ԓ! 2 ` 2` 2 eb@K) $` @$` 㿐 " a' @|@ `$ J@ " ec@K a| @R̒a e@7#(㿐 " a' @V@ `$ J@ " ec8@J a| @Ra e@#H㿘N 0     H*`@ R` x`?`2 ) "[' #@ ` D  e   `D` e#X@[  `e#pe@#N %#  ` "* H*@R`*#  `H*@R` +@ N \2 `" N @Ȑ 2 ,  N` ``@ ` $ 6&"@\ &㿘 `  0   `H*  R `x" "# J`  `2    J `2 2e 2e 2ee##@0@#  #e@c &h '̠̐В    ! "/Вa @L a|0$ @Qa怢 e@#ȁ 'Ԁ''] e#@ e'Ԑ!'Д?"? 6"H #@   "а !' "# ` ( N  :$ *: ?'԰  )e| ܲ'|# 9|`$$? `` e@#0*'| | !|''آ ` ܑ,`@""@``` a @ɐ a| @Q)a耢?f@ 㿀 a @# a|0a@Q?a|f@ (0  'a@Q ?f@t 8㿀 a @# a|0a@P?f@` (0@'a| a@P?f@R 8 """ $  a $ $ $ $ $ $ @h a| 0a@Pǔ 2 # #a f@0 H ?`$ a  * $a @   ???????a @9!|0a@P   # fa @ P @  " " `? !|0a@Pz?f@`Ր Xl      , `"    "c  `   :"    e#@P   f@_ h /e  ` ,?"`` * $ @` ,@`@ꔒ    ݢ` `?"`  * $ @A   ???a @!|0a@O f #a @f p`f@  0f@`J p !p`#   ????? a @n a|0 @OΒa6    `f`@   "## f `@G 㿘 !p` !# c ` * ! "$c a @: ca|$ 0a5@O f`@ڐ 㿘 !p  f`@G % fa@G  `4`@,`$㿘 !p  fa0@G  fa`@G c@  "a㿘p !p  fa@G  fa@G} c@r  "`㿘V !p  fa@Gi ' fb @Gc ?# @ ` `@*`fbH@GR *` $、fd` @2```2@h!0f`"h  @2` 2```2@h!@㿘f"@<? !h!XƐ@G  㿘@ߐ  hax@ #e#t@2 ?!h!@F # @ @Ac g@F㿘  "?` 2   @ 2   2?㿘`  !h!o@h!h!h!t@gct  16 %? #h-h+h)e`2  @ @ 2 ` ᨐaȒa@jᨀ`#a@c  @@    26 `h@U!؁xh!// "@Xː a @ a|0@NaK , @b !#\! @Z `h! @L!#\ @Z h!@p  ha@" hh"@Ô !Ȁ`h@#P "`h@#` # a `?"`  * $ @ `` `  !h` #p@H@@А@ a'   ????? @:|#0 a6@M  h#@+퀦 @*  |hc@ΐ a6@M' 6hhc@Ð @#  @; `?"``  * $ @痐  `?"``  (* $ @煐 (   `?"``  )* $ @o ) `?"`  * $ @a 耊 U- h@B#h @ 7   'h )*"hhh @2 @2 aИ  ` ` @  *@`2і  h@#ؒ `?"`  * $ @   )   @ ` -h+h)i  2@ڐ @אc + @ѐ `@ `$ݲ @D  !x d @ 0#d`#d "  ,` € $ 2 W 㿀  a|     `+ea`@ #  "a @!i  ''''@l'@y @!|0a%@LP    `1i@ $$ $$a(" '  a . # $b,b,$ 0!|$ $ a"@L)? 6  `12i$b,$ $ $ @ (a @`!i 8'@@,( i@' @`0# $b,b,$ 0!|$ $ a#@K? 6  `1i$b,$ $ $ @V Pa@{     #'!i `@@ # `?"`  * " @ 㿘 !x`€  "c`??` *` "`*` p#  a|     `+Kea`@    ! #\ ! @X ha@!i@ p a؀ I)  ! @V! @  0H a"' ' ' ' $' (|''@K^   `1" i@Ð   ?  ?//?' !#\! @WϚ ha@Д!i @R ! @UА! @Đ 0H a%' ' ' ' $' (|''@K  !i  `1 i@}     @@$ ! @U! @ 0H aI' ' ' ' $' (|''@J    `1#i@O  ` i@ 耊 i@ 耊 i@!耊 i@!耊 i@! `i!0@ڒ#䀢`b ! @UT! @H (0H ' aQ' ' ' ' $|'@J' 6   `1"@ii@!@;i 耢 "4i@ i@!X`@i!h@v"@i!p@ii@!xi@!`@i!h@_"@i!p@zii@u!xi@r 㿘  㿈Ő  a|     `+ea`@   """ a $ $ $ $ $ $ $ @Ð|0a!@J$ 6"  1 /2 i ] $ " " " @!" @  ?? ` `i ! @  a # |0a"@I 6"  `1i& $ $ $ @T ("@y  "i !@ a   ", i !@  # `?"`  * " @ 㿈5  a|     `+ea`@   """ a $ $ $ $ $ $ $ @3|0a!@I b  1 /2 i c $ " " " @!b !@` 7 !i7 !7 7 7 @{S7@ a .|0a"@I] b  `12i$`& & & @ (b! @   !i7  87 7 7 7 @{"7@U # `?"`  * " @^ 㿘#"#  !|`    `+ea`@Y """ """ """" a@c   2!Xy  a|     `+ea`@6   """ a $ $ $ $ $ $ $ @ w|0a!@Hؔ b  1 /2 i  $ " " " @4!b !@ Y` / !i/ !/ / / / / / / / / @{,/@ a :|0a"@H b  `12i$`& & & @ (b! @   !i/  8/ / / / / / / / / / @z/@ 'da '' da'd'̐ ''dai !7'ܔ''''` # # " ``` "`@2```i@L"a `?"`a  * $a @V h  a|     `+ea`@T    Ȫ a?????? @ !|0 a!@G   1 /2 i g????@T"  a@ z!i"0@I@!|0 a%@GӔ 6!i  `1 i  ??? ?@2"@  "X@H@ڐ !`"!|0 a"@G a  `12 i  ????@"ha @ 6!i 8@HŐ@ # `?"`  * " @ᾐ 㿐#.`  `, ,  @ @ @E 0@E   #@ @F$ ib@? 㿘#.`  @   ib@?x `, ,     @QՔ 0$  * "@  * *㿘  N  i.`i"@12i, "@*2r # a `?"``a  <* &a @, * &a @ϐ >p#.`  ?ؐ ??? 'i'ap@Ԁ  !i@Wؠ"@> ` "`ib@>  @D ? @?@       $ 4 @ԁ㿘#.`  @  ib@>x `, ,    @PՔ 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  㿐  !*!ꀦ`,`ib@> ibȐ@Ԗ i` ?#@  (`ibД@=  4`,`㿐 {77ib@  i@  ib@=А !2 2 㿘ic@ ` i  *aԒc@ V i  *aԒc @= 㿘# aԀ aԐ ,a  2  4 4  i #8  @ a   8i  ic`@= a6  6  6 㿈 .`   ,, #@@| 耦`4 4 4 4 4 4 i@M#㿈 .`   , ,#@@~ , 逦`, , , , , , , , , , , 4 i@#㿘.` , @E֐ @B `  ,,  , ,㿘@ "c㿘@ސ "cic@=  !x jR  `@<  * 㿘! , ,  㿘 #j`0@%:!x@Ld 㿀 @佐 a| 0a: @D"?` j"j#@ 㿀@䇐,2  "<"@@䐒  "# a|0& a:@Dl?a|jc @  7a9@D`?jc0@ 㿀 @`jc@@< @f  "% |0a:$`@DB?jc @  @Ґ`>|7 a9@D0?jc0@r 㿀@>  "% |0a:$`@D? jc @[ @,| a9@D 7?jc0@M 㿘!  j@'!㿘@Ŕ㿘 D@`D㿘 D@`D㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ ` 4   ? `  ?㿘`@ @ ` 4?    ` ? 㿘`@ @ (`( 4   ? ,`,  ?|㿘`@ @ (`( 4?    ,`, ? i㿘`@ @00@4 2  @44@( @ `@00@4? 44@?>㿘`@ @00@4?2  @44@( @?`@00@4  44@ lnnnnnnnnnnnnnnnmnlnnmnnnnnmnnnnnmnPnlnnnnnnnnnnnnmnmlmnmnnmnmmm mTnn n0n@n\n|m|nnm8㿀'H@@9  !'j@## @"a(`h @B  `"!(   """d9   "b@ - @[}    "bH' # ) 7 1 / 3 ; +'~% Gyڑ* @€ '"@%"0$b %%"0'"@$j$b $b&x%"0'"@$b% %"0$%\'"@ $%"0'"@$bU% &x$b'"@O% &"4K%` %`G&"4  C"b| ?@  =&bD   8"H  "<3&bD  /"bt  +"$ 'bh&'  ""b  "P  "d  "bX %a,  "L   "p %a,  "b8@&jH@7#㘀?~? "H*b'H`&  b b L b |  b bP ba, " b    <  b8 | "  b8 2 b  L  bh@bhbh &!: 'bh bX $a,   "@>  "@: 42` ,`8"4 &#p   "@  "@ bd`  "4 `ِ $$"@ ∀ 0b ސb " "0  "b ߐP " H@  !4@  @Hbl㿘 "t` ޔ!@Tv   @l @V@k  "<`d "D` `  @L5  ":j  "N`D0B6 "5`0= . ! V`6  "H`3"( j`@#  j`@# $"(@Vl@)D  @VT 0#@j`D0 `!j@#`D@a  "bl@U 2`8 jc@ 'H'D`H  "` 'h "`  "L`H 'hH''' ''|'x't'p  'l8 D@͠Dj@ $  ""l 2 LD2( "<`2($ .2 ( "H`2( $  8'h  @`8`< (``<` 8'`  8'`08 `0 `4 `0 "` v' "x`k `   @#Ek ` @#>  ` @Ȓ `@ @@p4'p@@t 4't b  @@`DM k @@ېx@ 4'x    @g    @.  @R$   @L$ `<   '| `  $ @6M`-"$@_$l 'l2-8l`L'h'H 0'|#k''̢` @"@@'t x''@"@@u' @"@@m'k @"@@cp? " @ "   "b(H@ 㿘`8"2 @ 8`+ `  ` #   ? ^  R`6   "<`2  `   ?"$ €㿘q㿘  "  @  # ` ?"` * " @F   2 xR 6`" "`  "L`  bh!k  @H@ +k)<7k9k3k5k-k/k " "`@ 0@` "L` h ; `8 @ 8@,_C @ߐ`8`@@  @` #\ $ , @#` b `X @ `  "`2  `? 2 `@`    (`0"@ p@  (`8@`0 "`` @<`0 "4`@5`(0@2` @gD b|   "P` `  2`@``(   #@ # ` ?"` * " @؂ 2h 㿘 "`    "L`   "|`2 "P`!(`*  @CW&@@CS 㿐͒ # a|@! ",@*` @o Ր0| &,$a|   ,.`"@`2 @C@+o 2R 6` "`  "L`  bh!k @G@ B7 ) #    #!  `?`$``@ ! * %! @ . .. pppBgroupc Cspwd.dbD protocolsEservices$Fdisktab.shadowXG disktabH fstabI resolv.confJH hostsA ...wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: crontab:*:66: www:*:67: network:*:69: named:*:70: proxy:*:71: authpf:*:72: dialer:*:117: nogroup:*:32766: nobody:*:32767: ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs  (=   @=׍{Y( @@=@@<@`dT U=@@500 (0pLl DA=$s=% =% ^$?C=.}=.}=.} =#*=$[܀=$[܀ V*=&6=)'=)'08@HPPO)=+=,=, =-D=.}=.} Cg%E =W=9=9($|T9u=4΀=4΀=4΀/tmp/disktab.shadowf$= /= /= //tmp/fstab.shadow@>="="="/tmp/resolv.conf.shadowv =% =% =% /tmp/hostsS {+oDJ-|o/"P?z$u (07tLE&N*G!?^?#dLgMZѡZiNc-Ms iŃ^>w$`wיbF>< Q_2rb_= VfSNۡgזp $-U.>EBnlb@ޒ ,,  @ِ! ` ?"`! * %! @׽ Ĥ㿘 " `@k` 0@ "L` h!k?`8  ;` ; @@* 8 @{@ND b|  "P` <`  @`㿘'D@D# #a   L?`&  @  a * $a  @_  $  "p`  #!  L?`&  @  a * $a  @@  $ Ua D;!@  #!   L?`&  @  a * $a  @  $ 0a a `?"``a  * $a @  #!   L?`&  @  a * $a  @  $ a `?"``a  * $a @֐ 㿐V mR 6` "`  "L` bh!k  @F6  @  >' # 6􀥀 ` ? "` * $ @֗   ݬ􀥀   #!  `?`$``@  * $ @x 2  `?"`  * $ @b 㿘 "`    "L`   "|`2 `M% #` E > ` ,?"`` * $ @0 , `(a(  ` ?"` * $ @  ` ?"`` * $ @   L ``2`  `?"`  * $ @ 㿘<(@- # @@ I0L0@-8@8 I0D `?"``M / F / `?"``@ | 9 | `?"``3 @ , @ # `?"``% =  = # `?"`` %  % # `?"`` *  ** " @}  㷘V 6 2  k D@Q$  k D@G$@1#k `! ##k!x@a`@0, @0 @㿘N *% "# J `*bd  ?*:  #! `?"`` ! * #! @  N  㿘!k #`@e!x@B 㿘@㿘a @k"l`@` ! $!@@G@.@ c@*!Ȁ kk@(!k@(!k@(ސ!k@ܐ!@( A?@Ԑ! @( %kk@@ba( 2kk@(Đ!0k@@Xa8 %kk@(!H%k! )k# +  '@@HaP "ز`@@(`? @J@ - +J` k@*= k@*8 @*B@ѐ @X $"J k@!` $"J k!h$"@v!p $bhJ 2?k!$bh?  @@S`?@7  %bp@0  @L @Y0@  @R@  @ @%@ @6@4ѐ  0@  k!@+ @q @52! #p @h @#p @a @5 :xx ?x? @R  ""x"`@  @  @A 0@ @9 @@@3 㿘@.㿘@: @ @㿘@C. k!@+ @ JJ "  " 㿘  """ ɐ "b@T  bp !Ā`@=@@*@ @A#h! a܀?  k!@-  $aܐ $a܀ a@6? ̐b"b" " " " " " " " " $" (@.bX"j #`n"Y `2"P `Ix ɀ`KIs ɀ`"L `Ej ɀ`Ea,Fc  !@"O g"C d<T ɀi`<"@;K %"@"< #@3> 8!@1p"@03  .2 x+  ( &  # !                       2`x Ԑ ے ~ݐ ?'  ɚ #""''// bb (' ' ' ' ' ' ' ' ' $''aܔ@28 ?2$㿐 #8` !Ȁ`k'!@*_㿐a܀?  k!@,  $!ܐ $!ܔ! @8P`h  k ""@}" "k@D @$#" "bb !ܐ "b!`h@8-  k򀢠 ""@Z" "k@! @$" "bbȀ  P"bȁhЮk" '@$  1 ¢ `@l@8ܐ  ,@  ,@ @_@8ϐ  ,@ k"('@#  `@M@8  ,@  ,@ @@@8  ,@ k"0'@#Ò 3  `@-@8  ,@bВ@#@8  ,  k"8'@#  `@@8  ,@bА@@@8w` , `k"@'@#  bА@@@8d` ,@`k"H'@#w  bА@@@8R` ,@`k"P'@#e   `@В@8@  ,@ k"X'@#S   `@@8.  ,@ k"`@#A'̦  ` //Ҧђ@@8  ,  , @훐@8   , b //ђ/@판@7  bآ ,b؀   //@z@7 , b@@㷐k@2"h k"p@"0 4 kkx x/?k@"ِ"@)k@"Ґ" "bk@"͐" "bk@"Ȑ" "bk @"" "bk @"" ɀ "b"bb       #""b#b" "̀   "#$ ’k '@"" À`"! @ * zk@"" À "b8k""b8k@"" À "b<k""b< "! À`# !Ȁ`2 "@k@"y"$"@k"@"t$bD"@ bDk"$"@bD 2kk"$bDk@"a" à ""`kJ@ 2 kkߐ"k"$"k@"J#" À`""  kJ 2 kkŐ#k"$"k@"0#( à ""`kJ@ 2 kk#0k#@$"k@"#H è ""`kJ@  k" %""b "bk@"#P â""`2kk"$bk@!#X à""`2kk"$"k@!#` À"b 2kb"bk@!Ӑ#h À"b k""bk#p@!ƒ À" kb ""  "$@!#x À "b$k""b$k#@! À"( 2kb ""( ",@!#x À "b,k""b,k@!# À"b0 2kk""b0k@!y#  k#k@!y# À "b4J kk#"b4k#@!j`"k""J@ k"Ȑ  @! @Đ@63 @'kk@r "ak#@!?`"k""J@  k"" @! @뗐@6 @'kk@E "al @!`lk"l @! bk"b   "!lk@ "a !J` "# H H㿘 "! @!$"H"H㿘N  N@ 2NX "N@  ݐ6㿘 #D` b@# ! b@!̔ b8@!b "a؁㿘 #D`%؀  b<# ! b@! bD@!b$؁㿘 a@! 㿘 a @!㿘 a@! 㿘 b@ ̒ @! 㿘 "`@@%֐ 㿘 "0J` " @!i㿘 b @!_㿘 b@!V 㿘 "` b @!G 0 b@!A 㿘 b@!8 㿘 b@!/ 㿘 b@!& 㿘 b@! 㿘 b @! 㿘 b$@!  㿘 b(@! 㿘 b,@  㿘# ! b4 @ @%L b4@  㿘 b4@  㿘 ?@&'?@  "ll! ( @!l@T ? p0񀦠@f  !`l X@%~ 0!   @ ?@z$?쀢l @%_ 㿘 â"P `$  2 `( @+bP 2 bP   ?bPc     #( bP@ 2$#bP $ & & bP  $ *` @ @ ? 4bP2?@(?bP`2``` 2` y ?@/Y ? bP2 : l @$ g?: !䀢? ! $bP # @#\   `  ?*#! ?怤  l @$˒  !̀   `@ bP <  B;  &  "܀` ; 0 l @$ @A   #l`2?bPbP "` "& &" "bP  ( jbP  㿘? !!䀢?l @$y $!㿘à $ 耢 # "P`0?`4? "l @$ ! @?#l @:8̒?$$aԁ㿘 "P`cB  gB 3` +    )l'bPbP@2 ` !@$+    2@` @|`bP P"  2  2 㿘@ U? 4Y @ 8T  cF  "P3` + @ 1 @*bPÐ %bPbP`42 `8,  `@? #l`bP`2 `@ bP  $+   cF + 3` @* @ ( 㿘1 "P` @2` "P:0@;? 1   2 @B?#l 㿘 w   "P2  bP@&  2bP "`("`$ ܀? P0? P$(( 8㿘 "P$@ (  ?"P ?`(#4`$ "`("`( "`$㿘 "P`( ?"`(`$$#?`  "P "P?# $" (" $"P$@ ( @ 㿐! #l"P @6 @E "P"Pa0` & @"'"P `2 \ "P 㿘 bP  ??#:0  ?"  2" "P@S` "P :0  :"$"(  @- ?l!P@" 㿘 @:<$  "P?   " """"@" 㿘 "P@ "P # @"""P@ "PbP" 㿘  @,̖ ?  㿘#@a à  "bP 8@9 ?  ??" : " : 0$"P" "" " " $" (Ր "P` "`a@"P"P` ?""` d㿘 "P`  bP bP` 2   2bP@8` bP?"`  @bPa$bP@b  P㿘N "`` : +l*:  9   06,  . a0 b ca0     * N?? @!ߒ b  æ#`%l@*,@@!Ԓ W ,@? ` N  Ð#`@,@`@*,@㿘 "  N   0!쀢` !@ "   2l" @!  㿘lb8@yސ  " #  b`  J ` * "* *   lJ*l@J*"J ksd   u           㿘l@"Hl@"X l@}"h  J@ + 0 Ð `  Ð ` 㿘   ! lbx ! lb@"X"X @  ! lb@Ґ"X"X"! Ô@ː"X"XäøˆÔ@T0@00  Ä`  "#(`"c؁"㿘 @/#`㿘  æ cܨ#`@J ! $J#@/#ܒ"@$#. N 2 ؀@؀@tN *: @ ;@/ N@`؀@Ң؀@"d`  ܐ#`@M#`   㿘1 #J " S#ܠ`@ &#@/U ذ @"؁㿘  à#ܔ c` (#J? #ܰ #܀J? 0` J?   o#܀J?  㿘 cJ  #J@ 0 #J@   㿘%  Ð#`@! cܐ$cJ@.#ؒ"@$#FN  ܀c܁ 㿘 J#``   c*"d `?㿘1 #J " #ܠ`@w&#@. ذ @"؁㿘  Ð#`@"J! @.#ؒ"@$#N    d㿘"d`T 08s "d ` @" "d `  l"  Ð#`"cN % cܰ *cdJ@@.kؒ@$@cܐ $cN`ܰ *㿘bd *  ä@.P#` #bdbd  @3` 2bdbd  `bd$ $`$ `""`bd"`㿘"d @?b(  `@ `"*` €B""$T""$ #"b$J``  #.#J@  #J` {  #J@  0r  ܢ c`""$  K? #ܰ  #܀c`J? #ܒc` U J? %  #܀(K J? E ""$@ ""$J@  #J@  0/""$, ""$'""$"I""$,""$n""$ Ð "c""$  @ ""$ 㿘 è#`@-p uK! #a@-h #ئȔ  $#@-\ذ "@$0G@-T ܠ  , ܠ? : * &$J?`%?2L@-9bȢ@@ @-1آ$@@ ؀@k 0@Ԑ L ؀@ n؀@ 㿘 *`:   ÞL   㿘 cJ   ! À ##J@  #`@  #ܐc`  J " #ܔ#`@  N?   ? N? 2?㿘% 䀢 @u$ '  À`"#@h ! #ܒ "& #ܒ"@$#ܐ @@ *@#$*@㿘   1l " @"# @6#㿘"$` !  #䀢`2   "# Ð#@$b$ Ґ "c #ː$#%   ܠ c쀢  ##쀢@  c$b$: $b$ 㿘 c "c@      㿘 @>#`㿘@ʐ@, ؒ@"؁ Á#`h<|hH ϼPxxPXؔXޔܴH8ڬL߀p\t0< < 4؀ll8h|ۈpdּ㿘@㿘 -" d( d @ 㿘 `h     Đ "`d h!l" h l" h @l" h ll""fb8㿘 `d`*e"*` €  l@0YL@!L@ +"` "`! "L@@L@ D$!H@$!  t! L p@8, p  l L`&L@00  l L@L`0)@w0&L@ ! !"l @k@$"l"l l@L"l@Hl"@ 0  J`x@l"@ 㿐  d`/"*` €?Ѐ v@~  dr ^ "`l$d  " d " ` ĢJ p  + -X + -!   t Đ "`t Đ "`t ,`p@1  L`p tl@1bP L`p + -1,`p@)  -/// / 8 k  *  @ !0 0 @!  `h  "`h0  ʐ d  ?݀   <  㿘"h` Đ @Z@3  "x "x? "x  @  ʖ"x"x@   "䀢`! # @ $#$# "`  "耢` @ a Q ! "  l@`"$"@ @> :0@P #0`l@I#㿐bl'#0@㿘h` Đ @"hJ"h @   d   g   0 @$㿘!"h "h Đ $"h"h Đ d@ l#H@b  "h* $"h㿘@)A? Lݠ?:L㿘 Ģ `h!a `@( @+ 0`h  >$`h% @&  @8  ` h@!e  l`h 逊 `l#`@  @  㿈 b Đ 2   ɑ:    "h"t+ % 3 ) ʮ1 %`d#l$l  .`p@" "`f?#l =#l `d "/(  `d "/n  '/'@͒쀢 `P``c/#l*` €lcx = #ll` "#@l @$l&l @ m 0l` "#@l @{$ll @  0}l  $l=ll  $l?ll  $ll+ l  $ll, @ #l ɐ  ɠ "܀ "b  @ " #l  A$"l 4%tt @  05l 4%tt @ [ 0*  B@@ ޞpl  $ll@ Hl &$ll d d$l@ l0l @ nl &$ll ʒ :@ 0@'lŐ#w0W l  $h$ll `$h $l}l hl $h` $lpSlg 0h h ?  ? l" h h ?  ? "@hl $h` $lI,l@ $h@RL #`'0Rl@#@ 0"Llc 0!@ !l@?c 2l[# `lT# bh@$ @@?! ]ϐ 0Yl  $l@<l P "` "耢`l캐 l $ll#"m' l  $l@2l 0l l#l"m' @0"l  $l@1l m (@ 0lc /  Đ $"`tm`8  Z b  " lb@ 0m`@  0"`lb 0m`H { 7 b  " ؀ ր @0m`P c  b  "   @,0m`` K % b  "    .@ "` l*xb. %0m`h( 0`d m `x !0#0  ɐ |"b㿘"p@!!L#@+ C\@3㿘  @.  @&""" ?㿘  m @; 㿘 ٔ m @- @ 4J@K)`J@ g`"#!" ?J`g2J@ fJ@`J@`J@2``@ И  d㿘 d     d"㿘`㿘`H"H("@㿘@J J ?v 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0ĐM S'@+?  㿘@8 H @   @.    @ – ?  @@,?)?@x@,7< "N@? N  M N  +N  Glz 㿐m@ Ƞ   m '@@x "  I " C `` ܲ` `$-d-,   ` 6 d` "  d   d  d ܀  `M`0 qlPlP㿘 @$z&@@  & N@ ".@ `@*N@㿘`@$b@ @   N@ "`@  `2 @ J"?8J?   ?J?8?㿈a " @耢?쀢?@v@#` " $@d `@x@`$`$㿘 !@G0 @㿈! a  " @9'@   S m`@Ő   H'@H 'm @ܒ@쀤`@'@y@r @  '@l'm @@d䀤` #,`@ @ m!'@쀢 y Y@*Ȁ`"! " "`@%aa @֒bx ɒ "(!Ԁ`# bp @Ԑ ! !!Ā@`?bp `$!@;@ @   #X`m' @] 㿈#a  @C  &  @u! @ِ ! @U!    蠐 㿘"!@  㿘"!@ 㿘!`  @? ` 㿘!`  @?Ґ ` 㿘 @Ȑ "  @㿘@P` " mm!0@ C m 㿘0@=m?@㿐 H@d @) !Ѐ`m O!X'@!? 0$* #d@€!@ؐ"a @B !$!̒  @ۖ ?!̀ @)Z!̒? $! m!@ א?!̀ m'!@`㿘 % L@ !@">@"; @*  m a@t@ @ @)㿘m@s!Ӓ  㿘m@g! m"}㿘L@ # @'%*`:  # %2 ἀ 0  `4@7`@!`L@  @ \ L@  @1'*`:  # %2,!@`@Q@! `L@  @,㿘@! 0 m@sb(@@唒 @] @ZX> !  @ ?2    @td @  g @   㿘  @ ??? 㿘 dޒ  d@ ,,Ґ@ܒ@ @!I, ? $@D  $` ݒ$,㿘@!.`@!)" @!# 栒 @sm@o"0 mN bH@!@!  成 mb8@r@mbH@g@㿘m"P @hYN`@0@㿐i?m@*"X " m"h@乒 ". L |    `T @s  @h$ ?O&&@ C@hN@` 㿘"m@hm@"p \@g8@uڒ  @;'#,`# < @   @ n  @`@ @ ` ސ @`(@ѐ8@ ؐ 㿘 "`㿘 "܀` #l`@??   @  b "b㿘 b쀢 @"b㿘     b?4  #   b?   F) #` b?c@    @ l 0)@^? @ @ ' @ @sc  N' 7? @ ' m@b"' -?@Z & @ 3 ʀ?c c   ` c `c ɐ  "bc f@? ` ͢ @ޒ?Ǣ Ő¤ @ ?܀  ""耤  #l` b "b % @"% @@+% @@?㿘$@    b? ɴ  ""@`@.? @ ? `Ş@@t?㿘 "` "耢`   E䊐 0A@{??5 3`  " @1 ) "܀`@   @\     @T??  w b  "b 㿘@8 ?  `@,?@UU     #?㿘l m"@ 0@s# @obl  blm@pOb@ @  m#@q @H   " 2 㿘`2@ H@ && @" `&@& `p "`p㿘 ?" "`p?"`p㿘 (㝐 ㎐& ??> & ʐ㿘 !!@#$!Ӑ@ @ HH  H H 㿘 2  p㿘 H H "   @᷐ 22  㿘  "   @: `:  :@ :` "   " 㿘? ʀ%#$` x*` : @ F @aꍒ @d@nꂒA? @?Z? +# ʤ (# &B? @r  #4`!   ?   B?  cl ̀ ?! ʰ  @*# 0cl   ?  㿘  `#$` x*` :  @ @ f   @ϖF? q #`'- Ԡ  - % l Z  ?- 0N`B l D ?ly 鼒 2 @@鰒/ dB? @  4 2" @ D@Q?l @Ȱ? ?D  @m㿘 m#(@ x 0&P?    "  @0 "  @㿐@N?  J   "@x0m  m @km#H@ 8 0'#p@ 3㿈@@ @X㿘?  m#@ \ w?  m#@  0> @ > @ d   2@ 8 ʚD? " @ 㿘  ?  @㿘@?@ ے & @ =?   ?@ 5   g 謒 m#@  0}@ "  @ ??   @ @8;'+ ɀb@8 "?  Y 0NV? ހ@   b"b""%? : 0/+ ɀ4 @  0b? ? 瀤@ ""@ b? ܘ       " "`"*㿘 # `B@d1  ! ɔ"mc@l @ ` ʐ   "` Ě ` * ?`#`#P  ɐ ##P  #P"`1 Ţ !   &  , , @v$    "        0   0            0   0     㿘 &?x !   `   Đ J ` ` ` Đ J 㿘   Ĕ J  ɖ# J !  "@$ 㿘`B @ 2  #<`   ɒ@Ȓ@@ 4J  Ŷ # B % # Ā`?J ` `N `Y    ?." `5 Œ`J   `2 `T  ?&`* *  &㿘 J `     @ ",    #L` ,:  @㿘# ` /!   "J . :`@$`  _ _   鐐 U ʐ G    $ $  #L     0|8 y  * r l   `k   f$` cP   $cP! 1 Ő    N `$  @cP  J = 7 #<`ɖ7b {@5  ɒ@@Ȓ@@4' N "! ő*: і    $ N`    ` "` 㿘 J ` `  ŀ 2      2   `Ȁ "Ԁ`  "Ѐ`   #< ɀ`     Ęb + *"b*@* "@ nn H  ĄH  "@  ń  㿘??  ?o ɰ? ?"c, `  Q  " HB?,b&㿘 42 ?`|F?  ʰ??  "?<,,Q ?8?`B 2& ņА  Œ    Ƙ& `   #`  8"& 8 ń  @ b ; 㿘   O`   4   8   Ȁ  @5 #  #"#"`:`"@"`$  &@ #``  `   4 2  8` 2 #c " "@㿘n @   "`|㿘! #   d$#@d$# ` ?$#㿘 # `?    2 `      4 @8 x@@%  ƀ "c   b@ f 46 4d 2Y  "#  l8 ?"E @" |421@.0+3 2(  "#  l ? T@" |㿘` Ű a     & R @f "     "@$@ !   25? 6 % ʐ l& ? "!?"  2?  % ʐ1 l ??? ?y㿘@E ? ? ? b  @?   "& ?Ò@"?㿘N -  >n@ 0@n@ 8!K @ @* @M @5 n @@  6n@Mn@ P  L@  N ۔@@ ە n`X@g  N 2n hx@&@@ @M@@ ۮ Z ɐ "b ۃ @ 㿘@ 7?@e ?   @Z? .   4 ??   @㿘⪒ n  pn`@\ n @ {?rn@7 0@5n@2 8?@1 @b  @  `E 4' @# 0?  ?` $  @ . :    * $@Ӏ #?! ? ?` $  @ . :    * $@x߀ @\ @ @ ϐ {   ""@  Ƅ8А?? 38 Ȑ ??: 㿘? . 1 đ* " ? n @  . 1 ő* #㿘 '"3  . $0.! ^+ !   > & 3" < n)   c > & #c z ư > & "    ?  ?n @  㿘`?㿈  @> &> 㿈@耢?쀢? !  # ;`;`㿈 & Ȑ` ?2  ?2  a ""`  ; #  ? ?a@"J 㿘[  !@ n @C ??㿐 %  0-0*)"!# n!!̀`n!0ٚp"Ξ<!̀`n!P@ 0!n'!`@ 㿘 "aАÒ㿐  l'@  2n` n!p@ 0"`ꍐ㿐  c n'!@֒㿘  0)'" B@ #p`! @?      0 0 " Ԑ 㿐   """0"b"n'!@㿘   " (n%!ȁ㿐 )   "N@0,+N@ M"  m =  #`   ʰ#d `#h`"|`#`@ر &c  ʐ#`* n'!@F㿘   ! J#($#(㿘   @ w㿘    أ 㿘 #`   n!@  0خ @V l"a؃  @4 10000000000000000000000100010000000(00000|0|0|0|0|0|0|0|0|0|㿐 'D Ȧ 8 " J@ € $8$8  DJ ?`0+'D "*` €DJ@ +`?`f`d'D D"J + 'D"a. D@~O'DD z?'D@ݐ 2  @6'n!@q    "`   `, # D&     `?"N   @`? J@  @='DD@O  "@  €DJ`2J㿐'H@ @'n"  ` @ @ِ'n "82 ! @͐'n"X@0   HJ`"  ` @ "m``  "&   a`> 5[`"Q` "` R`" `N` `?H"` `?C"@":` "N@;`" N@7`` @`@b`?` )"@4(`$n"x"`  `n`H@ 2 ``  "`"@"@ 05`  €H`  @`  "`   ``  *@` '@Y``  ɐ "b` @  ` 㿘! #n 0b@c 㿘@    S@ 㿘@  ` 2` 8@ 㿐Ր'n"@㿘  8J@㿘N փ $2``*@J@  @ 㿐d L -2    ?А  &%?'n"@ВS  А  * .  @*`: В@ Ѐ$&`2 H  "    J2 H J   ( P  J򀠀  㿘 'D'H'L@  @  @! ʐ $#TD?H@c;L $#T"#T@  ?㿘 Ȑ @@ q 㿐@Ԇ㿘 `@ʥ@<@9 ն pbH@b#?㿘!  `@   @Ֆ d<  耦 . `@   d@ƒ . 6` .`@B2`* @ *`B2*@ *@ 㿐 #l` ɐ m"b  M>    0              ک  `@9͒ 2   0  0 ڡڱډ㿘% Ƞ h@!Ā`  @dܔ ɐ "b$㿘!  ɐ h@  c\  @"c\ * $ 㿘N  * : N`㿈6 2 @ 0,@   -, $?L?㿘N) *`:  % `N d  s2N@L`  *`:  L`  N@ `@N 㿘 #X#aĒ`"#X  "aĀ`q 0'  " @ @  q ]   ?[` "Ȁ  ɐ "b2㿘ٔ٧T!٨! ʐ "c\㿘!!Ā {q@ !Ā   0 * "Ȓ @  ɐ "b h6?? ?? 0   080* 㿘7 ✴  a0.8✴a0!0(8   a0* 8!08 " @ ??a0*`:"`@a0㿈  ✢ `h$ a0  @c@!0b???bq b$!0$h耢?쀢?!0*  :?04 ?     6?042 ( ?㿘 " @  0*      @ 0 2`"``"@??:  ✐ $ ✀6?JJHJHJHJHJHJHJHJHJHItJHJHJHJHJHJHJHJHJHJHJHJHJHJHJHJHJHJHJHJHII,JHJHI<IHJHJHJHJHJHIhIIJHIJHJHJJHJHJHJHJ0KL|L|JL|L|L|L|L|L|JL|L|L|L|L|L|L|L|L|L|L|L|L|L|L|L|L|L|L|L|L|J|L|L|L|JL|L|JL|L|JKPL|L|K`L|L|KKL|L|L|LLMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMtMMMMMMMl㿘?!8! $#`#`9!p$ 5!$ 1"("b| !lH al"alH al㿘 alpbP@^㿘 alp@^bX㿘 al ɔj" l ?( l㿘 ? ? ? b  ?   b& ? 㿘?. > `6U l*` € !l ɒ`p@ J@ 7  C"ap@!b`8 8#  # `3 !?N  $* 0( &"?  4 `  ?2    a@  㿘?`6!H*` €l? V80t Kb0pha*a7B A0ل B 8 4`2  -?0L3h ? 4vT   0$ l ɔ p@ J  al? "alJ? al0 za ݞ  J:" ?." \ J2 02 0?㿘N l"   p b" 0"! ?* : `2"$*` €&@?&@? &@? &@ b&@&@?㿐 ɦ ɐ p"lN` 1pT"hN :( ? %' .2al* \al* ($al al*@`!$al N  2 z N ?ߐ N Ā :lp ɀ@ ""  `*@l@ "p㿘b| 㿘 #  " b  ʒ"@`*"@  J@ @&   "  #`H* *` @2* (**`J@ @*J  "   J  @ 㿘 !p `4 %!p "` 1*%!pb ?# ϐ   Ő @{  얒ݐ7b?%!p㿘  p"p* 0p  `?"p㿘 ψ @/͔  1@}p"  ?" "&"@:&" 㿘!" "$"@:$"㿈b @. `? &@ & 㿘" "?@} ?? :x $b: $-  p2' "" 42 2" 4 2 ( 2 㿘`@@ 2 ` @` ` 42` " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@|0&@#㿐~    6    >    2 J@ 2J@> J@ `'@`J`C '`JC `Ҁ J ̀ 㿀'PD'T A'PT  \ PT "@@ 8 F :`@ F :`:`HT(N   ʶP۔T P #L`` 1@'&"`2@㿘 !` " "a㿈耢?쀢? ? @b' 㿘 #$ ɀ"ap㿘   (  ?"   #H`  ?  b   㿈\`/ l ? 4 2(<y  l   ?  ʀ # ??<S# ` @, $Ք !` L  L @ "=쒏 @ 2 `  "l  l`l #$` 쀥2= 㿈`N@ > 2 pR"p#$`7 #$ 3 ap "5&ap&ap1&ap ʠb  ڔ m  O? "!  "! "! #$`  "!p#$ ???2 #\`%p"Z  ?#\#`??   #$  ֐ 0 "p#$  ̐  㿈  !xa !x? x`?#??" !@ !`@!!? @!??Ox*  ; B?D !?!?? !2x` (xx*  ; B  ??xx !`x*` :  `x@*   * @ :`@ f !?D`x:  2 !@`x  !: @ c @? @ 2#=x(=x#\#` " @? @4 2=x(=x=x=!㿘a@ΐ  l cT "l㿘aL@  l cT "l㿘a@  l cT "l㿘  a@ aL@ a@ 0 @  @  @ 㿘 #l Q ""#l @z ڨ joˡ  @o  @l @X@u8 aL@d ˑ = ɐ "b䀍 # % bbȀ  ɐ 2  :  ɒ "t"䀍 v`|   "`| ɐ "bp" " 㿐bp@bئ p"  {"#p@) f- ɒ@C 2aL  2[  ɪ "bX @%#p "\'J@ K %#p'J   *` ''J`3 `)$\$\J@`'J@ ^`'%bXJ \`'  *'J@  2J@J $"*@z0 @ @op"2 %#p㿐 "\ "  5 #! ?/?h   / - + l K    "p ͔bX@@ l㿘p @#  ɀ "b` "b`㿐# ɠ b`Z ? ?OV O "/ b`㿘@KiHi nnnnnnnnnnnnnnnninnnnjdnnjnnnnnlnmnnnnnnnnnnnni|iijTnnnnjnnk,nnk@nnmHmmnnnnt0 #! ˢ$ Pc`''@! X+)! '759qy;q Ft* @€cȀ  qa@ g%##̀ "`qa@   =%cZ$` |@ J@ q6`q |b@n @$`8C$`㸐 ?$` ;$` |@Δ J@ q4`q |b(@O @$`@$$``( $` |@ J@ q4`q |b@@4 @$`( $`` @$` |@ J@ q4`q |bX@ @$`<$``@ $`p0 |@`㸐 $㸀`` $` `($` ` @$`  cȀ  qbp@ %#@ #̀ "`qbp@א   =%c$` @@` $` 2&(` $`@  $` &@  |@"@ 2c @ ` $`$`H$`L$`P$`T{' |@ J@ q q |b@ g" P |@ J@ q4`q |b@{ $`$ Q$`` M$`  $` H& |@۔ J@ q4`q |b@\ $`, 2$` |@Ŕ J@ q4`q |b@F $`  $` |@ J@ q4`q |b@0 $`0 $`&@@a?? b* & @ @@@` 2q@  c@(    `-qqc@ c@@p  @ ~ h?' ʒ [@S#ؐ@G @ @A : q@pD#H  ʤ#|*@! @O+ 2q#x@p/ @< #Ȁ` ' ` Ԑ =$P&`'   'ش  ˤ P; 'P `'c7 ʮx-a+ c9q#Ē  o-` 5`   ؐ@,`  c 2vPq@~#qP#x2`''` 2  ܘ @  x''@wŘܠ  c 2LPq@T#GP@i$ $''$'' #\`l@`  " c؀ q#̀`wqc@Z #ax@ᅒ#@c 2Pqc@M@o#@ P @ @$PP? #$P!#  ?@@$#  ?qc@o @ @ak@ @ @ q@B##`$#@ <P Lcc#` @e " !q#@ @o9  ʐ#x2  &`&`&`  ʐ&`D&` 㿘'HH@:$㿐@k J @ "`E    >  &` `@Dž 6@;` "1 `  ?+@w` &@, ! @@" `@"` `2  ` P`  P&@ 㿘 #rrrrr` X `@ඐ!x@ 㿘@1  @nb ;'r n L  o  @ĝ = 2*`"@ 2    @2   "*@ "#`2 ra@  @ 2L@tv㿘@;xxxzxzzzxzzzxzyzzzzzyzzzzzzzzzy0y@zyPydzy|yzzyzyzzyzyzzyyyzz㿘! J`, e l f"i hr`6b#h*`  ː ["`lY`W``< R"`<`< M"`<`< H"`<  ː "`Bp`< @="`< ː 9"` ː 5"` @ |1r  |@U +r ː &"`$` ː  "` ː "`| ː "` ː "` ː "` ː  "` ː "`x ː "`@pr @D?2? ` ! @b t  "* @   t@ @Q t 2  ! "* @R@" $"     @   !  p@ & p @     2 ː "` * p@   h  `  @x @v @r @p 㿘!r #a@@<!x@f 㿐% l  #r!xa@/@~ '@U 0*#  #!xra@ @Yra@  p $ r@a@2 @1 @ l㿘  @" `  \!  `  " \ @  "&@ ` ˒"@"\$ ` `&@$ `㿘  t`d`"t"d  #  ː 7"`` @r $`ra@lj  " p@ p *`"@ @r˓*` $`ra@lV @r` ra@lM @ p,`*`"`"p㿐rb@ @l5 @ J? '* @ @ 㿘   @rJ,  ra@l @,`@@$l "`@`@ 㿘 @E @r( ra@k @8rb@Ԑ 㿘   @B`㿘 <@є * rb@kƐ  #    l 2  `!r@`" @  l "`r`@G"(`@ @ 2`8㿀    #r b0rb@F    r"@k ː "`hݰ  `  Y  ?  ?? @"  ` 2B  x 쀒@29 ? 21 2-.   $耒 @ ? "#@  2`_"  " "  @ #@  2`_"  4  6   1  (      r"H@FՒ  | r"P@F͒  r"X@FŒ # @s @@K䢒 g ˀ`  @ r"@j ː -"`h  ) #     r"H@Fr"`@F    #! @ے  @"o  #@"k  # Ȁ@Ԉ㿘@5ph؝㿘@-Ǡ % #r,' `0'!!h*` €"  ː "` "`  | $ ` rbx@- @`|  ː "`@4@bh?ђ?Ⱃ* @   @   ` r@" "@@   @:@ 2 `@ 㿐@W  2 @i " ,`* * * %r T@5 Z @A D @  T 2 >Xx@ , @Q h< @   @Քh  hr")@r"#h @Ò  2! @   @ 2 @  r"@i 2@ r b@Ȕ  ! ː@ @  ,@H @,@ :  @H, :, @   `r"@E$  `2f !  @E r#@idY "@  2S O @L ,  ? ?/7  @ؐ ?`'\'`'ab''d @q`\ r@#( @ $ '`'x'|'d ##\ ؐ  r@{c(   @ @ 㿐@;   r@h#87 @64  ``@R ` `D@#  T2`@< T 2` `D@   @Ҡ! 㿘  ``?  # @ܔ    2`@ 㿘 rN  nrcH@a   N  o  ː "` "  %  @ , ` @n*  $ @hR $@ , `$@  @ , 2*@, $@㿘  ˠ "- @ "( @x . " * @ 2  @ " @d . "  * @     㿘'HH@o$㿘 #rrrcXp@A!x@k 㿘@㿘rc@C a r@mcЀ`? ' %r+  m@M| 2rc@ @Mp!@n!@@؀?倢 ?b* @ @&@ `  `J`p   &``@`"!@ - @b2@@2@㿐`J c b rc@k `@ `@"sJ@ s`@Y ` @ ` @"sJ@ s`8@H ? *# 2* @ ? 2`  ", s`X@0 @@C2` s@`x@g7  㿘@  .!s@@“6 6`@@gM x `@ 㿘  #!s #!x@[`0 ! #!xas`@Ssa@N`@x 㿘@"ĝ㿘 #sa(@)!x@S 㿈! + 7 ) #s% 5 - ' /s%耢` $#Г*` €  |$!t %ah &Ԑ %  @w`| "a @q`|"a@튔a?ؒ?& * @& % !t`%$ Ӣ    '''  @ܚ ?sa@f~   sa@ɔ  "s!$!t Ѐ s@BB!s@B>!s@B:!s!t@B6!!t@Ḁ s%ah!t@ܒa !ts@֒b s %ahb@3 @Q @  @메 sȒb0@f1 @ @ @Ԁ`2"@sb@@   @눔 sȒb0@f  "@ 2sbsb`@f @)f@N耢 sbp@e @ 8!@X( s"     "   s"@f$ 0@? s"0@e @  s"@e0HȚaB + cB + 3`  *`  @  s"@e01@K: Ȁs̀s@e"0@* ah      a,c?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?%" @!  ?" "  ?c@ ! @  @!  #? "? ?c@ ! @  " @! @" "       @   #!l"!p"axs"`s # s #@@d@j͐@ 3   `Р"!ds @@=#h!hs`#s#s#@@0 s@@,#s!d#@@&&@!h@a &&  `  㿘. >@F 2s@sc@d, @It`@d! 㽐@銒 sb0@d @ t`(@d aЀ F  !x"" !А" ap * "ap d t`8@ڐ   Ѐ`t P@? ap @' %t!Е, * l"@ Ѐ  @?hap @!Ѐ t@? p04t`x@    t`@  t`@훐 @I t`@c @ sb@c @. ˦`t  Q@i0 t`@t ฐ@@༠@* @ @@x`t* d0 , &@x ax* 0@"0 ;  @ C@m8  !d @  t`8@3 !p "@Ѐ  t @? ( (  `3 /td,al*"@ Ѐ  @>h   `2dЀ `t@> p`>Ѐ t!@> Xt0!0Ēt+ )td,al*"@ Ѐ  @>Đ ht `2dЀ `t@> p`t`8@  㿘@z,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, (HHHHHHHHH(HHHHHHHHHHHH8x`pP00`P@  ||||||||||||||||||||||||||0|`p|@|P((x(H$(HH,`hx((X ( lLŸ8,,,,,,,,,,,,,,,,,,,,,,,,,,ԈԈԈԈdԈԈԈԈԈԈԈԈԈԈԈԈԈԈ$$$L$$$$$$$$$$$$$$ޤ( H00㿘 ! #ta@@!x!xta`@Ӽt@Ӹa@ 㿘  #ax ta@ӭ ta@Ӧ!t!@Y@Ӟ@Ȑ 㿐 'ϐ /)+ ) ' # % !t7 9 5 ;t- Հ * D@€ %a   %   $x $`| $p @!??Ⱃ* @ @FY&@ ' @`|`&pa@惒 %l  @%) %ll 6@tb@ @ m?`))*` €&p@'&p@ H0 @@0e@@Vx  p `   t"`i" cl @> B .`@J@ -)@ 1`?`#)!*` € Ր ,"a Ր ("a Ր $"a Ր  "a Ր "a Ր "a Ր "a@ `# #!tax@"@ڐt"@ #p`2; , l@H*$   `* x @ i#t #`@G@@;א @ `? @`@5@;ɐc@;ǐ  x@f? င Q(ဖ  ӄo:* b0  .*  ?** *a`b   "b#p@˒! 2 ,p@ . @ђ` ,p  2 t# :bp?`)"*` €  ' `t#`  ! ` Ӑ̒ @@    @ .  Ӓcp@` ",@ Ӓ"p`̐@*'@!l"p ! `  !  ???ؒ'@  /Ѐ/؀``ِ  `! ِ    耢 ! /'/! Ӑ Ф"p#\! @k -tc @G2!("p@$@ @!t#(@ # Ӗbp@ג!!t#0 # Әbp@ɒ!! Ӱ"ph ?` )"`*` €  t#(! ! `$!  0?    ??   ! ԓ:@ 2:@` 2``2 @턒  2 ` p'@v@!l p ! `  !  ???ؒ'@  /Ѐ/؀``ِ  `! ِ    耢 ! /'/! Ԑ Ф p#\! @ -tc @F~!( p@ؐ$@> @i!t#(@9 # Ԗ`p@#! !t#8c# Ԙ`p@! p㿐 `$')"*` € ՠ   ՠ   ՠ   ՠ   ՠ    ՠ    ՠ! @ ՠ!   tct "t   ` "` 2"@$㿐  ptcH ('5  t&{"@M@ g"? cl@; ? # ) / 7 ղ`@J@ - @ <``-*`)#P € Ւ    Ւ     Ւ   Ւ  * Ւ   ,   Ւ  ""a $a 7$ Ր "a Ր "ct  %   !"(?2`@ @ ?2`@ @ ?2`@ @  ?2`@ڐ @ @ p??2`@ΐ @ @u@b?2`@ @ @h 㤐 T%㤲`@@3?O??2`@ @ D?@     @H6  @A0?@ΐ ? t@@cP  ttt#Xc`@8Քx { $a   2$at@8Ɛ#t@8Ð#$a@ @ ? 4` 2 㤀 2   a "  ) 3 ! 2$M@L " M@`"M@` "```@ &M@@  3߀ !M@ g@ 1t#t#t# @8jL` t#@8b`  !`   !u '@A@8N  u@8H  `" u`7`"u0 "u0    0@Zu@8. H@  ఀ   '  ? ( ?* ??* ? *  ? ???"` Ւ"`(*``H 8 *@㿈    2   2   2    2 t#P     ?? @P   u P u`X@k   `@" H !`  #"" `? "`* d* € #x   #   դ     դ`D,u$ `" t,c,@# ? "D,   0  0  "   /,`* *` €t  #P??  ??ئ'''ܐ@e '@e   #u!x`p@͛@Ő ` " ` #u!x`p@͎@  " ` #u!x`@̓@  @Ꚑ@:? ? ? ?   $4 ؀ 2    "` "2` *2 $`2 2 2 2 2 2 * #@@$ Ȱ 444Γ*`4Ѐ`4 4     ""  2 `2` 2` **`$`*`*`*`2`2`2` 2` 2`*`#@@&  ,,,,,, , , , , ,`,  @6@   2   ,@"@ J@ ""@ ,@+{ @ b @q ,,@Nj "&@ /   @@,@?   @ؐ`N ,@@{? 2$ #` $'@B7  7 @?   `@閐   ! ϔ  @9b '& `  ,`` @r0  #u!x`@O@y 㿘@ Ֆ!   !    u #!x@3`@]  `? "`   #u!x`p@"@L >     0+ "@? ՗* " *" * " " " " " " " " $" ( *`*`"`$ $ `$  @?#:,@   Ն   "  (*(  ( H 7  7 7 * 77777+  2+` 2 2,2 21 1uD !pu`@=0="@  u "@  2 u! u#` a    #\ `@=,2 ua(@=/К1 ԰!pu0@!2x ? / / // 7  / / / / / / // ////2 2 2씓21 1uZ "ua@@=i0S"@A  u,  "@6  2  u,!1 # '%u#  c u#` aH  #\ `@==Lc,`01 # %u    K 0 *  2uah@=!c",c"pc@g!2x   ?''''   @՚ 6t "8܀ &@^ 2t"P  @ 6u!ܢ @*@^㷐 #p Ր "`x@ ) 'u#l@=(@ '@V@4ᨒ@#l㿘  լ!l"`  @{"L a c  g   Ֆ    5   & *+ 5  Ւ   t!  `$ ``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  " @ %  Ւ #x ?   cx@, `x  u@:a  Ւ  ?   `@x`u@ a  Ւ # ?   c@x`u@a  Ւ ?   `@ܔx`u@a  Ւ ?   `@”x`u@Ғa  Ւ D ?   `D@樔x`u@ax % 5 @ #p`25  cl @?1  u@!'?2% % l@<"L   `@l`@@l  ! ##u!x@a@H @  Ն?(@J@@"@ +# 8 ՚x*(cx # 4 Մy # ( Ր? * ###z@  ? @@ *@cx"(㿘  x`D `" v@2u 0;* v@2l P  "  2  v@2` `  #! @ @L T0 v@2R p  #! @@ @> 0 v  @2B  # ! @u@@㿘!v ՠ #x@2/      #v!x@Ȕ` 0 #v!x`@Ȋ   ! ##v!x@9a @}0  L 3v9 #-/v5v7v+;v  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀ `` `,` !v!2@1Ɛ # a  $a !v!0%@1$a `   !v!H@1 v !`@1 @1ax @@א! @1 $ 4   L@1 $  8 L@1 $  < L@1 @#@! $ @  L@1v D#@ ! $   L@1j $  , L@1b $  ( L@1Z 0`" $@U  0"@& 0 $a 0   L@1H   x`" @0?Hv@1;!!  @n  ?`$ !  * '! @? 㿘v@1!"! ## $! b@Rv@1" @K @ L㿘`@v@1"  #a  @8  ?`$ a  * $a @   %v"S@00 ?  @ a `?"`a  * $a @ @a 㿘`Y ?>@ 6  , < ?`&  @  * & @ !  ?`&  @  * & @ 4  8  ?`&  @ >* &@ >㿘 T " @ 2  㾀 ?`Z*`*!H €!v"8@܅*!v"H@U $ !v'"X@0!v"h  @8! !v "x 7 7 7 777@@0!# # !v " / / / / / / / / / ///@n@/ #@P! 㿘@@ @v    `А *`: ?А *`: ? *`: ?ɀ`2    *!,  €* ,`  *  **".@d|px  %  `@J@ -`?`8 X*` €         @   ?''''   @Ú 6v@#@ِ  "v@Y 2v@/1#0@̐   @ 6v@ې#@@쾐 @v@/#X`@  L 2@ @Y㿐vvcvv#\#`#h〒   @. 㿘 L   @3" 2  @U $ @P  L ?  M@ P @D  v @c # `?"`  * " @~Ӑ 㿘?`8 ̓*` €v#v#v#v #v #v#v# `v@.#0w @. x x  "9 u "C o     2  w `@7   `  w @ w` )w'w@@7 ( `@ 0`h@ڄd `w^ 8XwT `  `  `   `^w 8@ : 4@ڐ/@Ր*&w  @6`@ z:)w'w@6 H  @6P * w X@-0! `w `@-ٔ0w h@-Ҕ pvR"ҔЀ` "ҐR@"` `*`R@  *@- 㿘 @- *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @G6`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J ЄД ** 8?А ?Ї+ 8* Ѐ4*@*@ 㿘@-G㿘 !! @w#@6bw"`w# @)b w`" #w@|"$ 逦   #w b@x 5"#4"`"@H` 2  2   #w`@b ?"c4 wJ ww @L"  @G#   @#x   " p"`㿘! ဦ  | % p4 ! `"$ |""` "2  w#@P0w #PJ#P ww@" @# "$p$ |㿘w"pbx"`V 㿘w"bx"`L 㿘w"Hbx"`B 㿘 #w ߒcH@u ?"c4㿘 #w cp@h  ?"c4㿘 #w c@[ ?"c4㿘 'D'H  'D` &`D  wD@4H D  DwАD@4H D $ HH #w@*c  ``@5` H ?D"c4`"H`""`H@J a  " x x x    !  @ `H"`   "؀ H@  H"`H  @  @+H @U`'H 'Dx D@4/H HH #x@Œ`0 ?u"c4H   ">#!cH@꒐ ' @L" "䀢 H  "  H@5 y #8 8J   "#  2J J  @  "J  *` / "#     H+  * *` * !  @ m  "؀  @   " x x         @!  H "쀢 1   xx&  H@4`X   $ & H @3 2uLD Ĥ   M  H@4z  ! H@  "؀  @   " x x H      @( !  D "쀢  1  xx&  H@4>`X   $ p&   ,@ӐH, @ٖ HȀ 2 Hx@@N `@WD QL DH@4 > ! "@  "؀  @ (  " x x @      @ # ` 2  "쀢 !   xx$  H@3ؒ`X ` $`$    @.D?@,  " 㿘xp@ 㿘 # # `x px x@ 㻘 'D'H   'D` &`D  wАD@2|H D  DwD@2qH D $ HH #x@`  ``@3` H ?"c4 ; #8 6 J   "#J  @  "J !   *` / "#     H* +  *` +H"    ! H@  H"`   "؀ H@ @ H"`#H@5H   (Hx`@Mt (@ : HH @3  H Hx` ` @ @   : @@Sw㿘@7e ! #?`" * " @x #@4)   "쀢  ! # !  xa$  H@2$a $  $a"@ $a % "@ 㻐'H 'DxD@1H HH #x@` ?"c4H   ">#!cH@ ' @ڣ"n 耢  h"  dH@2l _  #8 N`  "# `    H+    +@J`* !  @  "؀ x@ a x x x        @Ӛ 3 `   "쀢 1   xx&  H@2`耢 "& ` &`&  " @15H 2N@m  "  xx㿘! ! #x!x!w#8  @p   #x@xJ!( "䀢 + @% !    x#a8@X0 #x@x3!`@$ +  xcax"̔ "J 2 x!  @; c!x !@1x    cax @%` c!x |! !    @  c!x"{"( w!@ c!x"l"P@ c!x#8b"x ^#D@ !  x  cb @ؖ xc@w" "؀  x  cbȔ @Ɩ) xc@w")  #!x!." " (aؘ@ #!x!#0@ x#cP x "Ѐ x#xw#8@% l x#@wi#l    ߔx#@ @{cl ` "#4㿘  `? & x`@~`   &  x`@~`   &#x@@Mc?  #!x#Ȗ@>㿘 xÖ "c4㿘 xx  "c4"Ё㿘 x "c4㿐   ! `?:"! #y@)`x`@~[` x  ("a`@~Q` 2` "!@ #@J    #y``0@ ?!"c4  """3 1 #!yaA P@Ȓa y "#@`h#y@v a "#4㿘 y|> "c4㿘 y2 "c4㿘 y& "c4㿘 y "c4㿘   #y@@}` ?e"c4   "̀ `?1"" x`@}Œ`   ߐ $"b x`@}`   "" ! @` ဢ "` @J ! ՠ#`!@O  ߐ "b"! "̀   "Ԁ " J  #y@/a$"#x!x"̔ "J 2 x!  @ " "#4㿘 y@ "c4㿘 yP "c4㿐  #y@'ap+ x`@}H` x  $"a`@}>` 2` "!@ J   #y`a@ ?#"c4! `?"!1 !  a a ?"a #!y!(!!@!    "#4㿘'H  'DyؐD@-H HD  H #y@a ?%"c4Hy`@"`` #4!`  | H #y@uS"Hy`@͐"H`  "b㻘  " &`   #y@@UbP `@/ `  ?("c4@=`  `x@I   ?"c4@$  y #bp@2 y`@I " "#4`@O2㿘'H  'DwАD@-xH HD  H #y@ b ?"c4Hy`@b"㿐'H 'DxD@-VH HH #x@` ?I"c4H   ">#!cH@㹐 ' @s"-H !  &"  "H@.; y"@$ H "쀢 1   xy&  H@.$b   $ & H @-G 2N@  " 㿘'H  'DyD@,H HD  yАD@,H D  HH #y@|b ? "c4y`@Ԑ" Hy`@͐#㿘   &`  y#&`    #y@@Vc y@@c8 yy#@#H`!y@# " `@-` 2` ?1"c4#@u x`J |"`@-` y`@-#P x ? "c4``x @5  @#`@N@N㿈'H  'DxD@,]H HD ywD@,QH  DH #y@ch! yH*  ?c''"?@ HJ |H@- y@-;#P H ?P"c4   ">#!cH@═ ' @O"  +  a w/H,`@y#H @ 3 `   "쀢 1   H& @x@- H ` &`&   ` D?@Ҁ`@Z  " 耢@@M 㻐 @K  @G @ S @౐   @9  @6 y@# y#@0ؒ / " -/ @M#y@c  +/ !  ! #@s#@ @#  y !̒@!W y@!Q y#@F? "c4@A @}@ @ ? y@F# "#4"#4H'H 'D yȐD@+RHD?  H #y@c ?U"c4Hz`@>  7 D  Hz@ H"`D 'DHz`@* # D H! #z@r (@ԟ# #Ȓ O@z@?,H" D 'DHz` @ 8   #z@r @0   D 2 ?Hz` @ 8 ?"a㿘!  | z$ |@ P 2$ | #4!2 $ | #z@rZ Xz@֐ $ |㻘@.$  z #`@f z@F@  "#4㿘'H  'DzD@*H HD  H #z@F` ?"c4Hz`@  #4!  | H #z@r Hz`@!㿘'H  'DzD@*|H HD  H #z@` ?"c4Hz`@f!  #4!  | H #z@qא!(Hz`@Q!X㿘'H 'Dz`D@*EH wH #z@ےax ?"c4wD#8@#H㿘'H 'DzD@*&H zH #z@ax ?"c4zD!@H㻘@$`y@  $" @ @    *@ . y#/@ @V 㿘'H  'DzD@)ӒH HD  zD@)ǒH D  HH #z@Za ?"c4z`!@`㿘!  |  $ |z"z"@`$ |㿘!  |  $ |z"(z"8@`$ |㿘!  |  $ |z"Hz"P@`$ |㿘! !  @  @ !  @ @6 㿘# a z@b"X!  " @ " ?"c$ $a " l㿘   #z@@b` ? "c42z`@"xz@7 8㿘@.Ӑ  "䀢  @y  !   "cp "#p@m   D@k 㿐'H 'DzD@)H  HH #z@bP H@#U ? '! #z@p{"@{# h"#4 ! #z@pl"@l#2 J`   ! #z@p_"@_#% @ D   Ga@M @ J   !  ! #x@p@!(@@#@  @4  ?("c4 zb@Ґ  `@֚"@޴DH? €` !   "cp "#p@ߐ @  㿘 z8 "c4㿘 zD "c4㿘    #! z#0@o$!! "#4  ""c4 `# @   *"`"@  ߆b  ր&`ؖJ!$J   J@` J2`@  b @* 2  * J *`؝㿘'H  'D #! z#@@o$"" C"#4  DzPD@(H D   H #z@cX ?*"c4 1  "c4!̒ @" b䀢`  L " &!̐@} , !̔# @+D#  L "  !@+:#  #    *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J    K +`"  Ja1 ׀  . aJ [  \ $ "+2+J ٖ +J $1  "#   "* J 0?L  @`+J@  f +` ` @ "Z  +@  Q  *`A: :  \ $921J "#   ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J ^  J2J 2J  ]`\J <E J ,b ]"4^#   ")+J 0?L ! @`+J@  +`  @ "  +@   J  +N ؀  0 #z@m#x㿘  | ဢ` z#  "c4㿘 zw "c4㿘 zk "c4㿘z@ 3#Ȓ`` #4!`  | "{ #z@m#{@  `  "b㿐  #{@m 0 `@  #  J  #{@mw (0 #{`H@ :# 㿘{@  㿘!  l'H 'D #{  D{ȐD@%ђH D   H #{@d`    #{@m;  l# ߑ*`H * bА@X  l   "@  #{@m"!0 z"#4" " ` $ lq"4*` *  @* *  "@ lbБ* * ` @'% `? "`@o   "Ȁ?̑. :  .@ lbБ*` *   @ƐN "Ė.@`@ #3 #``? "`@E `  &`Ȁ ?23 #?``?  "`@0   3 #`  ` &` #{!X@l ?"c4㿘'H  'D{D@%H HD  H #{@a ?"c4H @& ?   H {#a@ "#4㿐'H  'D{D@$H HD  H #{@za ?"c4H @& ?'H #!{`!@ @!@` "#4㿘 {!{!@ `㿘xx?  {#a`@?`㿘'H  'D{D@$H HD  H #{@&a  H @%ڐ  { ?@"c4@" {L {"@]@E  2{{b @ɩ bH@$:) #  % '   =# x|$H$|  x p @@E< H=# $$| @@E'H 'D  |D@$-H   H #|a  1  l H ߒb  @ 2  l0H #|a0@ ?"c4 `@|/ ߒЩ,`* ` @ Ѐ# "c  2 N+  T`*`:  $ \"B A c@  %*`    * ,  * :`  ?D?#?H,  @3H :  i2D  H,@!H@я@.@`N 2 N @.@# cH@ ` #|@k!H Q"#42N`  #| !`  !    #|!x@j ?9"c4  | ! #@jߐ`#@w cH! ` €! !  N`   #`?"``@* "@@j  @ @!cH'D@'HА* `@2 6# "D#/ ߁?'?#"@|@/?c@"@  |a@I ?|b@r  ??#* |b@r   ??#  |b@q  ?#   #|b @ `@d /  L@ 2,@ 2}|."@` L@  2}|!"h?#"@ %?!?#@ɧ"@%?   J  ` }|"@>20=`@$ ||b@ b@q  |  b@q   | |L  /|"@>0e,@ / ?L@ 2,@?c@@`$@ 'Ԁ??|#@=0G#H@@֒?2 0 ?? :?#|@c   #&@!'Ѐ ?|R!.'?c " @J# 2?Rc$@؅  b ?c:#    ;a@$l?O?@B :&  В@%M?耢 2 ! 7 !؀ 24? ! +!2  @& # #`?"``@* "@@i # " : @ F  @(  @0#?#ؒ@Ԓ@"w 2  ! H !؀ C !`!<  8 " ! :` !2    #?`"@  #* "@h # #?`" * " @h  @#|@<Ґ#@0\@#   | #? #|@hǐ#X#?c@׼ @+ #R!.Ѐ c@"c ? @B? L [@&J ] " J ``:2* @&< :  , !  ?#@ |cx@ؒ @ث  #Ф '܀'  !?#@F`  `#(|  P@@Fy  !|#@8 @  |`4 逢5 541  t , #p   耢` #  ~#a@ #`? "`` ,`:  @* "@@`A  "# `    4*` * ?А"4   #4?     #4 " d   "# `  2   d`  `)    d--  d`("  `-  "#4 "! ,! @&? ` #`  | 4 ! 耢? 5  t ! #`?"``@* "@@_@# $8$  @  #4`"# 1, ""Ȑ @Ӓ #4!a @ #  !Ѐ@`"?П@  ?ô@θ   "c4 㿐''   @~㿘@ɐ ! #  ~""@_! @#  @i  "~ : |?x ؘ!X'l     ?? 8;a'D'H'L'  LJ - ~#a`@L` ~#ap@L "䀢 DH@ L0  ` p  ♒ '''~`' 't@ /X 4  "Ȁ 1 # @̣?&# @(  @!  l@ l  ?"!A"4a@ 'dc$@  '~H@ja  H  #ؐ '`"c"0aJ@ |(~ @ H'~`@ V'  }#@2@ @ݐ @ڐ  a؀ ""ae#'07H@hc`' H~@2ǐ!@ @;  #\'@R  <  " H~#@˒a@ͤ @͡ @b  :@  @͒ @͏  ?@͈ ? "4 l"a@; d1 # # `@Q~D@Ւa   ~D@Βa EL  p ?` @iv    # R  @8  1 H~@2H!   :  l G"ؐ#  ~!    >#  l 7"a~А  ># 'tLD~! ,@ @  l`"!}#؀ @ @  l`"!@  "@pt@ n' @ې? @  `p'`7`` " S ! >`B;!`  R @ 4&@ ! ; !؀  ! 3 !!x * x   | ! | # #`?"``@* "@@][ # " :x B ?x!@#pR @Ӕ$   ! M` !؀   ! C` !`!<`  8` " ! :` !2    #?`"@  #* "@]  # #?`" * " @\  @2#`~H@1'!  ] !3 !!x 8x   | /| # #`?"``@* "@@\ # @# "  :x! B?x   !؀   !   @;  `?"``@* "@@\  `B :`? "`` .`:  @* "@@\x `B :@"`  ! B !؀  ! : !!x  x  |  | #?`"@  #* "@\: # #?`" * " @\*  @c# @~H@0W! @    ~@0K! ??:@7  l`"!@@+ @0 @-  " @&  !`!M  I@ܐ 0E@ @  l`"!@   "Ȁ 1  ?."c4# @l?&# @  ? "c4 " @ !`!  @ 㿘@ ! #  ~""@[ː!@#  l@  "'H : ''X ''?'T ??~'D     :!~ ;'L'P'Xb0'@`?'܀ #  |   H X  HJ - ~#a`H@L` ~#ap@L "䀢   ܀  HD@L0T'#D'䀢 ' ܀@  '@ l +\ H  "Ȁ ! # @ȷ?$#䀢 @< 耢 X@5 X "aT  ?""4a @( 'dc$@# X'耢 ~H@a lHJ |gH@?  U H@ /    H~@/!0m 2,H ~H0"8~"@@   /, H~@.!0O!      H@!  H~@.ϐ!0;!   H@ 'HH 0*!  H@ 'HH ܀    p   0 ` p   L@  :@   @Ɏ @ɋ  ?w"c4@C l #܀   # `# ~! cL  D~!  ~0}#؀ ~0@ݐ ' X 2X~H@a X #!  '5"b`#HJ | @= 'H~ @`'  H}#@.0`0a؀ ""ae# "bH@cP' ~H@.!0#\'h@3R   ! ؐ$'! "؀@# b܀ @4.@4 $b~@-"H$"$"p<   a؀ ""a ""@֐?  p "           R  @  " ^   bܔR @@2     $ P a 斂 <`!B <;a !؀  ! 3 !!Ȁ * Ȁ   ̀ !  # #`?"``@* "@@Y> # " :Ȗ B ?!@m#  R b@آ  ! M` !؀   ! C` !`!<`  8` " ! :` !2    #?`"@  #* "@X # #?`" * " @Xې  @#`  ~@-"P ??:@~~H@,!08H@-"X04# #  @ @d  ` @? "   @c  H~@,̐! X T"!؀"b@q` Ԑ 'l` !3 !!Ȁ 49 Ȁ   ̀ 0  # #`?"``@* "@@XZ # @# "  :! B?Ȁ   !؀   !   aB@:a` ؀ `  @< `?"``@* "@@X ``  `? "`` ,`:  @* "@@W `B :@Tn` Ԁ  ! ~#bh@B~#@X" ! B !؀  ! : !!Ȁ  Ȁ  ̀   #?`"@  #* "@W # #?`" * " @W  @# @   ~@+͐"P ??: @~H@+!@  X T"a؀ "@@Ƭ @Ʃ  @Ƣ @c  !`!܀ `    @M  " u#\@oL@Œ ?j'\@, '`\`H@2'd?_ #!~H"@o2\@sG@0P X T"a؀ "@U  @R  "Ȁ   ?"4@H @E 03@# c ?`"#4@ī $c쀢   @ " @ !`!  @ې @ @ 㽨   'd` 'P ? ?@~?@ ~@+$# ` & P  @,  @ߒ  "#}@*#]  @Mc?  " $  !  ?c d@   ~@*Ɛ#0 `P   7 S  x ,# bЀ '~#H/ c4@p     # ~@V#P ! `$b #~@V#x!~#~#H c4@G     # ~@Vu#P~#!    @?   " d$  #~@VY#! `~c@ D~ `P  2  #4 @     #~@V9#! #\#`  ` @Ā   P  @R *`* @*ÖǕ*@  (P @ 4 , )$ c@h ~ #4 @ǐ 2  ꀤ  #@U pd!   P  ?  ! ĘX#\#`#d#h #l ``\@j P ` ^ \ Z X V   @ * *` *Ö Ǖ*  *`P 6.&ĘȚ̄ІԞؠܢX#\#`#d#h #l#p#t;x;;;; ``\@  #@U 8! `   \  X  #~@Uq#!   @ś˦ϗ*ۅ(ߕ*+ *  Ó*`ӡ, @+`@(+(@+ @ǐ  (P, @$ @6.&$Q$cH@ !  #4'@    #~@U#P! #\  `@  OO@  O@ O@ #@T!k!   P `4@0 4    !  }@(#T!  ! c P@  P  P  R   4'd+ `P c@ ) !Ȁ 24 # c?" @-  @쮒   $c}@(#P+ )%!!Ȁ `P ?c d@ʘ  `P@(! !      #  'dc  d@  # @(!8# 'dc ) d@  # @(v!`# c`P@ `P  @(k!! ! c?c d@   ~@(Y#0 'T`Pc@ ŔT c}@(L#! @  6!@(B!!Ȁ h@w i `    :  x 3 "Ѐ 0 `"'i    #\h!@7  ! !   "b #~@S#x @`P    9  ! #\*   !#\#`#d #h #l#p #t #x #| # ## # # ##; !Ȁ? %!'P'@ P` %!    'dc  d@   }@'# ! @#P?$#  "aȰ p # ` ' '## c@Ԡ  @'o"c@۰ ?$c@cـ $c 'А  @  6c}@'U#c@~㿘 !# ``!2 $`  ($`@ $`㿘@[  c "c㿘' dcp$@)    䀢   ؒ " h  䀢   ۰"`h" !% &@"!  @}2!`. `!  4$ @:! a @6 ! # @0!a @,  &!<a< "&!@a@  "&!DaD p# &!HaH "p&!LaL ""&!PaP a#"&!TaT 8#a&!XaX! "8&!\a\# " @|!`@na`! ߠ" @|ݐ!qaq@n b! &!a# "bؔ$@|ϐ!@na! !$@|Ɛ%e@n @ $ 㿘@ ! #?`" * " @RB @|#  `  "# "#@= h~"0'D''H'L'@|’  '  ! "~!'    1  "Ā   #@ 2 1  p"~Մ ~#  #@R3"0   !   p #@R&"P  ?"c4b  "h`  @ʐ#܀ < eb,@ ~a'DL @ Ȑ 0@ϐ Ð `'nH  ! # `$# Ր @ڐ   #$#Hbp@L0@͐  "#~D@|+b0   "䀢 ~ ! ~D@|b0  !  "䀢 " ! "Ȁ 2!  2 ! ~!$H &0"Ȁ " @  "䀠c`?"Ȁ 2#!  2! ~!H "! Q "Ȁ @ I     ?"c4@m 0J"Ȁ " @А  "䀠3`?"Ȁ )Ȓ  @   R 2* + @ $  6 @%F"    ?"c4@"0 .  "䀢       ?"c4@# xؐ @P    R 2*@ + @ $@  ]  b@%  ?@"c4    㿘@ / ` 1,@@`~"8~"@@ ` /,@+ ~@$ؐ!;  # @PҐ"03a@lː@; .*&`  d,,@: ` 9,@ 0a@ߒ ,:  02 L .  1,`,"ߨ 1 ݰ!x!  @$"    ?"c4@n~Ȓ$   @. R  @`  " @$u" b@ @r ؒ  @   R  2`* `*   $ V 2 * *@$  4 6 @$I"    ?"c4@% V 2 *` :@` V @ $ 4V    #4"(   |||||||||||,|||||||||||||||||||p||||||||||@||P|t||||||P|`㻀b'D  "<# 'H@# ဢ   "`#"`        $3 # % "b#`  @""|#!&`$`@$ "cH  "`x"@n# ")@yc( 2&`$`c0@y 2&`$`c8@y 2$̒c@@y $`&`#H@#!@yגcp 2 ߐ "b@7# 耢 "bJ ! #"b! "̀   "J 2@#~#$"@#ࠒ  @yc耢 c@y @yc 2 #  # @GT  耢 "b  "`| XR @;"c r`p@  k  h"a؀`Bcg#*`   \"c  X"c  " S"`  O"a  ጐ `"F" C"  @"  ?<"a 9" @  |`@yI 0 #!x ,"c   " &"  | !"#<  | "#    @T`! $ t` @    "`  "`| " |@HD@j " D*`" 'DH @    "!'H#""@ "D @ @@G @j"@  v`x@ D $J Hv   H "D3 &; @@&" i@ c@` ic@\ !H'@H'`H'`''D@ 1  t ! !   # "l@NA @@ t!  " t @"`?  ic@) ic@% @F 㿘@ C  "@ 㿘' @ : # a !  " ! R @ @ $ ! # & $a@ @o#?$#$aʐ a  !  " $aR @ @ $ $a "#p $ P㿘   #?`" * " @M { L dƀ`"i,  #@M X `? "`@,   & Ȁ` v si@# aԀ P1 #H@r?  #@M xB 2 L  #@M 9 耢   !  #H #@M + #H "a €a ! " L   # `?"``@* "@@M"  k#@i "쀢 "  j! @MM#@M#  1 #$@U/ Ȁ  D @ nic@1 ic@-   -    `"J@ KJJ@J`J2  "  " `2J@?㿘  %  a   H""# #`# $aԐ $a@ H@, aԁ a J@ b!$   J@ `"#aJ@!fd " J@ "` ?  `  J@ " " J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " b* b #a      "  " ̐ 㿘 U?@%  #`  ! @c 3 bT1 !* ` 䀢 L bT@ubT!*   *@ @ 0!@?  #a  #a(@, ?#aH  @#? `㿘! #   aX@!x@< 8@"`   @V # !"x@l ?@  bh@-b@U` ހ  "a  "@ @Q! &/@u֒ . \Z" 0T F@{ L' ޤ@S :# `@S 4`@u . "@S  `@S$ `$L @u . #@R $@S L@ 0"'@    D ` @, @   ! ޠ!@@%T @gE&@0@ua؀ @ub   !@SR   ?@  ! ޠ!@@%* @g&0 !@5R   ?@  ! ޠ!@u@%  @f&0 "䀢  ) @! ") ހ ") ހ  '  #@J#P l`% ߑ*` * Р *    ``@!  "#   ",  , @!  ހsl `  "@ Б*` * ?`"-$l*` Б* @ * * `"l% ߓ* @А *` # @!E *:  ,L? l, `     #@Jj#7 ސ#@a@7     @,    @y"@v#  !@ 0 #@JB#p  #@J;# @_"@\" !@?㿘! ! T @G!  ` `,3# ހ`"a02.@2!. @-!`"`\.,a2.@!. @! ` ` ` `,퀢`\.La    `  @t<a "    㿘@#ؐ 2 `@ & & @#͐ P &`@ 㿘  @2 *@#&  &`@~  * "  & 㿘  `  @ .` @#` @*@#@#㿘  : , @s֒ 2  * 㿘# a'H  'D  #` DPD@ӒHD   H#`X@g ?"c4! "̀    #<H "̀ H "Ԁ"J `x@ =  9  "̀ H`畐   |   #`@(Ԡ  ` $a@<  " ` @4" " ` @, ! ` !P*P+    ") a  @#x  @  " p"`H  @g  !' ဢ |?$|E! #! ꀦ`!% @rڒ  @rԒ   L? ."? , #a@Ŕ 2,! a8 @dŔ   "䀢   "c@ ߐ "bĀ`  #aP@#x$|"䀢  "#@ ""Ā` ax@d 2$| #@Ho!$|'L`'H  '|HLp| H ?"c4԰ H L -  !܀ ' !!@w !@r@  'H@Ʒ@ 2!'H!@NH@Ւ! !'L'H 2!/'H@  @ƕ@ 2  #a@*  #b@" #/ O@O@j?.@O 2'H'HH Hk"`L 2@!" 'LL\"0``| `@"8'||L"H`` |`?"H @"P 25  !܀ \   "䀢  0' bh @   #H !@05 l ? @ "a  ߒb"`@q l`@  㿘  @$  #@Gu"pO #@b ,@ $ #"@@ON :@̐ ?L@ ",@ V  !@$ $ #H&@㻘    !  ?""`  @$   +  ` ""```"`` ""`0` 2 @ސ" "@J? /  $d !"@gӐ ?@" @b?L /" /, bД @";@ "@ܒj @G1 ဦ |?& |& |' ሀ`$ "䀠`?`@`#@#  `@`# #4@x d   &` "䀠p`?c & |$@P-%`@$` 2 ހ  #@F#( #P&! "` @Nm$  @; $ @p 2.㻘%  B# a 2? ! #cx@@a# #Ȑ@NE$ ,  `H*  R  n"$  p a# y##$@F;#  $a#c@Q @Mc!  h  $ Ȕ ,@O, @V 2Ȁ  @7#@  @p & @ْ @ 㿐# % a| ???$|m    @p $  @ J   "#@  2$|??"$|a 2 $|! # @EŐ #@] $|H# ' - a| 4?$|/  a`1  "    "    2 `@a  2 #@`  2 0, ,, #\#` Ė`X@ Ȓ  ,@?'''Ę?x''''@`?쀦` a   #`x@r$|"$|a 2 $|! # @EC #@ې $|?"%4㿐!  ?@$ `w @?   `?㿘# `  !؀?2$`@ $`h! ߢ"x @j` "x # d"d # :p@]  !؀ + a a1 5 ! @ B `5- -@B2`* @ *`B2*@ *@a  d & d4 d"@r #t?․`@@ d@*@'b@""@#\ @U$@  4`  <    4  a"@ , @@`J@""@` "H#\ B#\@) ߐd d"@'" 'А"@'' "p"p ` d"d" ;"p xx  "x@ # ' "x"x" `'" `'А"@@''"` 腠DA?؅B.'@ @@""@X@ǖ.@@""@@`.@(@x@u"$@!"h <@Đ <@@% ! !` "  aa`(@E@B""@@wx^% 耢 a@5@2""@@gN%  @Lb !!@G?ؒ. ЅąB'@l @@""@X@B.@@""@@5`.@@@"$@!" <@? <@@% R @ِ@E `rc@Y @| 0@w ?`" * " @C @H  |  @  "x"x" `'" `'А"@@''#! ! 腠D@?xx B3? ?  @#  ( !"!` !  "@" !x#\@~;``#(0 B`;h""#p@{ d V! !Q ` M x E `A # !@ D 4: 3@ @>b !@8?px. pąB'@].@@@ d$@!# <@K <@@%   #R @@M㿘  @ ,`@@4 `@* ? ct@ "  @? @I 6C`@,`  #@B8   # `?"`@* ("@@A %`@-` #   ?`"@ * "@Aϐ 逤Ħ`@ 㿐 ## `R `h@?   P "#t  P"ct$`㿈'''' @ 㿘@    ""b' ' %#- /  o|8@P@D@g`Ȁ? ?b* & @ @5@?'`' ''Ж@[  "  -  0  0    ! @bR`aH@: @ 㿘 #aX@!x@ 㿘@l  @8 1' n L  o  @ks = 2*`"@HĐ 2   @2    &*@&a@  @ሠ 2L@V㿘@PPPPPPPPPP||PP|PPPPPP㿐@@Ē /  @ @M @N  ` @@jfa `@6@@E! /* 4 @.2`@@jNb(  / }"`@@jDb0  / s"`,@@j:b8  `@ @ c"!@@j*b@  `@@ S"!@@jbH  `@@ C"!@@j bP   59"#@@jbX  0"!@@ib` 2@  &"aJ -@Ðbh@| ` 2  @"@-b  `@@ @i  5 $$ L "!"```   "b@@.-! /"!! /    "@Gb؀ 2  D4  # 0?4a8' /% /@i  @pa8?$  , , 4  /"0@4 @# a" @t a@-"@j% 5@ @ c @  @ " @-#@] # a  L  2 @ Вc8 P c@@ @  2# a` @    @`@!  @@괐@ "  P "`@7 2 P# 5@`"c 㿘!#H b@@- a@- b(@-#cP@- bp@- b@-|@-y#X@-I@- #㿘 P@  02  @!0@"` P"`, P@o@ P  a@  /  P" 4 P @ "8 P@a"`<㿘 P@@ P D ", Pa@  P "` /  P" 4 P @ @"8㿘y#@}"\@} P  ! ` ,c@ c@ E@ C $@@@@Ր値` P`"  P "`0@a܀ ! P /" `  P""` P c@   " P   @ @ "  P@"`0  a@2  P "` /  P" 4 P&  @# 8 PD@",@ː㿀 (P ,@ @ P     !  #@@.@,@h 2P@,z#0r"` @גP aЀ " @/P`!"`P ` 6P#"`P  "@/P`"`2  : "P  "@/P` "` 2`@ : @:@" P / ` "`P ` 6P#"`P ` "`P ` 6P#"`P `  "` P ` #"` @㿀 P`< `"`, P@E` P   2 ##   ,@ P   `@  P `@  P c@@ @  P " P@ P{a8" P"  P@  P!`  @@-: P /@`" @+ P @K"`@ 㿘 P@@ P`D"`, Pa䀤 2  a @  P"  a@  /  Pb" 4 P   "8 P@"`  h * (`P",f @   @ŐȦ @@,ђ   @@,֐@+C H0@a` z|0Q}0N , `h!T`x `"'Ē`@  2 (#  `@|@,   @r@,@*0  (`P",f @  @^Ȧ @X@,j 2!㿀!܀  ( h P` `,@ @, !   @%@,E@*P&  &  4 * @ w 2& P    2  `@  g 2 @o 2!@*#0e 2P 0 $ 0P <a0 $ ,@pc@@P b@?  4@  @Ð  P $P" P   / 4 $P` 2"`@ 2@"@ / $@ &@`y 0!@*)0 !@*Q0 c@1}"\@㿘@Q(4 @)!8{  @m(4 , 4@ "@=  8W$ 8 @e@@ 4"*@ @ F L, & ` @P !Ԁ "! 2!J , "!@ A & $.! @@6`, $* @@ U $ 2! $@)!0 "! "J l @ & ( !@)x!`0!@)s@x  @`l (* 㿀 (P ,@9 4@ /P     $!  "@ې@*@)iP @)a"(0@9P"@ @P "`㿈 P' /4b "@  @0 6 b 1   P`< " P "`< P < 2 P`" P"H@(  P "@ "< P`<`@)"h P <b@@J 2 P * P8  b  "8@E P: `8@E, $`8 P"f `8@$ P@3 P: f @2`@@0<  $`88 2 P b "8 P "@84@ "@  "8?#  P2 H2 H P# /`H`2`0`'!"@: P`8`@(  / P  0'@#\@[ P}b\ 8@㿀 P@@(" P` 2Z P`s  P' / I! "@@*@(q Pb ,@i P`@ P c@@@ 2% P P   " P@"`@(G"@  P{a8 @Q0"@(;#@@C8 P` "%@ P @ 2@ "@" P` "@ P` "`  P" 2 P !̀ @ "`  P"@(#8 @cp P c@@7@5 P "` Pf " @ /yb @@x P! / 4"@2 b $  P "` @.0J 2 P< 2 P ,b@@ 2 P P`," < P 1  @,cx@  P`@ې P c@@Ґ@А @c8 P c@@Ð@ P "`?08  b  "8@ P: `8@, $`8 P"f `8@$ P@ P: f @4  `8@< $`8 P`   / @ `8 "  "`8 P  ??   /  @$?' 0 P !8 7//    2?0#42H2H2H'!#@8 @' 쀢?" P 5#   P' @#\@  / P'@#\ @ / P ` 8@㿈# /``'! #@8`@&Ր / P 0'@#\@ 㿈# /``'! #@8`@& / P 0'@#\@f ??c  /  @ $@ P %@ @ Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  `@ "  P&  @ " @ " @ "  P` @Ґ% Ȑ$@ `$@ `"`@ `" @ " @ "  P"%   @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @;  P"e Pe!+ !,"e P *`@ P *`A P *`B P@* C P"`D P@Z2`H " P P2 J 2`J P " L P" P P" T P" X P @Z \?c  /  $@A P %@< @? Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  @ "  P&  @ " @ " @ "  P  2 Pa ؐ$@ $!`4@  "`@  " @ " @ "  P ``2"%` @% Ȑ$@ `$@ `"``@ "`@ " @ "    @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @j  P"e Pe!+ !,"e P *`@ P *`A P *`B P* C P`,"`D P2 H P`? `L`@`  P"`L@} " P P2 J 2`J P " P P" T P" X P @ \  / $@j P %@e @ Ԑ$ '  "  ?"   "  " a!$ '`4@   # @ ` "  "  " $ ' `"`` "  "  "  Pf -耢  $ f -'f - "  P& - "  "  "  P`@#\#`#d   @Ϛ  P"e Pe!+4 P!,"e P * @ P *A P *B P* C P,"D P2 H P2 J P" L P" P P" T P" X P @ \P /ǒ $@ P %@ݐ @ Ԑ$ '  "  ?"   "  !" a$'Ȳ`4@  # @   "` "` "` P#\`@#`@n#d P"e Pe!+4 P!,"e P* @ P *`A P *`B P@* C P "D P2 H P2 J P" L P" P P" T P" X P @ \㿘 $ " (@ (  @y,  4  8@q   , @k㿘% / ! @r!@>c $!@## 5#` 5`P " @2  `P`@' @`2`P 5#``P " @  `P`@  @`2`P@p2 `0!   `$ $ `0 5 / 2! !@>ac &!@#.#@z``02  "@zے` @z֒` !`  8@@% @zȒ`(@z`P`$@z`h`,   @z` ,`4  #, `8  @ `@z,@Lo`! / `l #\#` @z#d@L[`  `l #\#` @zo#d@LH``l  #\#` @z\#d @zXa @9 㿘 : d P"f P&@4*  P"f P& 2@"!(@^!` Pf"@ P& 2 P@"w! P&cP"  P@W  P@O P@I P! !@(@$H@6< M @@<8' @  @ h#@@#h 3! P !@@$@  2#( @ @P#@@#P # P b@ؐ@#@( P@ޒ$ P(@֒   P&  V 4M-  "  P O  $0M& `H@  -  # "8@!bP P @ P8& @   #-  "8@!b` P8@t P& @@k,  4 8  -   @ג!   P @= @Z  `p @{ Px@Ihb@+  P& b   & 0!@b   ''''@' "@\̀   "@!* '̔@ "@!!@ "@_ Pρ㿘@ f,  @N̔ 2fJ =2f@ "f@ D 2  @ $f $f@ "f" @@@@  f,"@f 2f@ Ґ"f@@@֐@Ӑ`(@{㿘& "&& &@ {&"&  2&&& "* 2 H-2* _* H* 㿘 /   @ p   " @X"a @ v#00@W @>@u @s @q @㿘! !&@@! !@ #H0@xc࢒ 2!!@ #`0 @#x@x@o㿘 4.` 8@ @ @@}`"v#.` @P  #@ _ @  #@ R   #@ J !ЁJ .( J.  .`.`Ѐ   Ѐ -2 `2J 㿐   N .А ( N   N " @7h "N 㿘1  % `@#7L   "# @J  `" @@" @yؔ` `'`$```\2 ,@ \,@ `,@`` @*L4,@@ 1 0 "$4$4$4$4$4$4$4$4$4$4$4$4$4$$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4$4"$4#,#L#t####$4$4$4$4$4$4$4$4","$4$#$4##$4$4$4"T""$4$4$$,4,,,,,,,,,,,,,,,,,,,,,,,,,,,D,,,,,,,,,,,,,,,,,,,+,T,d,t,,+,,,,, 01<1<1<1<1<1</01<1</l1<1<1<1<1<1</1<1<1<1<.1<1<1<1<1<1<1<1<1<01<1<1<0P1<1<1<1<1</l1<1<1<1<1<1</.ܝ㿐5 @F7 0@#@!"0 @q"@ " <$@" $@" "!"!,""$ $@#" $@$@ $@ $@ $@@ * $@  * $@  * $@ *$@ *$@  * $@  * $@ @9`8 @ے? @]@@@m 5# .  P 2& @ & $ P@I @ P @&  P& 2`2 P%@ ސ0  0@4 ` 0a@0@ P"&  2 P 5#`?㿐! @!!@9G`8 @c? !@ْ @G @"㿐@N>`I*` T @0@  * "@@  *  ~"@ x *  s"@ m *  h"b @ݔ 0``@#`0Z @`@"50R!!@ "K&! @q!@0@b b  bbbb @#10+@"Db && `@l @0@F 0@B 0@ג0@Y!@!@ ;@O! @!㿐@ϐ~   @> .@ @# ) @`:@`: 'a@@;  !x@0 !!8!X@ @!㿐 @^ !!? (!   #,  @6 2 !.@ !@= ,"ۤ ; 0@А!0 @ː!0"@@![ 㿐@ !!"(@: P 2& @d P& 2 L@l L  ?$ L "a@ { "P@@!+0@"h0@? } Pf @㿘 5#  @X 2   5#  @Xz 2 @ `  "@q  `@8 @X,  5c$"c㿘@& & P"@Y  P @ & 㿘!@"0 P"f  P& 2 P"@D  P"0&  @  P& @㿐@ {@"P@ 0@̐(4 2 @"# @(4 0 * .`@$ 0'@?a }@m@T`2`PE0^ ` ` PT"   P `  2 @  2`  P"` ``P $`P/"  P& /  6  @    P@#0  P " P@"`  P"㿐@>`:@*`!| `0 ;&`0@ؒ!@p"(@ 0+&`@  /0$`,@ 0(@ )%&`(@ %!&`$@"~&`@"z&` @"v&`@`40@A#8@Ր@ ;@7"@ːpԐ@   !!? @#X ;"J @F @7@ΐ  @$#@, @V@ .' 6@a@^ !!?2  5@# ;" @ #@ 2  #А!D'  @Ԥ  Ԁ@2#ؒ @ɔ0@* : `2"h*` $@"k@!@Ԕ  $Ԑ;@ @؀ ؒܠ $@|;{@!" @ h ;" @ Ԕ @   @Ւ!Ԕ @  є @Œ!Ԕ @ Ӗ  @ !!? @E ;"p @֐l @3f` @3``  /@3W` @3Q` /@ ۀ ; L@@i 0"`L@` @`AK?@mL@`A ," ;@! 0 @ (0`X @@@ @ *`@ "` * @  2 @ * @ @Ē * &@㿐@   2 @! @T04 ,* ;@!2@a@@|  @!P@ @Uv$$&@@ؤ ;@"@ x@ޒ @~!x@0@3  2@! @[ b,@ &@ $@ʒ , ;@_"@㿘@)  !@㿘 @!0@#㿘(8㿘%㿘ڐ 㿘 Ԓ  & 㿘 5c|  "c|  !@*㿘.   " "㿘 㿘. * * 㿘 㿘 P㿘 㿘 㿘$`㿘{ 㿘 5p "pm$ܰ㿘f 㿘` 㿘f㿘`㿘$ W 5cp&"cp㿘M㿘G㿘A㿘;㿘5㿘/㿘)㿘# 5|" |㿘㿘㿘 㿘P  @  @]"@5ؐ @V"0 5#          2 ! 5 2! 5#` @T)` 2@`2 bH ` 2 "`@b` @S۔ #$`L$@$`X$`\$`T$#     ,` ,` ` @ @ؒ`m2k @6  @"a`H 2  @  2@" @S  @ @$`H$` 'В@ В @@ "7  $  @  ` "bД @` `    "@`  $`  $  "bД0 @Ә` 2T w' 5 `^ `L @ 2`H ?$`L`H``L 2``L #H@s` 2@$$ 5c$@6"c@9 `   @)'` cX@c@##Ȓ@G`      2  $ $   2 @ @  2`L 5#` `0` @@`2`0@&@6 @ 㿘bH `1 5 &#@  # @Ӕ `#`@ @RŐ  P# "`@ `#  @ #  "`㿘 5#   5@ =@ 9  5#  @ /  "`㿘 5#   @k,  5@  5㘀  /  @ 4 1 "㘟@  `$"` "@ @4*`" *  * ?) 5#       \ 2   "@2`2`` 2 @~ @ߒ? /  # 2 /@R  5@i  /@R # `   ` 4`  `\`2 €    ` " @!? #А@ $`  !@H  @d X`@0& X   T ' X #@Q! & \ " ) 5#  '@ڔ # @Ԑ#P 0   @ @Q0a@   a@@5; 4 A A20  T 2,   (@ @Q0 a6@    a`@5 & T` ̐  `   h`  '`' @m@Ȑ "& 0  ( & 0 0@ 㿘 5c   "  2 2"c  5 `  "`"@  2$ @T!$ $  5`$ `  $""  4$  2"$ 5 " 2  2  "㘀 " ਁ㿘@   5!@ 5#$ "#$ $ $㿘# 5c  "$c @ 㿘aƐ a   @!0 㿘  :  :2 @y㿘 2@̐ܒ! 2"!@0" ,  @ """@ 㿘 6 2@*   &    @P  2 @U 2 $&b0 2 㿘 ! 2@n~*  @ "  2  @$ "  2  㿘   &%  I$ɒ    e "  @ 2@$@ !T &@ !%  2 $ $aT`@  `@ 2@ $@ !T`3@㿘  㿘  h`1 ` ")@@L "$@` '`@ @@Ȥ @@" @  %`  @`2` 'L'D 'P$ @z@ @OaL!8 "(@m@@!   $  `Ā !  " Ȁ 2$ ȠD @JL8 @C#@@ @8h @3P @.#@@@: 2,DД @@= @O @@2 @N @@' @N"P@#" @L  $@@ 22DД @@ @Nː @ِ@ @N @ΐ@ @N! "@@@ @ @@D @ @@ @ @@&'D`ȴ 2,DД @@ @Nk @y@ @N`"@,**@[   "'  @6a-  @X @T#@@@@I L$ 0P$ ($ ,$ l $ p $ $ L L'H`L !H @Z   HL@$'L@# @X@ @ $ `@@C# @@N ` $ $'  2"  Ē  jD``@ - ̀ V h  @L8 @P#@@b @ @ߐ@֐ @אL $@Ґ@ " 4`%@%̐$* @*`@ `*` &"`` d "`d@, D hP  "# Ȓ @ 8@#@@ $ @@ "Ȱ P  "" Ȓ @r  8@m#@@ $ @b@t   Ȱ PȬ $ @N`8 @I#@@`$ @=@O 2 < @3 8 @/#@@ @%@7 E <      =  "  : " `<`   < " @ : " @@@L !# #@cp@@  #@@F#@  㿘%   |  `"$$@ & &$ " ഝ㿀  @@ 2 `ɐ# !# @@@Ő@  `$`$@ "`̐$`` d$`d@ 㿀`    2; 4 /  , $5 4 4" 4`4`"  4 8`82@g 2 4 2 4 t?`t @ 2  u v@T`v " 4!  #@L@l@ݰ  @M 4 @@ @+ & <& 8& 4 t ? t`t @  v u@&`v " t@i  " `(& (`4`"& 4`8 @@ & 4& <`@@& 4`<& <&`4&`<@,#`8& <`8 t& 8`h`t& h@ `  ?@& `4 `@`"  `t " @ `" p"@"``" p "` p`2 p "` p` `2,"` pB" `, $`" , `, 4 , $" p& &("  & "&!"` 6 , `",, & ,`,@6" p&& "  &" & " p" `,  & ,䙐 @ `@b  /  'Ҕ H! #ؔ @Q@q@ߐ l` L   &  @> / H'!   @3@S@//'' 㿘   ā㿘  Ӕ㿘  Ȓ˔㿘 4 8     4` 80` 2`"`㿘 4 8 !  8 l 4  4 B8 & ` 2` "`& 㿘 v u    Ȓ u'0` 2` "` 㿘 v u # `Ȓ2 u ` `u``v & ` 2`  "` & 㿘 0@Ő@\ % Ѐ ! $ Ԁ `$ Ԁ` Ѐ  Ԁ  &@&  @JW & @–0 @㿘     㿘z  @@e@7$`㿘  `"` "@ u   8  " D 2@A ` 2 u@`2`2 @2 㿀@   `" `$@@@`8 @@@ @`2@t   ``@l ` " `@B ` "@@ @5`@`㿘 "` 1   1@ @h $1 @ߐ@ܐ :,`"@ ,?  1  a@I 1`!  !@@@E@7C (#ؖa( @/]@7!@@75 , @/R@,!X@7* 0 @/G@!!h u! t v!@ h`!`!@  㿈 @! ` @! `@ ``` "@ `` '!"(@@ `!'"8@@ `!'"H@@ ܐ`!'"X@z@ Ӑ ` `"h ` ` `! `@ #\`l@ Ő""@ `,  ,` 8  #,`  4   @ "@ ``,`"@ bЁH  P */ @ aؐ@g8$@  *@ @g%$@ڠ@ ?㿘 % !,  "@ - " ` @   2 ,`  2@f @wz   ` #c @@ `@ #p` Hbl@ # @ v㿘 5# 0 & 4#   ~  ###@  㿀 '& 0bq@o 6@ @#  2 0@ 5  0 bp@Y䀢 6 0@ * @ 0bf@N @  p @& < & 8 <@   /   (& @& D#"D 0 ''bg@-耢 6 5@   5#        ###@ I x\a'@GА  '#\@z@ ``#\@ #`' 4 '''@谒 @ !㿀  @ D@2  D 0 8@։ < W$ @$ D D @"@  8@ @d  @ D <$ @*`2 $ @37 $ @ 8@  6 @ @%   8" $ @  '@   @  $ @"  ' 8@&@  @$ @ $ @ " @   㿘&  @ 5#4!㿐# a  @ $!(!P$a@x 2  @ ! $!@ !X!?c' @xɘ  @ !!` ! 2 @ !   ? ?  //'/77/77Β  @ @ 7 !  @Q  6  !'Ġ!@Ē@  `?p  'Ԕ%ܒ @uԔ /@ "0   '' @s~`~~~~~~}l~~}~~~~~~~~~~~~~~~~~~~~~~@~~~~~~~~~}~~~~~~}|`~~~~yzzzzzzzzzzzzzzzzzzzzzzyzzzzzzzzzzzzzzzzzzzzzzzzzzzz㿘  4@( b @  " &  `@ !؀  `l@  ! `,@ @㿘@u@`o`@'@`@ ',!  ##, $#"(@ @ ##  & $#@ "X@ "@ "0M@ "J&  8  4bM   #, @ "@~. 4#"@b 4 2  #, @ # @~k@@@~f@$@.&%@@ ` @ ` & ``d "` ! @ S * 2 \ !* @8Ȑ 5*@  6*@   3*@   8 *@ !` `! !,8!(@~ `  !,8!(@~   !   c@~  ?"Т@ y 2`@Ȁ#\#\#`@e"  &`@}ސ` T` *@  N`z 4 * * **?"А`@@}”  ' @`l@@} . . $. @`l@} ?bА@' @}`,?`l *@ * ?`l㻘\'H'P @q$ i P ,`"_` 2[` %@ S``  # , J t ` A  `<`    '@ 4% H ޖ-* ,@@}%@@* ,@@}@  @@Ȧ`@Pp;  ? a' #H@+  , c .    a@j  .   @+ @?* : `3= |*` +;  @N@ @  "@ N@ @ J  2`@ x t+?+` : @*?ِ t+`+?` ` `` @ #@ c .  `J @ #.  #@1c` @ @#p쀥@@  #.  &@א#@ @ #.  ! @&@&  @a @ʐ` ?* : `6*`#  5 "- 1   "# @J  `"@@"@a8  `'`$```\2 - \-  -  @*L "i- "- c-@ '@XԒ@Bޔ! @@ ! @@ @aPk$D! H@ * : ! H@ * 2 @a:U$.LH@a/ H@a' P@a  X `@B,$0J@ h@~̐@~ɐ$`@  : -  @<ؐ`- @+ a@ؐ 1#`` @ 06 (8@U'''В@{Y 'U'̀  " 'Ȁ ۡ m ,    " `Ƞ  , 㿘`  2&@L && 㿘  " " "" " " 㿘! 2 @.!  &@& 㿘@~/ !H 쯒 쪐 $@!X@AҔ$ $ $ $ 㿘!츐 쏐 & @! & @zȔ& 㿘 `?2@; ,@ 2(``ah 2`@ѐ!`@z```@z``b`_$``` I$`k! 2 @! && & 㿘  4$  Q"  && &  㿈 ' ''0 @+$ 쀢$   "0  '  '@' " $$ $ 㿘`"``0/`!0*!@@1̐&@Y"@1#㿘) / @t@ 2*  "      @/"` @*"x  @$" @" J < @ "  `,`@ 2` @] @"Y 2     <(& "&U&&   @=,`@ @y` @@ n&&@㿘" $@@y] &h0@T$<`t t̝㿘 + +  5 57 + + 53 5x 59 5&&&c "!"c*x* '#㿘 ? & @WY  & +a 2)"a`  5 +! @  +!x 5"c" + + 㤒 "#!* +̀Q  5c*?c*@̐ "́ 㿘4:   "#    5 -  5 5"#"c@Ғ0F "#     5 5"#"c@06 + 5 5 +"#"c"*++  +! +!   5#  #  # "#    + # "@\ +2.  5 5"#"c@\㿘 +aܠ +! 5#  5# 5"# +!## 5"#  #a 5c 5"c  +!$㿘) +!܀  % 5' 5# +$a! +$!k%!a؀  5# 5"#$!$a$$!Ԁ  +!&!܁㿘? 㿘  !* %%`@4"% +!* `\`"  +%2 +@#% +! +"a*!㿘# +,a  א x   "#   D  a@y  + "aa* %%2 +@#8% +! +"a*!㿘! +,!! -_ "#     "@G  + "a "#   D "! !* %%2 +@#h% +!* +"a@㿘N   H*  ?* : `#*`  c@ !Oc@ !Fc@ !6c@ !=c@ y!?@cЀ sq!M c@ g!@c@{ _!7c@s W!9@k`  O!" `@a E!` @Y =!`(@Q 5!*@I`@ /-!I `P@? #!C`X@7 !8``@I  N  !: @"`h !`x@4 2N  !`@  ! @` !! `@ ް!`@ ְ! @` аΰ!4 `@ İ!`@ؐ !@В`؀ !K ` @Ɛ !`@ !%@`耢 !' a@ !a@ !@a !H a@ v!A@a( pn!1 @a8 ge! a@@w [!aP@  2T aX@f J!;@^a` DB!< ah@T 8!Bax@L 0!a@D (!#@<a " !N a@2 !@*a !& a@  !G@a ! a@ !a@ !+a@ !,a@ ڰ!.a@ Ұ!2a@ ʰ!3a@ސ °!>@֒b !J b@̐ !Db@Đ ! ` @ !b@ !b @ !b0@ !b@@ !bX@ x!/bh@ p!)bp@ h!0@|bx b`!E b@r V! b@j N!-@bb HF!$ b@r   b@O 3!b@G +!(@?b؀ %#!Lb@7 ! @/c !5 @&c   ! @` !㿘! -#Ȑ'H'L'P'T'X@$ ,#Ȕ$H@- / $ c @H! ! "@w@X c( @S  @4c0!  ! #!xc@@W@sf@~ 㿘! -#'H'L'P'T'X@z$ ,#Ȓ$H@- / $ c @  !  @w@ c( @  㿘! -#'H'L'P'T'X@N$ ,#Ȓ$H@-x / $ c @ߔ !  @w@ c( @  㿘! -#'H'L'P'T'X@"$ ,#Ȓ$H@-L / $ c @ !  @wW@Ð c( @̾  㿘  %`N m`@1 @Ys &@(. *` 2: .㿘 ,#'H'L'P'T'X͒$ 5## 5! -c#P$@YFH$@,1 / $!#  @S $3 5c @Mc P   5c  $"  @?c` ! & 5@v@O #c( @I c@v֐@B  @>  5# c@7 ch @2  5 "c 㿀@'@@@s| 0 ' `  @ *  @sg  x@'ؒ@s]  ?` ؐ8 @  '@sD 0<     *  * ۘ?@s/  㿀@@@'@s! 0 6  `  @ 2@*   '@s   x ' `  @ *@*  ܒ @r ܁㿘@2  @``?㿐   .# cp'@6  .#@9 1 .#Ȓc@9 1 .#ȁ     @ ?8" *@  ? @ (8"?(㿘@x<*@ * @`@'   \7///''777  7@ @rs   & / *`77ܕ277ސ  7ސ@ @rR  &㿘@㿘@@5 . `* & x  3 .c  h&c@y 4h?c#&c[& @#ה %&5 .``  &1 .# ?&#@y 4??##&2&#"` ` ` *6`& "=! .# $# 1 .# &#@y[ 4?# H[#&#$#?@ 6㿀 /   ? ?/7'  @g  Ԑ p #?'c @j  6'Đ 'c"@j}  c Ȓc @jq  6!@  6'!8'  @jZ ?   -!X  @jJ ?   -!  @j: ?  -q!㿘 5c`& 4 !耢 """ 㿘 4 @ʚ ? "  3"0xb`x   4&'ܒ @g܀ f"㿐@p 㿐@p  g( 3f+gf# g( 3f+gSf#㿐'@pє 㿐'@pɔ 3f g2`* *#3f g2`* *#㿈  @p   @}   @p  @} (7@@p  &㿈@@p @p   .. 㿘 H% 6$DD "` P  , cD , `" @  `Ƞ    5 a"#D#潔 㿐  } {`0 ; ` ` 0?ޠ㿐 ; 8 x̐ 㿐! (  @sC@ڐ  /  @s6 @6ΐ 2㿐  e !!? !  H @s@楐   `@s @6@r@] .1 ."Ȧ@惐 2ِ! ,@@r$@@o@@搐@ .,@ 2㿘 &@` . @k @ 㿐!$" !K!0 0   .@ .@ .@~!H01'  : @@  & ( `@Hg!p` `.`@oL` `" @@|8 @3 ;M!㿐!?!Ӑ0 @ 㿐  `  "@{ɒ & @ܑ:   2! "b ! R } {"b! ;"q m UR?Ӏ! ! "(vW  @R``: @q@冐  ܐ"H@q @5|  )@{R & @e:  @"h@``: "@&@`&`:`@n$ @l2㿘L@ -  `2(L@L@ 02# L` x ` `  "#@   `""" L@ `` ? @ /??Ѐ@zL@` *  *@ & " # ## m #P## a #  # %.( 0! 0E0, #  # .2`00+`Đ4! ː# ;" \  @'!! # ;" I @Ā'l'ܐ8'ܐ  / #؀ ;" 2 !   ;"԰ "а @Đ?'ؐ / } ;"  ֒! m P ;"  @'ԐÒ! Z p ;"  @'А : G ;" ؐ ! 7 ;"z Ȑv @s'̐ : $ ;"g c }!  ;"W S @P'Ȑ''h ; xB ܐ* @*`@*`@,ؑ: `  `?Ԁ`Ȓ *`    ?* @*`@ *`" * * "@*`@ @ *` *  * "@*`@*`" * 㿘@7ttttttttttttttttttttttttttttttttttttt8ttttttt@tHtTlh!J - @3`؀         %!571 3 2* @€a   ` @  @@c ??@Z  `! @) @f  @`@ܵ -@~^  @R@֊ `ؒ @ "!! @  ` @ "!0@x aHa@@Y<X @ @o ?2 a`@s @w  @w !p@ ?J?@?D @ !x@ؐ?@~!@β?2@v!@a ?2 @l! @m @m@m  $@u͐Ȓ@k ̔`'̒ @g  !a@@ @ ?@ ?  @<a" @} @p@}   @},  ?@ ?   0@Ga@@ @  .@.. . .. tmp dbxrun . .. tmp ... (=   @=׍{Y( @@=@@<@`dT U=@@;(((0pLl A='V='V=(;gNAA=3%=4s=5 R C=4s=X;=X; A=4s=4s=4s !=X;=X;=X;/tmp٦SG?y)# D(.} 1옅0 aTks)8H+B7vI a1'|*"v*ϱ6<Cv=-g4x]gCvm]Z:l AaO=N2|?n8s)ǩ6k5L b3k6Q&6L! ץ c?X!@eؐ 㿘! #b@N*!x@uT 㿘@ 1㿘 7!X 7{ !x !x 7  "ap  @"   7=!xt @ 6 @0F S" '   >% # cX  $cX" @ 2cX@0+ @ "8cX? $cX! #d  @ #d 3 @ / $?$ $cX! #d  @ #d  7@Ґ  7!t @  !x@/ "H@  0 >  B=!x+㿘@ᄐ  @/ܐ 7"8N 2 #&@+"`+ 7ap ' 7t @r  6t@/ " @ ! 7: % # cX Ġ $cX" @ 2cX@++ @ cX? $cX! #d  @ #d C?@ ??%"Ȑ?$Ā $cX! #d  @ #d "@Ґ b@eєb 7"bL  @^ & @ K &  @` "  "J`@ T 㿘 7b% 7   9# 71 #X`&#Xb@ܠ,  2#X@* @y #X? &#X! #d  @F #d  ?@y ?$?$b &#X! #d  @1 #d @d ✰ b* "  $✁㿘. 7 7 6%3 7; 7b 7b⬵. b bb  ! b ! 7 7  7("  " ""(@""⤀@  7*``"⤁㿘! #X# 7` 7 7 7 7b$#X""#"@#b#X$b? $#X! #d  @ #d @ܐ 㿘N !`(@ @@ $`( 2@) 0@/ 6N(? ! @c   #`@?6   @)ؐ H@?0#` #ax ` h @G 7c&㿘^ 7b 7 7 @ "`?ܮ cP  `  #""m 7"#RcX 7`&cX cX? K&cX1 #d  @% #d z?@X v?`$`c @ XcX? +&cX1 #d  @ #d Z?@8 V?X? $X3 cd  @ cd "@$ @C 3  :?    # p@גaxⴀ  ܀    # @Ēax܀ ⴀ  "    %"%cP`&ܒ  " 㿘 + 7O- ib  ?/ 7# cX  $cXⰀ" @Ӓ 2cX@( @ cX? $cX! #d  @y #d ?@ ?%b?%Ⰰ $cX! #d  @d #d @ Ⱃ,*` 7 "bP " ? & @A  &  @ b  ? 7# cX b $cX " @l 2cX@( @E cX? 4$cX! #d  @ #d B?@E >?%b?%Ⰰ $cX! #d  @ #d  @0  2  7"*@ @ @(R @ ? / 7Ⱀ *@ 7 "  7*܀` 7"` ?㿘N !`@+ @?@ Q`2@(  В@2 6N+? ! @   #`@=b   @( @?0#` #ax ` h @E&  㿘 cP  `'@&P- 7+ 7) 7 l 䀦@ `b܀ " *@ @ 6@?`@P ʐ  " 㿘"  ! ##P  N@`  N@@ɲ` @' @La?#P 㿘 7"ԤJ Ԧ"@~  &Ԑ?& c ?+ # cX  $cXc" @9 2cX@'V @ cX? I$cX! #d  @ߐ #d Ӱ @ ϰ % ?%c $cX! #d  @ʐ #d @ Ԕc@ac @`* 5?@ `*?@ &   7"Ĭ@ J  @Ɛ   ?% X  $Xc"" @ђ 2X@& @ X? $X! #d  @w #d k @ g % ?%c $X! #d  @b #d "c@ c@a`c@ c   = # cX c$cX" @؃ 2cX@& @\ cX? $cX! #d  @) #d  @\  % ?%c $cX! #d  @ #d c@G c*&c㿘) # ȴ  3 7/ 7? %@?q  % ȀX' 7 >+ 7! #X  bĀ$#X" @$ 2#X@&A @ #X? G$#X1 #d  @ʐ #d K?@ G?$?%bĀ $#X1 #d  @ #d b@ bē,`*` 7 "b܀` 2c b&c*@bİ  @ ?@%!8@!@ %Ԑ ?6 ?6 + 7b*bİ%ԁ㿘 @#!X ! #!x'   `@ `@b!  !  ^*`: \! `?"`` ! @  ! ` \?"``! * $! @ \N``!h@'J ! "@?M "`  ! ]* @ے ^! 2  0`"@  ! * $!  @’ !  82  0`"@  ! * $!  @ !   0`"@  ! * $!  @ ``N?"`` ! * $! @~ J ! `?"`!  * $! @l  $$HH  xTDx   x 8\TT㿘  @%!'8'D'H@B"H 7"c@b9   H J r`? "#\/- 7' %  ! ) #+ "$` x p"|0 0 %@ $#PH!x`t@A@h HD@VL?• s H*@'HD" 'DD`HJ@-D  `"#`"H 'HD'D@^ !  $#l @W   <      @]A @  #$#l@ِ! @ @^_ Βa@jE ͒c@jA  @j> Β`@j:  7@\#`   #"@5axW" L #D  +"chHJ@%H@@ H w   #l`Ð ) #HJ@!# #H #p@%)  #D  #ax@"0H@J2 "8 #l` #  #! ?% # #! 7 75- +') 7;   7T Pax@@  7# @Ȓ@\Ȑ ?' 7  #``ax@0אbXl 2 T bp∐ #@@Ö V  ?&P  7"Ē J  " ? ?5  7@[""ذ ?@H & ?  7c@Z  7?ax??l+(ax ax&@e0bXl!  Tax bp∐ #@@s 0 ax"P∐ @@h  ax@C0l`h T bp∐ #@@T  Z 㿘 7 7 7 7"b"""    7" "&"$$"J`,`; "̐`;#"$c@ "̀ 4  &"" "$Ȁ ?㿘 7# # 7 "$bb#  ` bJ?`U!ؓ*` €bԔ`$bԘ "#b `$b" @  ` 2   @  @$<#@r" - ^2q o&  `2Ŗ - ^2d b?YbԒb@Ӕ  $<#RL"GbԀ . 4$bG㔀?@ / @`? 9bJ@ `$bԀ+bԐ`$bJ``@$b԰  (? 7bԀ ;̒` $b" 7 "b 7"bԀ ? 7"䀢@ "j?\ 㿘   ! 7 "$""#  ` *: `p $"#0*` €  7J`n" `p`l   2  $" $" $"԰ "J ` $"" 7"؀` 7@ 7@ b΀  7c @ْ Ӕ  7J`n" `p`l   2  $" $" $"԰ "J ` $"" 7"؀`2 7@ 7b 7@ A &?@  ? 7c @   7J`n" `p`l   2  $" $" $"԰ "J ` $"k" 7"؀`2 7@B 7b 7@  ^ 7b   2U$0S 7"` #``"K? 7"̀`A""# @ `7#@ 4 J`n" `p`l   2  $" $" $"԰ "J ` $"" 7"@   & ?@ &? 6L@?  ! #p@". L@  @ J#p`#  #pR &ݰ?@? 7  """"b 7"̀`ɐ""# @ `#@ "?L@ ! #8J`n" `p`l   2  $" $" $"԰ "J ` $""L@ ! #p@!Ŕ @ #p@m0 7"؀`z#P 7"@{  ug G  jG V` `&  7J`n" `p`l   2  $" $" $"԰ "J ` $";"ؐ`% (  7"̀`,"  7J`n" `p`l   2  $" $" $"԰ "J ` 8$"" 7"̀`"  7J`n" `p`l   2  $" $" $"԰ "J ` $"ې" T " "T J`耢 Ҕ` #!x@<bP0 7"`"  7J`n" `p`l   2  $" $" $"԰ "J ` $"" 7"؀`b@sb@?  7c@    7J`n" `p`l   2  $" $" $"԰ "J ` $"e" 7"؀` 7@< 7 7"b Z@ H " 7J b $"G" J`n" `p`l   2  $" $" $"԰ "J ` $"""=b@ @  7c@   7J`n" `p`l   2  $" $" $"԰ "J ` $"" 7b 7@    ? 7c@  7) 7"Ȫ"  7"̀`b` 7"䀢@6%"Ȑ" %b #  7J`n" `p`l   2  $" $" $"԰ "J ` $"" 7"؀`@p@ -  7c@   7J`n" `p`l   2  $" $" $"԰ "J ` $"c" 7b 7@ R  ] [? 7c@Y S  7J`n" `p`l   2  $" $" $"԰ "J ` $"-" 7b 7@   ' %? 7"̀`"  7J`n" `p`l   2  $" $" $"԰ "J ` $"" 7c  c  | 2"  p " 7"̀`ߐ"  7J`n"  `p`l 2 $"Ԁ"J ` $"" 7"`? #``q0"# @ `2 7#"̀` 7" 7"b@  J`n" `p`l   2  $" $" $"԰ "J ` $"{" 7"؀` @R J#p#p` L@ ! @ L@  @L#p \# #p 7"ɐ &T?R 7"䀢 N 7 K"b#' 7) # -J` >"J`g" `p` "0+`9*`0&`r 0$" $" $"@d  @@`J% % ?$`"Ԁ   `2# " "J@   J` 2 ##X ` "#X @ s  X? $X! #d  @ ސ #d ɰ?@  Ű?@  @@   "`x% X? $X# cd  @  cd @   #  `@ B` &? 7"؀`` ` ?$`` $``  ?$`% 7 7 J@ n" p l `2 `` ` ` "$"Ԁ`@f `  7J`n" `p`l   2  $" $" $"԰ "J ` $":"؀  @  `@ "  7c@. () 7# 7" b ! 7"̀`b` 7"䀢@6%""$b  7J`n" `p`l   2  $" $" $"԰ "J ` $"" 7"؀`@@Ԁ  7"̀`ؐ"  7J`n" `p`l   2  $" $" $"԰ "J ` $""@ "J`q`Q"Ԑ $"԰?"# @ `#@  7"̀` % 7䀢  7 7"""b@  &?  7J`n" `p`l   2  $" $" $"԰ "J ` $"^" J#p#p` L@ ! @ L@  @L#p F# #pW## 7" 7 b~ 3䀢 7/"""`+ #``'`q%#? 7"̀`"  7J`n" `p`l   2  $" $" $"԰ "J ` $"" "cP 7# 7 "@` " ?ϐ "Ԑ @(  @<#@   " " |ϰ?" |  7J`n" `p`l   2  $" $" $"԰ "J ` $"" 7"  7|b@ | @  ?  7J`n" `p`l   2  $" $" $"԰ "J ` $"m" 7"c 7" 7"@$ 0a 7"̀`X"@H U  7J`n" `p`l   2  $" $" $"԰ "J ` $"/"Ѐ! 7""P@`"@g  c` "@#0 7# 7 "@`  7b @  ? "#p;?㿘 7"̀` 7 7"""b"b 4   7"䀢   "?㿘 7#3?1?% 7) 7`  ?,䰒 cآ "܀ ` ꪖ   @|  cڀ` ?㿐 7"J@ 6 "$bb#  `   "8 $bJ@ !`@r$bԀ ' ! 7""P@9`c"Ѐ  [ '  9% 1 #X"`&#X@ʸ 2#X@Ր  8#X? &#X! #d  @^ #d 6 @ 2 $?$ &#X! #d  @I #d b@| b'J@  " @``* '#"J@ "*@@  㿐 #\`' H  7 `"b ?  `  >- % X  $X" @A 2X@^  8X? $X! #d  @ #d ?@ ܰ?%`?% $X! #d  @Ґ #d @  !*@J@ i / 5 77 7J@ !T %` < ! #X $#X" @ #X@  Ȑ8#X? $#X1 #d  @ #d ?@Ȑ ?%`?% $#X1 #d  @ #d "@ " *@"ԦJ \%" *@'"@ J` >! #X  $#X" @ə #X@ s8#X? 7$#X1 #d  @@ #d 9?@s 5?%`?% $#X1 #d  @+ #d "@^ "  *%"Ѐ 3 7J  2 `` =% 7! #X  $#X" @F #X@c  8#X? $#X1 #d  @ #d ?@  ?%`?% $#X1 #d  @ؐ #d @    @:i" @`*b@@ \" Jcp cp@6 @U'` ='! #X  $#X" @ #X@ Ð8#X? $#X1 #d  @ #d ?@Ð ?%`?% $#X1 #d  @{ #d @ ?? ' @`*@??'"Ԑ`%"ԔJ` ) 7# C3 7% X  bЀ$X" @ȏ 2 X@ h 8X? ,$X! #d  @5 #d .?@h *?# P?0$%#?&bЀ $X! #d  @ #d @N @QNb 7b""*@L@ ! % 㿘 7 #  "c / 7- 7' ؀  7 ?" ` Đ J?`  ` ?5` u s?bN   J ` "Ԕ" XN .XN  XX   $X! B #X? $#X1 #d  @ #d ??@ ;?##$ @ i #X? $#X1 #d  @ #d ?@ ?X 7? " $X! #d  @u #d {@ w؁㿘 7"    he@T% 73W ) 7`!P@ =/ % X  ࠀ$X" @Dž X@ _`8X? ~$X! #d  @, #d ?@_ ?%!P?%ࠀ $X! #d  @ #d "@J ࠒ`@PI`@@@ % 7P` >/ # cX  ࠀ$cX" @: 2cX@W  8cX? 2$cX! #d  @ #d c?@ _?$P?%ࠀ $cX! #d  @ː #d @  xࠔx* * @F ! <?#X?`# 7$c2$#X c @s #X#X? $#X! #d  @ #d ?@ː ? 7? " $#X! #d  @ #d  @  㿘 7" 7b    7"Ȭ    cX   "cXb_ 7"cS @     @  cX? %cX! #d  @2 #d N?@e J?1Ȁ *'#  7@#$@" "@ $$$" " 7"؀`cX@ؒcX 7? " %cX! #d  @ #d  @  㿘! 7"  7" 7b " ` U" S`& "N  E1 ) 7#X`@&#X #X䐐$ @} #X? &#X! #d  @ #d )?@֐ %?#X ?%" &#X! #d  @ #d @  䇐  ` 㿘% X $X @9 ) 7X? $X! #d  @^ #d 9?@ 5?"`@  W?T 7"؀`"""&@X?$" $` 7 7 %""#"`$X! #d  @* #d  @]  㿘  7A"$?"`@  @" # 7 `$c 텖 &?@@ 㿘 "c` ` ? 7* b 2" 7b "b" 㿘 "c  ` ? 7b*@  ? 7"􀠠  7  " ""``$ 㿘@ĭ     ":@  8 㿘"  N \2 `?㿘' ਤ 9) ! #X"`$#X @ĺ 2#X@א  8#X? $#X! #d  @` #d . @ * $ਐ?% $#X! #d  @K #d  @~  N`\  `*  *  㿘 #X `   ?d * @"d@$`㿘 #X `   ?d * @"d@>$`㾘 #h` 㰐  d? # 7b* * &"d#    ! 7# @PO  # @` @ b  @ 㿘 #h` @ ?d *@*  7"d#`@K?㿐 d? **@! "d `h @O8  ` " |` " $ 㿘 #\`" N ! `@ @ /   H 㿘 7J@  2  `"J`   ! " :"툐 5"@5  . "   x`@Z  @T   $"@  g 0 "`x"@uu " " @_V!'"@\ $"㿘 7"ԪL@! ` "b#* :  [ \  L@q   ``L Z L@ ` * b) $" >' # cX  $cX" @4 2cX@Q   cX? 5$cX! #d  ڐ #d 2   . %"?$ $cX# cd  Ő cd b bԔ@K 7*@"܀ %b!  ⅖ J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] 㿘&@&# 7bJ b 7"#5 @7 b0?J` @ (&bԐ $bb @ϐ  @  @<#@$&@b!0&@ ?*:  g2 `$bԒ & 㿘 7bԪ "bJ % J*: @b! 7#`%b9!H#%bbԓ*J :` % 7y) 7#` 7 ! #X $#X" @8 2#X@U !h#X? $#X1 #d | ސ w#d%#?$ $#X1 #d  ϐ #d   * *:`$Ԁ` `J `\'b **@: $Ԁ ` 7"؀`b # ! 7 ?6  " "ĐJ?` 2 &M bԕ=J@ ##` =! #X  $#X" @ 2#X@ߐ 뛐!h#X? $#X! #d  h #d    %#?$ $#X! #d  S #d  7  7"#*@㿘 7" 7 7b   " u + #` 7&#@ &{?]#  g 7cX#`%cX# ߛ cX? W$cX! #d   #d X?: T?##$ @” cX? 7$cX! #d   #d 8? 4?cX? %cX! #d  ѐ #d # #"bȒ"@ # %#``!x ?`# ? 㽰ި   /  7b܀  ` s `'  @q 1- 7+ 7`  @qΘ   [$ ># cX  c$cX" @ 2cX@ z!hcX? $cX! #d  G #d ?z ?%?%c $cX! #d  2 #d e ܀ $  c@I\ @ʒ S$ð? = # cX c$cX" @J 2cX@g #!hcX? $cX! #d   #d ?# ?%?%c $cX! #d  ې #d  ܀  ߫ c@I$ L >"  = # cX c$cX" @ 2cX@ ̐!hcX? 0$cX! #d   #d C?̐ ??%?%c $cX! #d   #d    $@2 ܀`限!?܀  F c@Hc !@*@! @*`  㿘 7 7#c - 7+ 7/M &A \` `" , % X c$X" @t  X@  NhX?$X%?%c $X! #d   #d @I @  7㠢`*@#N M 0I 94H?Ѐ4D* @  "@@ , % X cb$X" @&  X@ C hX?w$X%?%c $X! #d  Ȑ #d @ @=  7㠢`*@4# *# cX  $cXc" @ cX@  9h%?%c $cX! #d   #d c c  *@# c% &:M ? # cX c$cX" @ cX@ ϐ !hcX?$cX 2'?! #d  V #d ? ?%?%c $cX! #d  A #d ct c*㿘% # b!   "d*@  *`@l$b $"*` * "$*"@ *` "*"@ *` &  $@ n *!@˰ @."$"$b㿈  7 7⠨ c 䀢?  b? !? b   7 "b  cX " "cXH ("@*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?„"2  : * "2(@*`8: @@('`'`*'  #@ #` #`# # #  7"؀`XX"?%%"%b$⤀ $X1 #d  A #d  t  㿘 b ??!"b) b* @*`"@ ✒@ ``@ ^@@I@✒??$ 7#  7"$ "b""㿘@/UVVVUVVVUVUVVVVVVVVVVVVVVVVVVVUVVUVVVVVVUVUa@  w"c'4   /# w! w+ #' w; w%9 w'0+8 *&* d@€ '4   '4  '4   % $c$#̒`@ER`$# $cĐ $ؐ 'c@@=H؀?Ґ? * & @ @cԀ    a@@?  b 4 b @@3    2 @`ܰ? w"c@K * 2 #'#@Kz`. @@H# bh@@ X@D@H$ . *X`$,`0%`&@@?  ` ?b@ <  -  ?@?% cԀ 2 @  @ @ϒ@@@@@<  2    cԀ " @&@O9㿘@ / 2N  2  N /"?* N /2? (א@Zd   @ 1-  " ` `0``!`@"@Ғ `@̐" ;) T`6 2``"`$``" @ b "`` J`$`/T"L? / /,  cX$#  ,"@   @ $,#X@+?`8 `@X  2&`@ w#؀`<  #`@'`@@L '`@# '`@@L$'@ "@20 @2`"@L`@<`  @\& 0<      `#@/#Xx  < @@ w @[@O0`@K(@[@XZ #` w#Ԁ` `@#P@[ I #Xa@EՐ  wb@ <  "  w   "bX@ #؀` `@@ 2! #X`@@0 w#` @a  w#` @4 @/ 2 @Z^ 2`8 cp@Y 8  " @8  `??8` @9 2`@`@U# ` -  w#Ā``@֐X`2G w#Ā`2B w#̀`9 #!xc@&WX?P`? "`@! ?P  $?P ? y# #``? &`@!`  $`Ȁ` 2` y YX@Mvr X$ X &@9D?2 7#@X'# )@>@ @ǔ@##@ܒX ` `@Ԑ#   w@M=@M: 06#؀`@ 2#  ,  w# @ @;Ւ @ w#Ғ o*@ @8 #@X @M @M  #@X 㻘  @:#?` #,@ 3 cX@  # cX@H #@p 0  w#؀` @ @㿘` 3 cX@  #cX @G #@M   w#؀` @* 㿘` 3 cX@Ő  #cX @  #@(   w#؀` @ 㿘 ! w  /6 $# #@Iג#$  #$  $@I#  "`cX@ː  #@ `  @y    #   @]`#    `#@ޒX  <! @6 `  @7ڐ   $`@ X #@ƒX $`` D@> `0@jHX  ` - D  @X 㿘 #X @    ` @  㿘#! #!xa`(@$a@$``@KА 㿘@m8m8m8m8m8m8m8m8m8mHmHmHmHmHkmHmHmHmHmHmHmHmHkmHmHmHkl l$mHmHmHmHlXmHmHlmHmHmHmmHmHmHmHmHmHk|kkkmHkmHkmHmHmHkllmHmHl0lHmHlmHlԝ㿘 # #!x`pp@$K 㿘 # #`P` h@$<!x !` !#x@$0`x  2㿘 # #`P` h@$!x c  c#x@$`x  2㿘 #! #!x h`P`@#਒`@#`@#`@#`@#@#`㿘@'H@'D  @D+"c  c?@`耢 c*?H@D "`(H "  @L  @  `"#c@L  @L  c@L  @L  c@L{ c`@   ca@  c  "c @Ȓa c@’a #    "c"# `@a @B@C! $ # / % 1 +) 5 9 ; 7 `Ezِ"p*` € v$c @a p"`  l"c  h"c c c"c   "c"Z% U$S$ &#O$$L&#   "#F"  B"c! @Cq!؀  $c #aH@#!x@  !ؔ @@ݐ+,     ""c#" # `"#"@ v Dc #a`@"!x@ j  D " @ ` D $Ha @& y耢 # #$#䀢 c #&#cD  "  #`  #c!x@"a   #܀` $ # a #c!x@"a@ " #    #܀`2  p "a @ @ 'c@͐!@w "`,@Đ!@n@ "c@!@e@ "`4@!@\ "` @!؀`  #؀`  ` D@6!ܕ* H $!@@ !D@!@   #``?@?@ 㿘 #/ `3-  0  #` Ȑ X@?R  $ # # !ax"8"H܀ ""X"p @"c!x@"b`@ |  `    Pbx P    + bx+`( `(*` ( * *` *` *` *`***** %c #耢`2  # #R`@7Œ @" %c ?@"`   "؀ "`0 @`< "` @ &`  `< @0A# # ! @`< 9"` " `Rf!R /܀    `  `8  #`  #!x@!tb0܀  ` `  ! #!x" "@@@!``8'Db@  ! #$#ش#D@Y < @ 4  #쀢`  X? (08@HP#?D?????????@T?D@Ò0|#`B  # # !xb@!(7 @ #`0  # # !xb@!(%  '1 #؀ $  #`  #`   ##ax #`(?  s@ ܒ ` 5 3"` ## 4  #" #`  #؀ #@ #`  ` P P ` `* `*  `*  `*  `* * * @    ( @3!  ?"`< # #c0@ !x@Ӑ  "`@ # "`0@g<  "` #`  @<@G<0#؀   #R!. "c ! "5 @ ' ! 5      #`   # # !xc8 @ C`(   #䀠 `?$   #`(!xcX@@  @@| #`#h"p@ ! # ܀   `  `8@<  $  " a<€㐀 ?$ @GJ<#؀`  @GD㐀  @q ? #؀ G @S 0C <# `   ! #cp@ِ!x`܀   `  `! #" "@@X!x`  ` `! # " "@@K!x`  #؀  !x cx@!x!x@`#؀ @r#8' 3 - + #) /5@ <@F 0L   &` *@2!# ? $c@ː<@Fϰ :%@5{ #0@vax@<@F @Fc@ِ&%@Ð   #܀` #` #ax@V `     "`@Fc@@ѐ0㿘 #  "` #`@730@ܒp   @@hc耢 "@?t  А@ $&@@@@?`@?\@ $@?M`/" @?$ "@  㿘   b @?;$"@ *   ?"` (@ : #܀`   `  @    '"`@? a@ @ "`'  @@|j `@ . @@o@$  㿘 !   (@rb #܀`K - c쀢    #`2h   `2c  #`  쀢 2Z  #`2U  #`B  # #!xc@` (8 @c@ c@ 26.  . .  .  .  ). ! #`   #쀢`  #`   # #!x`(@) `     "`  " @`@ 㿐 #` #؀`   8   # @ $8@3 /8#  0   8   # @ $8@ /8#  # @ $8@/ `0 ?   "  #`0`X ` @G۔   ``@GԔ  8# # @ $8@ $    # # `h!x@( 8 # "a #  @ $8@   # # `!x@(  "`ܰ? # # `ؐ!x@o(c  "`  # # a !x(@\ c  "`8# # @ $8@ 8#  # @ * $8@q * 8#  # @ * $8@a * 8#  # @ * $8@Q *   #耢`8 "#8#@`$8@= 8#@`$8@4 `,#8 #  @ $8@& 8#  # @ * $8@ *  #`  # # !xaX(@ј ? 8# #  @ $8@ 8#  # @ * $8@ *  #`  # # !xap(@? ? 8#@`$8@ʐ ??8`K #䀢`2!  #؀` #`! 0 ! 8## $8@ *  8*` @   #    @!8# # @ $8@ *`,  c `2$c`0! 8## $8@j 80 2h 8 c&``!Ȑ@F>  8 2a c @F2   "a$8@ 2l? B$aА@F      "a4& aؐ@F      "a$%& a@F   c!H   "$&   #؀` #`2   `  "a$$8&   %0   # # a!x@( :"`#`   # # !xb@( ` ? "`㿐 , ` #`",@"h #`23 @". ,      #`"@    #` "@  `` #`  " @"@@"0~   ? " `0"`  `, ??@7   "$` $` @n  "@* *+`(+  @  *@ $ @# *  #` .` "0 #@` @"`     "  "``$$` `   "`  " "`$$`  &`  "`  #` " @q"@ #@l` `/ @* `% `   ` 0`0 4`4 `  `  (`(`? 8@:` @?` ?`?` ?`(?`0?`8?`@?`H?`P?`X??@-, 2,@ ,㿘@:ǐ #ܢ `  @#a*?5 2,@#(,  "`` @?  #А#,? ,? ,? ,? ?,@ʒ /  L `%@@?L 2 L ```  `* ,@``@ . 2L`@M#HL` " @`@ " %  ?2 @ ` c܀  E   n@   # '  (@  # #ܚax#h"X"p  @[ # #!xc@Q  #`<# # ax# 7Hc@ c ?P@6T`  c@@5uH@Z O "#H ` Yy `@|x `   @ސ   # #c0@g!x@  "` 㿐` `''@  <`  1 # 2   # #!x@Cc0 ` # "`#  @} 㿘 #܀`%  #   #` &  #!x`@ @0 o # c 2   # #!x@c0 ` c "`c 2 @? @QJ   `(" @Z ! # 2   # #!x@c0 ` # "`# @㻘@ 3  # #`8!x@Ö  :"`/-+ #.)@@ (@P #@8@8 # @  /,@ @@x;0 # Xax@ &`@ڐ Ѥ @㿘 T ! @? ( `"T@ $ (!   "! @|$ ! # "! @t$#!  , "! @l$ ,! # "! @d$#!  4 "! @\$ 4!  @T$ @?o㿘  ` @?c @  㿐  " < ,    #c"c"77 ( , #c *   , #c* `  , `  #c  *@   , $c+  ,$c2` * $c#@ #`,`* #$c,2 *@ $c,`#1* @$c@H#c2 ,* `@$c@= @  w"c@ *  @ ` @c1 ,*@ $c@"c ,*@ $c@`) +  @c (# ,*@ &#@L  c@%``c# ,*,$c2 *@ $c ,1*@$c@ c2 ,* `@$c@c#@ `,`* $c,2 *@ $c,`!* @$c@c2 ,* `@$c@c# ,*,$c2 *@ $c ,1*@$c@ c2 ,* `@$c@c#@  `,`*  $c,2 *@ $c,` !* @$c@k c2 ,* `@$c@```  @[%``㿘 `<@?  @ `  w""` 㿘? @ x ` @ w"c @@ߒ  b\. ```! w@   $# p#`d "t@   @ 6@     "`l4@"x w`"#쀢 w w "c $#a"# # w@#쀢!#耢   4c$c  *  "㿘  x4  bth & p@ a0`  cd! ] X @S  `M ` &~ @6'@` @/'@` @('@` @!'@` @@'@` @'@` @ '@` @"ɲ`'@"@   | ( 2㿘 "X w  x"@"@  ?@) w?";) w `4! @2  | x"@`l""# | @#`l$x +  @ 2@2@   #   +   2 2     @#耢  `4 x `€ ? %# $㿘 w#  "`h ) 5 #' w/ ; 9@`x4 @@ `*  ` * $@ @*2  ` x*  2 x" b  ڐ c 8 C  |? x@"  wc" (% #x? w  @x? 4 xc `*   * #c@ @ *2 c *  2`x  x4@% x  $@ `*  $4 `x@J `x %$`x`l`4  `x l@" `x&lc쀢! wc耢   c쀢!#耢 c쀢 f`xl  4@   x l@" 㿘 w# ` 8 w#) `5 7 w3 ;@+ 9  x#`4 @ @ `*   ` * &@ @*2    x*  2%`h |  w#`h@  x" b `h  @ 8 ` `h x |" 8 `hL@ J x "@@ `h " x w#  1@ $%`hx`4 xc `*  ` * #c@ @ *2 c` *`@2@h? #h x  $ x 7 l``4   x l@"  x(%l`4  x @c l``4   x l@ޒ"  x%l x $ x $ x `?$ x$쀢! wc耢   쀢!#耢 쀢 < x  4 x  @' l  4@   x l@" 㿘 {"b    "`"""܀ " " ~ !Р      +  #@ "б(+@ ?`  Є#$*  "D    ~ * +  $ @ б**@ ?  *";  #$ "D * ~ + "?,  `@ ?б(!*@?  $ {#t 2? 62 z {!ct  .   3 2 ! {#t z`a .  2@  3`!! {#t z`a .  2@! 3`! z {#t z`a .  2@! 3` z!@&! {"`  6`@Ē 6@  `@ w#t060 zt060 {؆H060  (͐#2$      (̝㿘 { ~.`.`5 ~ +.(`@./`@/ *  .  ..#.  c.`  .`.` 'c.` 㿐  { #t '   ' 2? 62 ~  {c*@ * @"<;2  {#t9 7  {- c@,`@* @ `$22@ 4 . @   @7@ $@* @@@<""Ѐ@ '"А @<@Ԓ@&Ԩ "< {H {#t-. ` t?. `"?.   ?2 *   2  2 & {#t/ {. @`?% ?-  `* @  " @ @;Ӑ&В@$4 `2?. x { #t  ** 0  ` ` ` *` *4 @2 6 㿘` ~@ ~` "=   "`?"5 { ~  @ "2`*#+@  `  *2 - +  { ~К#bԦ`   * @   "@ "@ ?* 4@ ,  "  %b% 2  :   &`? 4 { ~#`/ ~- ~* %$ , * $*$ @ +`@ % ,4@ @ @ @` -@+`@, 2 @ 2`$h  Ӥ*`"&>㿘 ?      .`<`;0 {ذ ``@"-@.6 .6@ 6@` 4HD6D6H        Ͱ 㿘 ?      @P {"ش`*`  @@` ` {"ب,`@&2$ `@ ,` @@ `@@`B@  4 `H`D@ `F@  @`J@     @    @*`㿘   wR#   zM     @  { "ؔ *`   ?  " * `"?"Д *@   #"Ё㿘>@ @ @   w  { @b  *@ @ &  w#X? z T㿘  b   `"* ?#@2 @S O# K   b  А "ܔ 2 2@ #"ܔ`@   @c ! "ؓ,` ? $"ؐ@ 0' @Q  z {!@b` bؠ @E #`  ` w z#@` bؠ bА  "b"@"ؐ $""ر6 㿘 # b *   "b w#.`  `92  ~"  wa*` ? 2  ~ z 쀦  *`> ! @* ` > ! *`@  bĒ`#0 *2  "̔ #bĐ +"̚ b"* `+b    "̐"* ` "+b+"  `$"/2""  x l z `" #$+   @9`@? " bđ2 6`4@  "#@  "  㿘 " `  N  ~ bи"  ~aЬ#  c$"D  "   # @ ,`  @j* @* @b`" @[$@ #-` * 2 `` 2 ! * @ @H@`" @A$@ b §4$@9$ w   *   @   w*     2 w*   @ `?2   0䀢?"b 㿘 b "=  ! #. @ # 䀠2 `,*@$#,2 *@ $## ``,%*@$#@#2 `,* `@$#@" " . 2`:@4 %" .  2#b 0`* 2 㿘 "耢 2! ##   `,*@$#`,2 *@ $#.   # `,%* $#@~#2 `,* `@$#@s4䀢 '   , c *  #c@`4%"㿘M c#@  ,`* ,$#6`* `$#   ,`*@ #$#@9#6`,*@ $#@/## ,8*  ,$#2`*  $#,8 *@ #$#@#6,* $#@ 5 # !`, *@ &@㿘  `8 #"`< **@  ` # #`8**  @ * @#P@ "  # # %` ` " ` # # `   "` 2    "\"X  # # a!x@ ;(  "` 㿈  " <"c @?  `X   5 \   # ` `*  `@ `( `( `+  ` ` +`*    `X@  @<!@q7 7 o9 @4!PkX b`a c  *` @ ( ( *  @ +`*@  # # # ` `( `+  ` * !xa@ @! ?7 9 3 ' ! % # `8㠀# &`8@ؐ #4* `@$#@ ?@ X@̐!7 9 X &\ ! % #  8c $ 8@ .@   8* +`(*@ (쀢 ,, ! % #  8c $ 8@ .@   8* +`(*@  + *`  ,@G @@n! @h"X D  8 c = #Ґ@ #P * * @@  *` 2-%X #؀` #`   # # !xb8@ ( ` 2%X "` # # bh!x@ (  "`%X&\ %X&\    'H\'L'P'T'X????????'*`  " H  X "4"@ `   , `" *`@   ,``"8 " *,  @   /`,`@ @  @  '' "@`  ,  *`#`" H`@*  '?'h ɬ / '@H.*`'].  ?!` '+@` " @" `@*8 +@''?@*   @h   X# " 'X h""  //'&4@, ""4'/  c/L    /7LT" * @ /" P* 74@ *  ?, * ""   *@ @" @4 @2@ *@? @  $*.? @ L  㿘   2!"a"  В  *2@   @ *`   2  7    # * @3@`  ' 0  "   & :2 ( 3@  ,`  *#@ +2 ,`:@  *  * 6 "  *@@?@5`*     :*1* 6#1 3*  @   +`2@ 22` * * @+ 21@*@㿘E  @   "* &* #!2? 620>,' -  * 2 ` 2   2`@`` -@   ? "*    "* &*  㿘     `,*`a`,  ,``o2 0R@@'  #) !2 * @    ! ` @ ,   @ 2by @ ,        ?  `,?*`@?*@`@!a   `,*`a`, !, 㿘 c  w  $# -!  (   "? ! # *`3 ?$# *` !  3   @@ ,   !2`, @㿘 ! *2c* @    2 @ .    3 b @ ?" *@@㿘$ "# 㿘  "!"a 㿘 ?  "# @.@   :"? "r!   ,"a 8?.@ 0#$a&c? ! $"" @.@    "? "0΁㿘  " <"c a  1 !  4 a  4^a  4 㿘 ("!() 1 / 9 '  (*  8#@㈔` % 8  %@ 8#, # @ % 8Ӑ $, Ԑ @,   " '  8#㈒ % 8 , $@ a x,"*   " $  "0 3 ,  `&a0+  8# c % 8 `-,, ,"* `" ,     0* :` " " @?!, 4  `,(     h *#h@ *????*@#h *`,*@`,@㿐  " <1"c !, h " *`  ' *   ?##p"lp#h@ % l# ) ' ! l* `8#@㈔` $`8  #p%@#h  $#p p#hl" 2@  , @ `#@33 # 5 p, `@ - l% ) ' # l* 8#@㈔` $8 Ȑ cp%@ $cp p.`l"2@ @ p  a,@.`0 4  !0   c*  "c p""p !( `  J J  J(8  J    c( (@   @"@"`@ *@ca#"* (@  ##@"@"`@ *@a#* (@  #c@"@"`@ *@㿘 ! 'D"a -    "#"c%x%!N - +  "c| "#| @}  "#|"#|x  J  c| -   #@   !܀#| #!܀ 2#c DD "܀  *@J`-2J  $#!D@%*`@ @͒`Ѐ !!   c   %!܀ cC Dc#@D!#cD$#%!!D * # c2%!e?@J`-c|J c| V? "a%!Q A   -`?`%x!ܑ* @J`-2xJ  -`xx L@   L@  =2`  x@%$@ 2xŠ$@Ȁ2    !` ! #*`@ !x@@`x x!ܒ@%x%!܀d!ܖ%!L@ ) ` G"a !`*?J`-  #@!x@͒` x@!xJa(@xq x@%x #D  *@ "!%!!` *@ #@!x@aXRxx@%xN :  :Gxx @%x'`  "@ `!ܑ* @J`-x6J %x !`!ܑ* @J`-  #@!xx@ha !@!xJa@_x!!`%x%!\ x @`. :%xxJ `!ܐ %! :2J` !` #@!xa@6 "!7 :23. J` :J ! '"!؀ !  "a%!!D* !` #@!xa@  "!N`:   :@ "!%!%x. > 㿘   㿘 㿘@BLdd P    \    h  t                                      `b@eO a J  o`?#`J  g`?"J  m`?# J? f'Ѐ`??"''''ܬ    )% '; ?'59 00* !@€ +  (  %  "'ܒ 'ؔ '਀ @*?J`-JJ  $@@̔?ǐ?&*  @@܀  Ԁ``b(@Ð 2   2@' @?А   @?'```b`@ J`"'b`@ ^ @Ȁ bx@  8O'耢 2 @ ?А  '`@ ` "'`` b@} J`"'b@c ( @nu 'b@W   @@ި : `@@ޢ . `@*@'@@'@@'̒`@-L   @B * ? ;* d@€܀ ਐ@/f ਀ +0w  @$b @q਀ h   @ @_0Z W਀ TԀ Q   @D "D @D "D @ D@? 83 ਀    @@m* 2 4@m= ؀`" ਀  Ԁ  @ò  0 @2\̀  ؀  @ܐ" @- 2q 8` b@ @!㿐L ?@0 " @ ?b@ J`bȔ@s 㿐L ?@z " @ ?b@i J`b@P 㿘    `! #ax"#(#0@ 0  a #!xc8#p# @| @  㿘@ 㿘@ #   "  (*  :`J "   2 㽘L0`"$@#Ѐ   B 6+ B+ 3` @; 2* @ * < #`4@"@ޒ   = b<8 $ @7 "(  @'$(@  @   @", - @ 2  4      㿘 #4@"  @ϒ a8  4  4  (/  6+ @}@ 2$  `c@& @" `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<  c@&I @J`@ 6  ,`   @"". `*41 2. 2 `)  `` 4  `   `J@/`  &J@J@`?㿘@㻐@ @#@a} @%H` #@  @q0@@!H < `( 0 8 @Z0 @U㿘 @.`T >`   @ M`@@w 0G# `H<  2 0 8 "@3 @ ,`T : "@@a X cL   J"`cL 6 cL@a  @  pcL @a cL 2  @!  "@+4 㾐 (@ , /`  `   ?   " 67 4   $ #8`4  " , ,  ,  ,@M 㿘 (   ,@!A   #8 `$ " , ,  `  ???????@<<  `?`  0 8@ @$ cL   J"`#L    #L 2 @ z   @`e  c G @ ! a<"  ''/'@ʒ -$@[ #L 2 @ Q 耢 ! " @  $"@ɐ   #L @`-  @a #L $@`!  T!@< @@ 3@!8@ !X  " @ɐ  $(!h "@v  !h@,# `\cԐ /'ġ,'`*`:`c2@ #J !@ܰ 0N@@b   !@̰ @_Đ!00;#ԓ.  `?32 !@0 @A@Q  @4 cԕ* !`2 @ @_"cԓ.`  2 #L  @_  `  ? ??Ȓ`,?/'Đ'''???@'@X H #D`B@@  ????` ???/'''''@`  B*2 @2 2* @ * @v>`@  @#@Ԑ@  @  㽘 #`@ P ` 4հ -`(@     @ɰ @" 8 2° `+`$$` 0 ; B<``  0h: @$h`` P*@ :`   @  `0  <D @L@ @ @6  2r.` "@O`@'0  c.` @A"` `0 # b@3  "`0    , .``   `P*@:`     `0  <D @L@ @ @   2.`  b@ " @| #L`"@^c"8 @m"H  @,  .` $$   0 :`@ c <0h:` " $h@" 8㿘 @E #8`"  ""&` &@@А c`4@ ( 3@ ``4@ # b@ b`4 @  . @94   3  #Ԓ  @2+ c @? @  @@c" "  *cJ@   #ԕ.  ,2 #@  2@ @v  @4 㿘@h @2 @㿘 #` @H  ?$, @ 0?,@6  #,㿘! #̀ ?"@b$#́@ 2&@&`$ <>` ('7  e( :`Ӗ ` ̀`x h ư @` b> @]U" @"c x @ؐ`0?  ;`; @@Ъ @ Y p 95/2  <@ :@L@ B 8T @ @ &`  8&`@`&N`0 20``&-``@ ܔ "@@ 2 `@` 0@?<: > @\ @-"c` &``@   &`@   8 &` p 05*` * :  @ :`c /@  &`@- "&N`0 2㄀`@  @@Ⱘ O  `t @;  d Ѫ` 㷐M`0  `@ 2`0#`@`  ! #  0@R` 0` : t@<`? # `t @s; 8#2 # `t@  b: @\Nb @"cqF@B@ `#d@**# `t6%* @@ 1  "`$@ @  " $- * cH@?:49 `%`@e "M`0 2`@ b@@"`"`f *  ?%㿘 #q@n # `@ߒ@``@, ` 8@@, @K #0`E#c@@ޒ, ` @[ #`c@ђ @˒,  `! @Ò@  #0`# `c8@ @,  `@[g  `#P@[a  㿘  #  #x@$  ) ## `x 3% # @Ғ@{ @˒ * @s  @@ @@ x  ` cđ* @ ?"@0$`x@@T%`# x@_ * 㿘   ` "  # ) #@ɒ  E # c`'  @$@( `@w * @@) @hx` * d, @5    #       %  b!  @  " ` "`㿘 #8e< `H `    4 " "`# " "# @$` + @%` ! * " $# %`$#"!    @` $ @C# e  `㿘!   "$ @$ 㿘  0 ;  @ C@8 ` 8 `,` $ (@ 2 @ ##@ b* `$"$ $ $ $ $  ,`$  ( $ $ $ @  $ " @ # `d"b@*` $b@ߐ "b* "  &"㿘 #ؠ@R b*      2  0@㿘 b   " *`   @Ub?@N@Lb$b$ Ć * 㿘g < `H P X @@O 3 cL @ ` cL  @Y h t?"t  b @  cܔ  *㿘 (  2   ,@  㿘 ( "  ,@!  2   # 8 &   㿐 x@YZ 9 # 5@YM @wS p "@YD  p@Y? @Y;  cL "  !@ @Y0   @Y*  @p'` @Y `㿘 ؒ@@Y  cJ@ "     #4   0   *@*@#J@ː 㿐 #P    #J@    #  #J`" 〒 J@ 2  # P`@\`@``@. ` ` @ǐ @"U@  c#Ԁ "c!@c @ 2  @"U@" \ c @   *@ , < @ ?@ % (@ 0C@  0? ܒ *   %  ܐ *@ P *  @o  $ (ܰ #*4@Y$ dc$ $ $ ` 4 :< `4#t: $ h`~##t #8` "6` `*`  ???Ȗ\???? /''͐  b@ V #ܒ * t?"t@@@@@@@@@@@@@@@@@@@@@@<@\@@l@@@@@@@t@@?@@@@@@@@@ȝ㿐@?q+   *#'% ;9 ) 75 /# ! K- +B* @€cL ?%cL!|,А b@p  "@@W1|,А cb@b ('"#0 $%#0",|( m@U p&@s"0@WH c|,#p  ,c| #p,c| ,#p!"h@_ @Ѐ?? "*@  & @ɒ  ,@Ð cL , ,@ ,t@    ?@@β`  @F ? `  '@㿐@Ւ"J "В@㿘 @b耢 "  @b 2  @ܒb "   @Ւc 2     㽀 #L`,`@[ cL@Ԑ c0  cL @#@?y  cLcL s@#p     " X*-  `@V#8@ "@Vڐ#P@Vא#h@h b  cL  J"`"@ɐ#@V#@cL @V#@DcL @V#@ cL @V @ cL @V H@ I!`̠ h`# `8) @גc<#t@. * (! @* . ("2`*@ *:@ @ @Voc0` 【 #t"@" `%#t@V^ c0) 3 5 P;  # ,@"  <@4@ &<@[< 8@&<c<"@" `&<@V1 ⤀ @V+ ⤀  %# @V#a 2 @V" @V! "  %# @VaP 2 @V %"%&c c쀢  @  ,  &L  #   `,6 % @*```@%. ``d H, @ `,& c 2/"@WO"@Ic c@E'c c @@"c c 9"ccL  @U!X c O" @U!@x "!@P cLP`@@ "'''@1   cL @U!@= 0 㿘  #!`",@@n` #`, - :1  ``@``@, `  @`  @,  @@ @  ``:c*$@ +@`@* ``,&` 4?@< @@   ``:c*$@ +@`@*   ??d /'  ?????"<V"t`,! & T  %    @ c %@` @   `,& s& T㿘ː@< 1 "ؐ`(@M 0  0`X@F  @ ` ` "@ @"8   J b@-  #ܒ *   0` ;  B`B #c ` cL #0`w7 `"@ @Tw pcL  <@x"P 2 ` 4  ;`a<`4@`0`? ;`@  E@;  `- #0`?7 "` @T?8 2`@@((o7  #D`>`` 8 872`h`;2`h - #4` ?d# `(`b* @: " @ ڐ"x#0` ` , `"@S` @~`(($`h e(`:` `` `7 `h `B*2@  7     #`t@ ?   4`( , ` 0 "@S"  , 􀤠   #`t@   `X , ` 0 "@S"  , @h ~ t  c"t`. 3T``@}ѐ  2 @ u"@{# 2@ #@ 7c """""`` @  *@  *@ "5 * #D`" `?" <c``$`p$`t4`k4`  " "`&`` 4`$@g:` &`$`h /#(@ ,L @S#X0@#h `$B" h0#p@ ܒ *@ "8 ܐ*@ b@ *㿘    ' cƔ `  "` @ # #L`@Rϐ# @ِ#  @Q #@ c  `$) ' +-/57 ݒ   r    #:`K *$:@ `2  #<  %#< * @ +  Ys༒ ` $ @  #L`@c K @ @ K @|А  2 @ t#@{c 9 @ @ 9 #Ȅ`" """@ ""@⤘Ȁ@ `  #@@ `2@Ȁ@2 $`2  $  & $` 㿘  #!`Ƞ (,@j@`  ? ? 'Ą/ ?????`, "\   "`"T +  `@6+ ) ㄀ %`  #'J@  ] ` @  `,&& T㿘  3 3   2 `- ) +  # `@ $ " $#Ȁ# 2 #Ȁ @ Ң`YZt[8[ YZtegfff f 㿘   `̐@ꀔ㿘   `̐@t  `?* : `m  *` €@ g @m ؀   @  @ )` !퀢 X#@  @ N!@T!0     !퀢 C#@  @C!@ ;#@  @ `@ -!P@3!0    !퀢 "#@  @"!p  @  @ ޒ`  o@ ;2 # #J@ ΐ!x#ܐ * c8 #ܐ * b *# ! b"l@`  " b *#  ?c:?   "/' T?????耤q$`Ь+@531  ``%Ѐ`a #"$ @!p > K    : 5 28 @h  J"`  aa@ "#  !a@ "# cL @P" cL! >`$ @"       :   @7@  $  ?H @h ' '̤*"!&TK%Ь+)# 1/  :%  "7  2?0   "($ @;ap %"8   cԓ*` ?2  @@)ap "8 cԗ*  3  cԕ* ?3    $ *b&T"* @  `"   "  $  $ " * 㶀 #D ` (  #  "  @ , $   (!"`@v 2#     .bh $@Ð!p "  #8`"` $  [ b O, b #8 `' // /"`7  b8@8 "@2 $ 6,`@|"( $ 7 @7 @ $ `& $ #ԕ*  ?2 @ِ4@a!p "  $ 4I  #8`' //"8 ` "8/ $7 /   ?  w "74 $  & $ #ԕ* ?2 @4 @ 2c8 U$  Q vc ,@ !p "F E b`@ɢ   e(#0@?   W(@ސ#h?$ $ J(7 @V@Ԑ!p "  $ & $` #ԓ*` ?2  "  `  $L .2`2L  c$@!p "   .2 c& $ c   > #8`!  2    2  ؒ  $,@r!p "   #ܚ @ * : `  ԓ*` € $   @P# $ cJ `2   #L`~  J"`y  죒 @3#Р o  <#ܒ @ @  *  # *`2   & $ $  @͐ @Ȑ 0@ #L`@M X4 @ #Р /  $ c8 $c8 # b J @   Ghb!p @ , "  #ԓ*` ?2 * x@:`  $ @$$"@㿘   b@暔Ё㿘 " *`     V"T- Ԑ % H? ) #J `@#J@ :?  J@ 2  c؀@  c` `  #J `؀@$  촐   #cԗ*$ $  ?3 E $  $ " #  *<☘& Tl<kDkkDkl㿘   c@!(`     ?\"h?   /'#`T@????V? # "`' * : `?"P*` €` #ԓ,`R ` 뢐5`"`02"`"  @wY#"a@ a@t  @ 2aHaX `*!`:`@@ $T㿘  `B ' + Ғ   4    c:  J* $:@`$ ⤀  2 & @w$⤀ `  :#* $  * *+ c<%c<`Ġwvvvvv㿘   `@V?b  #P c ` ?*cH ࠒ @ Đ ?b#0"຀5`X $ ! #L @;!#L 2 %$@ 1! "X%$  ,`"cxX $   "  " $ %$P@ ?*  ณ, @,: ତ@@ 1|@ , $:`0@ !*`@, , :`@!  #L! "@ڒH%$#L @ ϐ"0 ?#L "H@ɒP@ *  ณ,@: ଢ@ @ |@ , $:`@*@ ِ`@, , :`@@L %   * "xL? ". ?༘#<? Tc8@#""@ ?:`#4a#@"U%c?P#0?("?" #,%P![#%`Tഡ,  %`XP@ ഑* %`\ฐ`,`: %``?ଐ#,$@"@ x@K| , :`@%`d?$("@ " %`h$ * @%`l@ ]|`@.* , `l:` %`d@`\"U`d?`T%`#4?"@ c8?#" @#<#@ "L@ʐ"`  @ t@?$" #D?c@#@  p  *@"@  8?`8  ??$8   6,    :c*% +@ * , " a " T  @ N"` @ "ܠ P@ /@  ࠒ @  @"U@ " #Ԁ "@༒@ ͐$@4 %` %`,?@2@5`5`&%`$ $%`8@ %`p%`%`$%`%`  (`@6%`(%`( ,`@6%`,%`,U` 0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#8 ?#4@ @ L2@"U%cฒ@ r?c?`@c  #@`@/`@"@  @* : `)!|*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ*":`@ศ Ĭ`%@"U    ` :`b@`\@   ? %*@*`  ? %` @ɨ @"U8 3 @"U  @ :`J *`" : 28 `:`c@``@   ? "+@@* 8ז@8e ``%`@ |@`@-T@`T@ `"|@ @ϒ@v@ @ @Ē@’@ @콐P@ @b* `- Ԑ@ `X@@ *  2$`$>88@G &``l:`@8@> &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " ?% ::@ `4@  8@@=$ 4 `l `p@`h @@  @  $4*   #  (  `p 瀋@" ?$4*  # ?#`$@ '` @ '` @ '` 'P@@ . b@ @   `$@`c$ `  $ `$$ * cx @ P?<@  `@"U@`T`T@ @"U@ T T?#8 @ (b@ Ð "?c<@@@ @"U@ T T`@"U@`T`T@?8 @ #P *` J"` ?c,@@ F?@"U`"@`\@ " \ $ @"U  "3- ."   \ : 2  @>@c   ?#,&`?c(@@ 6F`@"U# `` #@``@ $ @"U  "3- ."   \ : 2  @@c0   ?( €`@"U@b`\@@"U" \?4 @ !cP@ x @ "U@" \`@"U@b`\@?#4 @N cP *`?c @,@@&L ?"T?0%P??#$c@@@ؔ  @@ bȀ   = =--+   $ , $ (㿘 #'H'L'P'T'X!x@;H@ 㿘   #,` #$@G#p@  #,` @G#x! $@G#@ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘 `!@#㿘 'H'L'P'T'XH@j 8@TÒ / @Rޒ <  L  r @ 㿘@T / 1  $,@ /,c$@͐ @ɔ$0 x #"c( @R  @F#0M8@R  @#@Fu>'< @@#L@#( %#(@R{؀  y@FX#!  @FN#@ `zâ @ `2 㿘 `@jV @p `@jN 㿘`` @jD @p ` @j< 㿘@ `0@j1  J#  ?*""H @R   `!@!@E° <   !@! "  @s   "b `!@!Д@E͐  cL  !@E’ J#|` L@R   &cHL?`&cH!@E"L # @E"#  !  "c"#`$?#$`$ , $ ,`$`@o$ @o  $``bX"@F "" (  "c"4@O  I  c@ D L 2A b@0 ": @p"@ 3 \@@LH@,@ 8 ,$@@# "`\@(#\"`bx"@E6c  @#H@  #0` J@E%#p  `рL`#### ?L 2#   $1  ,5 "c @A  0 *@ *` t  :` :"〖  @<` @ E   `#@ `2 " ,   <`cА @֐   "`<, ` `$ @Ő @L ` "`@D hL 2 $@  2$* ,`   @ *@ x L "@D hL   @  2 $* ,  `0`H    `0L "`H@De hL   @l Ȁ 2 $* ,  `4`L  ]  `4L "`L@DB hL   @I Ȁ 2 $* ,  , $H0204"0  1 L `:%0@D hL   @ Ȁ 2 $* ,  %(`<!(L < `"(@C hL   @ Ȁ 2 $* ,   H8%8: @ %< "!%<!X  H8  L:;%8@Cΐ hL   @Ր Ȁ 2 $* ,   L8%@: @ %D "! %D!  L8  L:;%@@C hL   @ Ȁ   $* ,   X  ::8 L8  ::@ 2 e,.L 2 @!Ȁ  G ! D` "D ",` <:%0` "(`H8  ; 88`$ L8: ;%@*`+` ] eLY$L 2 @Q"   M! x` "x "L` "P`#\"eT`%`"X`P@i*  , @,: @@\`@. | , %$:` *@M  ` |@*@ , :`@$ L%@  $ * ($L`  #@`  `@s`hcH@  @P  "cP cP 2``@BҐ"@0 4 3/57 ``0"4cP`8@ ``db@* 2 bx@  @0 v  0  ժ` #`,`:   ? @ "c"@B0X# @  "c# "# @  "b#"@Bn`0># @ܐ   "c#`#@B_*`0/    # "b" @$c! $"c@ " `""c#8@B?*`0@ Ӏ`  *b *" @  㿘- @   # :` @  # b@C 2 !$$ \F!T@c`, 4cx`c@7  `,`@.?` &`hc! ޒc#@`d`4 @-@ $#@@`$  $ , @ ,  @*@  @ h@Ȓ@  2  t@"e "% ` " # # # # ""b *` *` *` *` X"`X <"`< "` @"`@ \"`\"@b"cL"#LcP"#PcT"#Td"$d"$ @` P$\@ܒd\ l$@֒d`d" d`" `" eP"%PeH"%H8:8@;%@H"%H0:0@ h $ #0`+@A# h ?%@ $ @A:`  `` @   *" 㿘  #L`" ! `@@ h㿘 @P?"  ? # "  "   ̐  @ c ``*: :@ ``  #*`   e %h@!  &4 &8 &&$`0&`,&`8&@&`(&|``4@8? @ @8?&`&?<``* &@"* &|?@}8?@x@&@@n&$@j?@f&,`&d <`` &d`(  "#㿘  e`e@ 6    `!@R 8 㿘< @@"%  (@" 4 0@" 0 @ #0@   #0`" @?!X 㿘 #L`!pa@`?@?!   J#|` #H`  @?А! U*bJ#p`2    # J#|` #@?!D ! +) #@?a@`$@r  $    ` "     #`? "`@U 2 y Y n NΒ@? y€ Y *" 㿘 #` 0 "c@i"Ę 2`;! #P ?" " " * c$ "c 0@p($  / ?آ`$ $ $" $ $, $ @6#@i @i`0  㤀`#" 㿘 ## %  #`d.  "D 2 c` c  2 cܐ!@Dc  $D" "$ c$c"`$c  $ 㿘 #`d .@  cH@ H `"H @ & & & 㿘N` B`  #` @"8"@`Ð``.`` @`&` #@# `  ' `#P@@ 8   0"@ d H* @A` 0  㿘 #L`2@>!"P! M"h㿘 #H`  @,b0 #  J"`&) # :`:  @ @ ! #L`! Y"  #: @ᾐ $H ,i! #PHd @h5  # + `) 3 @"㤤HQ`@h`@h H @"%#"@"  %cĐ  `рc0 #L`"  "؀ " ` * H*`c0   H ,``D* !"@* @=ڔ@@H㿘 # >:`@ْ @ 6#- @GXW  #@ 6# @@=#  : ) 9/#4@G2#4 * <` D @ :C  @﷖ #4 `@#4@@@=k#P @@=d` #4@@Ͳ@@=[!㿘 _ # >:`@] @} 6# @Ik  <"c#h@b 6#@= #p $' +@IH @ < D @ :C  @> #@@=c`#@@<!㿘 #P   #`8 4  c "   ``8   #! -@  #: * J& : 2` 6` @ : * H" : @6`e`@@``@, ` ` PU " `Ԁ #`@ .# U%  ` `:*"@ +@ * `; c` ` ` ? #@+*@*`c< 8@ $c<?$$"$$` `8"o ` 8 "@ &^` `?`@  2`P ##`P    #  ``   #Ȑ#. M.   ?? $P/'?????#@ .#'̠̐!''Ȑ ''n "@$@@y / @ ,@Ȁ!<c'''O $P ?,@|@V" 㿘 #D`J @Z 㻘ؒ$@Գ@v@G   "`  @ 㿘@ΐ  @  @ 㿘 '   !#N 0     #L` @;~  &  (   & &A 0x   T *`€$ "$$ P@  &$  X'@ 'ܐ ``'''@ 'a '' @aE@$㿘8 /  (-.`  `  ': ) @@2 8&/@/8 /`/ 8܀ 㿘 8>0#  @ `?>@ *  @ *  *@  `?>@ *` @ `? h㿘 8 >  0 .@>@ *` @ *` * * .@ >@+ * .@ΐ x㿘 8 >  0  .@>@ * @ * * @ .@ >@+  .@ 㿘 8 ">  0 @`?>@*` @*` *   `?>@>   v 㿘@X@   ! ##!x`@a @Ц@А @C "  #!x@К`@Đ  В @Z @P 6@ѐ @3 @Ȑ! s / |  "cx  "ct! @@?逥 f "".@!8."t @Q   .#\#`#d"    @D 2  "\  @< 3!p @7      #\#l;p#x ';`#h#|    @C  @"   ?''' @А  @̐ @d @b @`  #x@ǰ 㿀  ?''L'P'T'X'H'`L?`' '' @  ?`? #####`    ( ("#㿘 'H'L'P'T'X@tH@@w 㿘'H'L'P'T'X @dH@xaT 'H'L'P'T'X@쿐 @H㿘 #| `"#|@㿘!@B*!pې@> @ 㿈   ?'  @ ?   !@&!?㿐'DD  ?   D@f ?  D! @!㿘㿘  @e a@٪ 㿘@Kh@ @V ?!]@ ? @?"S@ 5 㷈"8$@"@$@  @.% 'ǐ"H' @  '' b`@"X@7!"9''@71@ @ % ("Ȑ? @8   ?@1/$x ( ?@8 ?@?   %"   #0@^R ?x #x 萊   ڐ#X@K @ #x1/ |  1/"#t"Ёp@- 5?  ?ؐ ''' @'  @# 7"H #t1##'耢'# '' @ B !"8@6#Ȓ#@e ?#b8? @7  ?@ \1/@7 ?@U?   b8fC1/Ԑ   @b8V@] ?Ԑ?Ԑ     #x3!4@?'@20̐ h: 21/ "t `@R11" |㿘1  T "  @    !@     @V & T    !@o ؒ 㿈  D T '''' 'D  D  !`@P 㿐   T ''     ! @7!ϒ㿀 D T '' 'D  @ꂔ 㿘@ 2  @aE* #@a $   a@ . $  㿘@aP   " @aJ@aH   @aB@a@ @a>㿘 ' -  )@a  , @, , &@g& @` a (@?G& @    & ( " L& $& $$ (㿘` @`@``@=`@:@@`А $``@@?a0}`  $``!8`@` $``  ` @`@F`b$`  $` `!X`@`ǰ $` 㿘% L    " (e (b 2 $L  1/ |`k 2@B @D12"ԁ㿐@+?  Ӑ!x0' @c @L 6 Đ! @5@ @! @ 㿈@ ` `? @5?w?@+t? `!k? g@@?o  @?0Z@O 1`  R$`  O$` ")`@u` @J!?    2 b @AҔ @]@& b(@Aʔ @U@S@ ` $ 4 ``="0@ ` h@ ' @Ӑ `@4@`@"h`@ 㿘# `L 4\ /   @= 7 $  $` ("`($`L (` $"`$r0P?2$ 2# "cx@7 $  3   2  "3  34  x x㿘! $#x     L@ & Ð ( "1   2 (?2& 2#$#x 1  @4 ?"#x#x ? #x㿘' L D  ?&  ( 2 0;  ( 2 @x` 2 (  &  "l& "     ?& #  X!8   @Z& 0ݒ@@ L@B{  L "12 `2 (`&  @Z  ( 2 12"ԁ L 2  (2 2"   P㿀  L       @Zx$  ( 2 " @1#@ƒ ?"> @)?8 *  ? ''' @Y  @U i"H @ !"8 c@2Đ"ؒ@ @3֔ 䀊   :  2  ",  @Z"??#   "$`P@: ? @3 ?"`P`P   ?     $"@P1/ |㿘  L` `  "` `(`2`  b@ԥ #(.  @Yِ??!   ""1/$ P@ ? @3m ?" P? P   ?    $K"1/ |㿘@ (   @*`2 㿘@i  @W 1' n L  o  @Ւ = 2*`"@& 2   @2    &*@&c@@Y  @U8 2L@](((((((((((((((`p(((ԀԬ((((((((((((ԼPՀհ <(l֜8Hؤ(((th@Sc耢 ?'     "a""@ #@ a   (` `''''ВP! ; 9 % 7 / - ''''ܐ@Ô?A? ;94* D@€  2"  ."b@ | )'a |@K`$` | "8@} |  "a |@;x`@q |/'!p |@0 `@f |  "at |@$ $@X |  " |@`@L | " |@ 〤`@@ | &l |@ ؀`@5 |  "a |@8̀`@) |  " |@X`@ | "  |@ېx`@ |  "h |@ϐ`@ | " |@Ð`@ |  "x c` |@`@ |  " |@`      |wu` |@    "g"a| |@   "|\"!@bY`@ |  R"` |@tXM`  H"a@ | B" |@dx=`@ | 7%  |@Y2`@ | +" |@M&` |@K 2 `@y | %$ |@8`@n |   "d |@,`@D` "`*`@ &  &  @2 a 4@ @) ,@  ' $@M!#(8$&@B@0[@$@8@0QcP@U[   %c`@ܐ  Ȓ @! $ " @. ''77''/7?''''7@? /   "0#ph$@@=?2 x@$ b O?@|    @〔@@[  2  `@!#@up@>   &  r p@/  ,  @_  `@Y  cT@K줄!'   8 "@&. s "8@3#l@  ' `@@"@耢   @c@<     2 @တ#@0V@@Ē ?"J?`` ?Ѐ@ "c `@@#@ " @ `*: :@ 2 ` @ (@M@ `  @ P@M@  @%  @    a  M@ @@    H "."   $0 "@@ $  a, %$@@ a   ( 'a@@  ah? L"ah  lJ " "l  !p` &l($*$&l!p   ` @`  '!pl*  4 '!p ᄀ   !p@@? &  "a   l* " x   a|  ?  #xa@aH@   "!| a`? @"a`` $d@ ""0B"d @$ d8"   ""( #axap@!  2@!p2 "@ 'P`'T`'X` a'\!!"@O""$'a@I%$ b0@D "0 (@> "b( @9% @@#$@" `&a:` "$'a@R %$0@M "0 b(@G "( @B% @@>$@@ a b@"@.@ $@`&a@@y:` $@ b   ̐@c  @d  @슐@ `/@8'@7ia !ܐ?'`' '' "a'\@  '`c`@ ؀   `@@C@2 㿘  e`e@mX 6 X3 b8   ,`@$ ", b8@'#0 @Rǐ! !@ X㿘 ",`6ߐ6 e`g@A @R!"@㿘'H'L'P'T'XH @   a @{ @b @~@R@א 㿘 a   !! #a0@Ğ!x !! #ah@ĕ!xa@Đax aa % "  " ax@~  @룐 'D'H@ ِ  ? ''"b@ @ "b@ {@ "b@@ u@ "b@-!@~ @ a "B @7='Ga8@  @#e ?2@!@d @- ? @Y: @W @ C   b @ b4 ?@@A "    ! @!@ + $"@8  "  "bЀ""̐?"e,"e(̔  <"%("%,  !@- @ @   ̀`"$  @-n!@   "@-e @  !`  @-Y" @ 4 "H@-P @ !p al 0  4"@-B@ݐ  " "@-8 @Ӑ !   "@-- @Ȑ  #@-$@꿐  #@@-@귐  ; ;`8 8 H L888@  P =   "`P 4  " T =   "`T0"`T:   "8  =   "`` 8   0 4# @,ܗ:@w  a  022 4$%P$ t@$ x$ |`| "`d =   "`d  a4?@ϐ8?@ʐ@&@?@羐@|&@& ?@箐@ג?&  &?=  * "`@* "̨  0 *` * ?: ;%0 `t:`@|<  e0@B?#@k 0 *  "0= X-`*`"X@氐@̶ْ"`8`*` "``"8 4 02  8@+#@+~#@ * `: |* # |# 8# `# 4 %P@밐*   ,`@,: @ @룐@u | , :`%$ 0 *@  ` |@d*@ , :`@ !@낐@~ @O"̐?`x @H@q$`) `8  @a̠"`0=` @/* ̔?`x@)@Qx@# (@+ ̐ ` 0 8::$ `$ 0$ 8@@8$ P@1,`̑*  @`,`: @@$@ | , %$:` 0@ *@  ` |@*@ , :`@ @`0* ""`0`@  @ʐ"`x?@Ő@$`̒ `0@弑,`x?@巐@r` 8̒ 0@嫑* ̔?`x@奐@x! H@Ɛ̢"`0 @啑* ̔?`x@叐@x@剐 @*n``   @*e h @*a` @*Z  @*V ! ` "  0ap  @*E`"  4al !@*:a8@Ր !t̐ @͠"   !P` !! @*!̒ ?@3@\a`$   t̒`@O @ "`x?@@D$`0 @* x?@@8 " " @+$@"x?@@! $ %P@*   ,`@,: @ @ @ | , :`%$ 0 *@  ` |@̓*@ , :`@ @ b( " 22 : :` (#" eP C`" @$`@䛐"`x?@䖐@鿒$` `@鹐*  `, @,: @`@鬐@~ | , %$:` 0Ф *@  ` |@m*@ , :`8`  @鉒 |@[$ @邐 `@̪, @)6!@ѐ  !@).@ɐ at0 !`@)!" `` `@洐  @)"  ̀`"@) "H@)"`@)"a`@旐 P@8*  , @,: @@+@ | , %$:`@ *@  ` |@*@ , :`@L@  $  d|<$$@@Ԓ@$ఠ@ $ఖ ' 4 @("@@ "  D!hehL @ "0 L  h XX@P̥* #X @ɐ | `@㚓* %P  eh`̒#\%`$%X$%T̔%``"%X"%T |`਑* *  P b#\"Д@(T#@"cXD LX "h *"̦ %P .#\?"L?, TP@r* 2̦%P ̶cXܠ̐@^8 ̐|@V@(@O@x@@H@D@m@k@>@fP@8@ `,L?= .#\ T@%* R?eL?2eXe`@@* ,eL?2eXe`@@L?,.#\ TP@*  ",L?2T.#\ P@* 2`8@⬒@$, $, x ` @❓:  @ $  ,8 ? 4  @绒̠``@紒- `` @筒$&)`,#c@礐@瞒-  @痒@i8$8@d@'H#@'A@ܐ ?@~`$`"@ e @u``@p, ̠@i $Q2`!8 * @|@Y @'@䮐 %8@O`'`@I, ` @C`8$@@@&!| @1@& ,$ , @R  ̒"@$ `@ `@| $`$`d`$* #"   %" `d`|@:@?`$"@@& ,# p%D*  0  L2  # #  # l  =   "`p̐ @t "b@&!@/  !  !xF " T̒ <$%\$ @$ <$ X@$ \ a|, $ D$ $"$ $ $ $ * ̐ *`@" ̀`0"|!$@棠! !XH#\@&U`$!`4``!h`,` &#`&$" HH?'#\@&7 a @&0!@0  , 8 153/ #@  2&̢`@Y̠@S. ̠``d ,  d@!Ц@%ب @%a@L ̶`, ᤀ 2 @%! "` ! @| @]  @$  @ `T`=``0"`d *  bؒ @ 0  ̶ `,D̒@```@. `  `d@ő,`,D *  4" ;* ! `2@K @<@? @= @; @ߐ!㿘 "̴ @屒 $4@娐̠.@堐 ༒@噸$@啐 $4?@^ @ "! .@ࠒ "@彮@"Ȑ"U$ $ $ ,?2@Ț4 4 ̐&4 $ $`@58$ p̐ $T`,  $XeP@T`* $\``,`: $`e$``@D`@| , `:` '$d@7`@  | , `:`Ȑ ?$h`h` $`h%$ * @$`l @ `|@*@ , :`$`ddࠐ" $@$Ɛ!@a %  '" @"U  ȕ: ` "`\@@  ? $+@*Ȥ ?"  ')  0'   @(@, ̔ "l0 2  "̒@```@. ` `d`0,@@" 8 " x ` @߄: Ԁ @"U̐@v`8Ƞ`"``cؒ@@%%$`Ȁ   l;  +  $  * * Ȑ`̒`$`@z |@M * `"`T`T@@ `" |@f @ǎ @5@^ @Z@ǃ@ǁ@T @|@O%P@" ȥ* "X@D@* Ȑ Ԓ@@@7@  @2%P* @@@ 2@`8`("`(Ȑ (" 8 @B$ ( 1$@*4  "  8@ "@@'@"U ``ȕ: ` "``@@ `` ? %@+@*Ȫ`$@ "$̨`8@"U̐@ެ`8Ƞ`"``cؒ@@[%$`Ȁ   l;  +  $  * * Ȑ`̒`$`@ |@ރ * `"`T`T@@ `" |@㜒 @Ē @k@ @㐐@ƹ@Ʒ@ @Ʋ@%P@X ȥ* "X@z@L* Ȑ Ԓ@@@m@? @h%P* @@@ 2@"`86/Ȓ&*`4 @ U"    "ȕ: ` "``@@   ? %(@*"Ȩ $  "$%$`9  l  p  h  `!     %$4+    "  ( @ `Ȥ`p怊  %$4+   " ̒` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @```@Β. `  `d`0@,㿘  ! bH"` "`"`#!4bH "bH `4      "@$bH: < ! "bH@D4"$(`Le@ :`B *2   $hb`d`4@m* @S 㿘  "܀ "  `` `6` @շ`?$ @ a, @*` `2` @ե"㿘 "̨ ! d*"@"@`"U+"` 2`$"0  b`"c``@"̐@8@S "b 8` &`"X@!հ 0"@bȐ"U `> ` @i"%$`bȀ   l: * $  * +* b ` "̐?#` ؒ# @ ? "` #` `#  ""̐@ |@ܩ bȗ* @"U@"TT "" |@ῒ @ @܎@ @᳐@ܒ@ڒ@ @Ր@%P@{ bȥ* @"U@"X@ᛐ@m* bȐ Ԓ@@@᎐"@``@eP* @?2@"`0E`4@P "̆`8 "@ " `8`̘#bȒ@ #`$4 "$`8"@*`   `8 '"@"U , ȕ: `"``@@   ?" +@@*"̆ 8 " d*@bȁ㿘@w@@) "! & l d*@""@"U@" @ Ր"@p 6`\?"  ` * @* b d"@*b "ؒ"?",@@ ""@ @I  @?@ @8 * @  @@ @@, x ` d* @,@  0@t"̐@x*  @"̐0@@b㿘@ 㿈 !`%% @L/ @޽? * "@L'$ @ @"?@)  6@""$44*@ 8 " $4@L 㿘    @Ӻ@㿘@h @ࠒ 㿘 !`   !@S @@ӗ00>  ; @!  "В  @2 6"К  @"@"@݈ !@) >   @ߐ"@"@w "㿘 !`  !@ b@V05 "`1 >  ; @͐!  "Ԓ  @ 6"Ԛ  @"@_#@B #@+Ԕ >   @#@N#@1 $㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `? #!x@ђc( 㿘 8 >   #  #.@>@ *` @ *` * *.@ >@+ * .@ 8!x@c@㿘 8 >   #  # .@>@ * @ * * @.@ >@+  .@ 8!x@sc`㿐`h @ڔ?   @ #  @t " P㿘@1 $ % $ % % % % $ % % % % % % % % % % % % $ % $ % % $ % % % % % % % % $ ' 'd 'd &T 'd 'X & 'd 'd &ĝ㿘c@ѐ   "b +H) # ! ' %5 7 9 "* c@€ %" $b$" $" $b  %  $@@Ɉ?ߐ?* & @ b @@m@  @ʐ &@0@@"㿘 "`   "쀢`  "耠 @    "`2 @n 1  @Bd ?` KI ,*` € ``z`!#@O @Bm `!`@D#@.  2 ``\`!#@1 @BO  M``@`@ F@U  @$` `   2 `8``@u`@ 2`8     "  "@` @|` ``@ @`  "`  `@B#  "b@Ր 2u`8 c@AА 8 m 9 7 5 3%  +<;/-8@  " 8!7F " @ @AcE$   "䀢`#@A4$  ' @ "( @  @8 "`@@% "  "@Ac$  㽐`  @˙  `<   @Ʒ ? @??*$@Gl c@A2  @݉`02@    @))u@ <d <`耤@&h g   @ @_  @[`02@    @(G@ <d <`耤@&: 9   @ @1  @-`02@    @(͒@ <d <`耤@&    @F  @G0   `"b@F#@@ƒ㿀 "쀢` ! #cؔ@ڐ!x3!x "耢` < ( @֒  2Q @n @2ݒ @3  O ##ax  #  #\@!x@Έ?P`? "`@ ?P  $?P ` 1 #  ? $ @ߐ  & Ȁ` 2 `y `Y 㿘 @ % #@) ? (J /"*@) / J .2 J  .2 J 2    @@L` $ `&   &  㿘! #`0@(!x@R 㿘@P@@) / `"#`@"@M`؀   "aT   @ ࢒ ;  % !+ ' 9 5   t|@@} ? fbaT*@`&  @ `  `@} `? `@u`@p@ : $P@ :,@P@w` aT@ݐ aT  @P '@`%`@C @ 2    "P @@  6   `  !Pa@?U@ؠ  4P @`7 @v ' J` P@a @  'P  W@  P'  a@з Pa8@>  @@Pa@С a@@> @ P @@N 㿘 R!X!XT`"V@2 V  @!V  @,! V @'! # `? "`  * " V@!0@j   !  @z $ 4!  ( ,@r 0㿘  N  "@c"@]u`sN o # a `?"``!  <* H$! @jY <EN * @:`! ` ,?"``! * $! @j> ,* : %  #!  :?`&  @  ! * $!  @j"* : 4 NN 4N`! `?"``!  >* $! @i >㿘 !T`  # #!x@Jb 0# #!x@Cb8@m 㿘@Џ @D%! $#@=N$#N`P@  @ #86 㿘@>*"h@8 㿘bh@ 㿐 !|`' "@rNb %!|b@ǭ @b@7 $b@Ǣ  c @ @  ,@C 2 @ $!|ဖ @"@3   ?"c@ ,'<'$ c?c@˘  c?c@ $'c  @Ÿ 㿘N  "*`:  c @ `2  _ - @=   N  㾘!@  "ax@<㿘! !x "@0c$!x㿘 !x` c@"#   c@c`,`7 #㾘`!@א# @?㿘 #@ώ@$@χ@xؠ@= O؀ E F Aؐ@3$#(@="O؀ F? "!x@_@J@ "*@#0@= @nsٰ㿐 c @"' OO㿘`* :`` ,, ` #h@<,@<ݐ#㿘@㿘c@v @ǐ 8 !  % '- ) p @"l| 2|c@N @"!@B@@2㰀?• m* @@`2@@@,` -6 @@& @?` @`J /"*` 4`@@!4  4`@@O  !( @@!~?2@@<:#а @ @8#ؠ+-@@ȐL `?,@#  `  `..`2 @   /@<c?<    /@Ґ @< ? /`, 㿘! #c@!x@0 㿘@ F GP Ep E F B I J\ I` Hp J K Y Y Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Y Z Y Z Z Z Z Z Z Y㿘! @!"!@ @x#  "*` @*  $a`*`@! $"㿘 - H@(   `P@ѐ 0`` @ ~ "#@ ` `` @ ~@ `2`` L@ #"ՐH ҐH@i &*  *@$L@ p@y b @W  @6$ `+  @ ~ "# @ ~8L@@ `2`L@ ,2B$` @ ~ "#@ `  ` @ ~@ `2`@  @$   @ ~ "#@ ` "L@` @ ~ @ `2`L@$$+ L@ 2 @`@/  @,Mb<`b   `!@wJ @DÐ  @EX 㿀 J`e3     L - L    L  n e  E`2L  k   f L -b L   \  6% `63_"*` €` ) '`%  @F䨒  @Dd   ` L`  @E䨒 6  @DM @f?ƒ?  `*   @D`   ?$ *  'd  ' '' {`h ?" @a`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *` *# ` "`@A97  # 쀣 "@{΢`쀦  `' @ 6&`@{֐ 2 @z` @{ ` @{ 㿘 J@  w`?  !!! "  v ? V #    #@e?耢 p# *  `2 ?`2Ϯ ΀   ` !  @x#@x  ` ! #H@x@x  " @4h   `!@Cy ?`_#t*` €~@Cj!z `!0!H  H@CY !X@CQ@f _\@CH!h @CB!p @C<! 2 @C5! `@C/!@C,!<9 a!  H@C + @C!  `!!H  H@C  @B! @B" "@B  @B X22`- 㿘㿐Jb(      r7  s e  # t   #"@ "@$  #  `"  5`9' _#*` €# %# % %# %@ # " %  $ % # ` +,- -#@dI?Ȓ?`'@a " `'@a " # ``#* `J`-`+ `J  ` $# ?#@@A"Hs #* `, ,P @  - "*#* `C `"#* `64`"%@@@v@2i ` ! "*" h""x"  @@}j  `@ "=`@ Ѐ` `8d  @wV@ "`- +1)-- (bx"   @}2 @@A @ `Lװ 0@A"԰ d ϰ @w @ Ģ`"  `` @ "`    "@0"+-5  " U`R`@AZ""@AT" @AN"$@AH" @AB"@ @A:" @ @A2"@@@A+"@@A$"@@A#@@A# @A ? 07 ### @A  0 @@ -@@ -  " @m@@#8 "@@ߐ @c @@ؐ X "@  2i@ BL5 㿈 `   "` H' ''   #  - +`9` x*` €    '    L ' @blc@2  * ` " J`-`+2  J       L`?` @@k#h @b5 @ސ#Hڰ 8@u`/`;9  =5 @ 2"쀢 ' c@jْ"ℐ`@jՒ+ `2 @j =0$ * $ @b` @@-X`ڤ "5 ) 97  =@{P d$@@\`@t`<`2:`27@t ) $쀢 ' #@j™ℐ @j+ `2`@j4 =0$` =*@`$`@b  @?ސ XP #@?ؒ H'@t`  `$ `" `2(`$ 2"`` $ @#̀`  " @1  `" @\{#$ `$ ?$+ $8 @@`$d`  2l㿐 #H  ! %"  t ? a# #     LF #@a:Ȁ?〢 d#* ` % @sҐ@t? 2  `" $ ϒ ?$  2@t    $c ?$@t 2㿐   @>#0  `? @4   㿘   % '"  p ? l  z   ?% @`?• n* `2 @E| 2 @Et 2   㿘@z0c  cJ` `? # @>#(  H@`c ?c * ` @C `  @C  J `" 㿐  x`+   #\#`@i0   #`#\@i{㿈  ) L -&#   *    "# ` 2%@tk  2  0$ @y`@ ) ' # %"  s ?c" c@tH  2 c  0@=ް c@_H?ဢ lc   ,`    `P@i " @=c H    *  | '%@]  '?  *`" @=ؐ  @=Ӑ    J#퀢`   |`H ' %,`@=``P @= Xu  ' `'@    x  ' ? @@4'@@4 ?  h "  @` >   6+'L % @B 2& %`@\w쀢 @<Đ` ?  @$'   `@$. 6 ` `@o2 @<`,` 2L㿘   J## ``t  @^$`t$ 㿐!  H@^# ?# * ` I  B!L  @*J` !0@  $ H @S@S㿐!  H@Z# ? #*   @W_ L  '  @7@  d*`2` :`   2* 2 `:  22 2 ` ( @7H   ?4``8#  @7< J@ b  @S3 㿐  d  ` T8 @U /  %% `*`?&@T&  &:``$`* $`&`&   J `   㿘  ! #"   v ?%# #@Y]`p? f#*  "()@v@ " $#@6Ғ`  [@r@ @{Q @' 2   ߀㿈@!@ؠ x@7J#@Ѣ`@7C!@ʠ @7<@İ @76`@p   R  ""䀢"b" d@!/ǪO@Y ` `@ '   "@ b" @  ''̠``%   @{$@a   @l@a "  @^@aِ@^x@@X 'ؤ!" p :  @ *@@5!@5!0@X~!?倢 ?؀ "!@ % , d @  `؀, ؠ *@` $@*@ , `$@@   @ *@&@㿘 "&?,? .`?,@  0?,@ `` `㿘  d` " #ذ `d. ` R $L@L 2    `d R@" @   `d`d"    L 0 @ H P  Ƞ p 0  @ ʘ Ʉ ɨ l Ǭ  ` 4 H h h h h h h h ̰x tttt!b<|'''' 'ؤ,`2@q\` ,, @qS` @5A h f ,  ''܀Zؤ V  #+€  ꀤ#  €   @ ؀`ʀ0ܐ?'܀  M `@q`0 "'  @ `?`?€  "'ܤ'@㿘`"#N  N@ *`: N`2`@pʒ 2 `@  `?怢 `N@ 2N` Ȁ  `#p#t*` €-N%NN !`? 2@R3 '4'4 #J '4`?@x  @s @n @c@@Y T <  D @M H < 8 @A < < , @5 0 <   @) $ <  @  < ( @   < 0 @   (@   $@   "@ @  Ȁ 4߰ ̀ ذ  @S4 '4 $ 4@'44@’   # @ @  @@ `? @S @o: @Sz 1@o3@o2 @o  $ 00@)  ,@)    r$`-p#\*` €0, d`?0, ^@ 0,@Y W 0 ,̀@0,@M K 0,@F D @Œ > @8 X@44 @8 , @ X@  @  @8 8@<  `? 8  㿘@8` #`@t  <   I  ?  ` @0@㿘@   €  2  X   `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@㿘 2m  €   2_  €  2X xP  €    2  </   2  + €    2    2     @ؒ? 㿘   ``? `    *` @m`?   $  ` 0"㿘㿘 .`   ` &@1!80!@@1 㿀 J"("(`    /  H-b( S*H a*` H * * f"  a ?' H" " @Sb(?퀢 S!H!H` "L2  b@1  *  @ 4  "@1H 0 @mPc 2!#?@'i  䀢   *` 2 @1&#  @ : 5aH vaH#-+' 2 @耍  2@182 2@1c@ : @ː @1P 2G  *@缒 2?耍 2? @   !#X@cM#p@0Ɛ"  2 #2 2@1J#@  : @ @1?#P 㿘 #? "0#"0 """ ""uc@i ! <c "c  @ "b<@  *b@   <㿐 < 4  p cԀ."< `@`h %    "`l#   @s "@r@  #   @s @r1㿘 "<`@r  cJ` J` @ J` @xĒ?@Y 㿐  (`  @N @g @J   @TK   ` ?㿘 @X"㿘 "`2@ZҒ 0"* "㿘N  "   ?*:  @Z N$  *@`$  N P "8~ v""8 b`# '`(b0`! '` '`'`'`'` '`$'' b0' ' ' ' ''b` ۖ w$b0 "@'ݚ & & & ܔ & & '///@n/L"@b0 2 ?$b0L"@  L"@?& L"@ L"@?& L"@  L"@?& L"@  L"@?& L"@  ?& @8   @ G0 `  @mߒbJ   J 2JJ- + 8`(8  J            `?J `2"@ 㿘@S / 2 #Ĥc ,`,  @\  @M$ 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@3  @ ,`@  @*$`@M,`` % @  J?`/2 d`b*`'' @' d$< , `, @''',`@@"`@' d$< , E, @'''" '7 5 @#  dC`( @81  @   5 N@ \@ 2.@  .@   N@  \.@ d #@Az`"" &#@: !&#c@. U d ܒ` ''' ``$ @` d$< , ٔ, @'''"@`'d"@ ɔ    . `2  d@i @ J`2d@. d滒` "&&㿘 @@`@i  `"@㿈`ذ @# @ `d擒``d e` ''' @6 H@1 @,8`d    @" L   "@I@m`#@nZ  H@;":   &`dM` A`d. * `    $@@ $`2 @Z "$`$`` ?xp@z   `d,  &@  `d `*Ȑ4@Nג?  @h  .&@`d` ,`@.. &@ @' `d$< , 忔, @'''"@`'`d"@ 寔&㿘 &'  @ \  *`*:  ' " ` = :24J  &" : \2   6 J ` "   *` *:  ' " ` = 5$  "# @ `    `2  N @g#Ȁ ` `N / N /2`?'&㿐\`i '   x x#x!@@  `$  $@$'@㿘` A   d`@IQ.N '%L \2LL  "L `*`[`?`$"LL  (2L@gЀ  L /"  L  \L  N ~ *`.@*`㿘 $ @@ @*` @`@K@J    K@ K @" @*`㿘 # , @ " `d䇒` , `d`㿘`@p" (NN / ?N /"?N /2?N /2& *&㿐@a* @J @` `d`$< , !, @&`&`&@`d@Hz`@"@`&@@a  # 㿀@   `d  ' '' '耦r@f : @@@ `-" @H] @ 2 @,  @`,@   /,  " @HA@ $@< ": 6%,",'@ @䀢 6@䀢 `d@,  $@ @@㣒`?`,&M@`㿘 @k/#@k  ) ' ƀ ƀ &@? @`N@f# N@f ƀ 〦`?`ƀ㿐      "d"b\"h#bT#"`""X.1  h  l%     !     "b # D(☲#"#b d$bt$#`bt D"  "@    "h#x#b|#"l p@?m ! "` #  hc#" :  *@p#?$"#)  ' @ A `@  "*`@  @  `* @*`@` b 6 ""%"* * `c* @$` "`  0 0 `".b0T"@` ؐ @E 㿐 2/@  0/1 "?? &"@C"&" 㿘 d  @ 0b>  *  *` "dJ ""d 㿘# b` "X@ ! "\ "@"\@"\b`@$"\$b`@͐ ?㿘 "\' p@^֐  ?@ ~""1 b\ "h `?"l@p  "h@tLb\8? %"l 㿘  㿘 "\ bT! @   " 4$"" @$""@ 㿘  `\@ @p 0 4"@  㿘 a ─ % \ @ """─ ` @t b`?"\ "b`  ) L@-@ \`"@\@0%"l "x t`" `4@!   @   "b@ %"l\ ?@L\?㿘@  㿘@ 㿘@T  b\@㿘@K  㿘  T"\  @ې 09 ‐??2# "#   bT  ` *:  _ $2bT#    `2*:  _" $"‐??#@G 㿘  `"\  @ 07 ‐??2# "#   b`  ` *:  _ $2b`#    `2*:  _" $"‐??# 㿘 "d  b|   @""\0b\  "\$"\@J"\ "\0  "\J@`@U$"\"\"\㿘@??@+ ??㿘N  * @ : N`   "    㿘 "p@ŢN` bh   @: N  hbp*㿘  "@# 0c  `  @֐ ^  ? @@О@ΐ㿘 "\ bT @   b 4"bb ]"㿘  b\`  @    4" G@㿘 "\ b` @y*# b??$b% ` @bӒ   bT@bɒ b@y 0??$b 㿘 @M"\ "??#"  T b`2J@U 0 T" ??#" 㿘@D @B °  "` *@`""` 㿘 c@6 㿘 `h@/ 㿘 b * @%"@ 㿘 b * @@ 㿘 "` @c0  # b  h*@ * @"@ 㿘 #Ѐ   h ! @ 0  "T"b% "T@T# "T ""d@}"T @$b\$`@"`@y 0@ 㿘   # `h"`" :"@ `z 㿘 "` bT  "`y04㾐?/B )3  J??..?# %*.@ #` `.! "T@f  "T&O`^ B?` @"@D ``@#(@@:   "  `@? 㿘 "`? cЀ  % @# @2 5T@ȠL@`^ ːD?0 cР?:@   h?$⌁㿘J@ ^`@@S_   ?@S= ?"㿘% `# *bT' ` Р$ bT@$\bT \   ""h$`#"d+@ ""@ 㿘 b`} 㿘 bTv 㿘@? 㿘 ?""l@ 0@ ?%  "d bT   #h!  D @:  D $x x t "@  "|@e"d) dbT@2 bt "`"h  bt 8/  "`"h@  d"& / @|  btx?@`"h@  dbT@  > *dbT@8 <@`?" "h@[ ??"h!L\8? &bl㿘1  "T"\  @A 03"`  J#ހ`" J"\J"\GJ"\DJ"\ ? ?*?"\*J"\8J@"\5J"\ ?*?"\*"\J@"\   ? `    `    ` 㿘  "\ b` "T " #@   "@ @ """@ <T  y  㿘 "P b\@AВ1 #X c* @ "#Xj#X * $@ @  &#X㿘 #X   "c\"#\ #\ ?c* @  ##\ "\ "bې 0@Ԑ#8Ր? 㿘 " 0  ' @Ő#PƐ?& ' \% *`@!@  b\%"  \ ?$\$\\* @`\\*`   T      """bd"\"`#"h( 㿘@S  㿘i "T      ""d#"`#b\ h*@v?  㿘  d@A!`N *:  ^2*@ N>  ?`  +*@`?` N *@  "  ` H ^*"H@ ?*@*"H("H㿘   ` !ݠ#h@$ 2 ! `$!Ҡ#h@#!#pː@# b.  ` *` # * @#ݐ#x0  b.  .` @#Ӑ#㿘 "` @#,#ð ##  *` *   `2 @#cx :   ,  ✐@     2✠   6,  @     ` 2N@el . %#  : . *  "@^˒ 2 ; . c*   #@"B  @@bP ✳, @ 1 ` ."@  ۷bP✔@*"@ "@@ " :*"  * *+ @ " :*"  * +  㿘# bPM ?"bW#   "b ! "* "    + b@* b   "F  ` *  ` @ G* `bP),$" +   b*" +  *   8("8 ✄( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $ \ ━ 㿘 "`@V 0 "\@"@"   $b 㿘 ─ "\  "0@6  㿘# % ' ) + TXbd"`@b\bd!!T" %b\$bd$T@$X%"`Q@$T$X$bd%"`%b\@?C @  㿘 @`  㿘 @Z  㿘 @T  㿘 @N  㿘 @H  㿘 @B  㿘 @<  㿀  "`# "\bT#\#`" "  4 bT@ 0  `@ R"?% .  뀦6 ߐP   㿀  "`' "\T#\#`" "   @ 0E` h 08" ^ T@ }@Du@# ` J /`  P ` 3 ~ T㿘 "| 2`@\ "T :`"p"   #"p "bd"bd  bt`"  (㿘 (`?"(  d` `J@"dJ``""dm 4 㿘  !  ""x "x"t y ""x "x   "x ? $"x "l` "x`bt?@㿘N `"p*` : N bp*`㿘    % #  "# `   , * ?   @ `,     $b$h$$b 㿐1 "T^% "T `" X '"@ "T   $`* "T#b\#"d    _  㿘  h@` S 0"`:@?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' O0K  N )   " '!N    " '2  N  "  "  ""  '" ?`"NN     " '2 , < .. 㿘@ U㿘@  L㿘@ C㿘 "\ b`  0s"??m!"  ""`c "`  `*:  _ $2"` L c `  `Hc ` b+  * ` " 4  c ` U#+  U c  ` *  `H*@ `*`c  ` *:  _ހ U $ۀ U"??!"  㿘 "`'  bd "`   "|  N`  b|$h %"h / 08 08 08 08 08 08 08 08 /D 08 /h / 08 08 08 08 08 08 08 08 08 08 08 08 / 08 08 / 08 /D 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 / 08 / 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 08 /h 08 /h / %$ %, %8 %` & %H %X 'T ) *l * * $ * * * + *㿘' # d c@1`$ $$c@* !"dc@E d`0$c ``@L㿈 C!  d ``'''@ `d  '''" '`"  @g  `d$< , ܔ, @'''"@`'`d"@ ̔ 㿈!  d ֲ` '''@7":    H dƒ`㿈!  d ֔` '''@" :   0  H@ƒ d֡`(  'c@   @b   #J`2J 2J 2@!  d  ''I  '' (@  ' ''Ԧ?$@@:Ő!. €N   ԓ-  €ب Nհ N Ѱ   ڸ ظ   $,@` (,@N ``?$@@: ,@N `4 )@<2@X  ' #  $,@` (,@`,@N``?$@@:] ,@N ` ),@`,@`" ?/  @@X~  @]ːL n?$@@:0  ,@L `\  @X_ ؒ@E  @Yא  @ؖ,@X ,@E#2D  2    d c`" " $ 4$@ 444 $` ` %"  = #    ?  ,@` ,@a `b"( @Y ,@T T    %"  = #  E ?/?,@` ),@,` T@]" T@' T@@ d `@k @]}@]'؀`2T#@ @ @T @ N '   '~ | 'z ) 쀤@~ J  l'd   J  b'؀ W䀢 2  '܀`N'  h  W䀢 X FW䀢 D  A ` % '`  ?"` `  "`@E  뀥   ? @F '? @C'W䀢` @  "` 2耥  2,   *`    *` n 2,@i ,@`-$@`@$@ @ @ @p ?(`@7(@``  ``d$< , , @&`&`&@@" &@`  ``d$< , , @&`&`&@@T@"@`&@(@  ' d  ''  ''쀥 w  *` x v  R,?߀`]O#\*` €G [`@ ,@?`< `,@ 6`@3 {`@0 ,@`*`( % '  " ('@  @ 2  #? ,@` ' 2,@,@``,@`  㿈N@ $`N@ #cNN` _ } `@U [ % *O  * @ *O  ] *@a}@ZB  @2 ' $+  2 2c @   d`+ @Z @['  `H @@ + cJ `   2& @ &@7<d @7M`$$@    N :   N   N  * `@  @2?N  J  2&?&'N@ * @'  %%=#  d`` 2 `  H$@ @ +   @`$`` ``?$@$`4`  @UF [ t O  * @n O  ]j  %%=#!  d Z` '''@`@Yx  +   d$< , R, @'''@Z["@`'2" :    H$@O `@  d I`6  d, ' ,   '''" '$`@ `$`$@O  @`?4` = @ * @ B? ?@Y@Z$`$@ +  . @2 "@@J`  H@ += -?cJ cذ cJ ` @ H@ . @2 + @㿐  d! `@,8 #"`@L~"@ $#O V@ .``)``$`    " ! 8 P@T @TȒ   @? 0 2!6  X@F@ @?ƒ  @R  @< @ 2@ @b@v 6 &  㿘@T  %2#0Q@0L@8J.@8 A. (;*7.@7 ..?:(*$@7 2 ? d&@5@ @7֔ 2  㿘`@" : @* 2`@`  ``d$< , , @&`&`&@@P@"@` &@, @Ȓ"@:` "@@94㿀@`$< !  d' 'г!' ''쀠`  @ `@&> &@N@2|  2   2Z @Z  "  @  L / '< %@(@ @8  ? @   2. @ (*L /%< @ (@2   @Ȓ8  ? @ @<  2 /,@`,@ % d$< , =, @&&& d$@@4"@`&@ /,@`N /?$@@4,@N /`@RҒ /  ,@ @6 2,@$ @" @4y@`@@&@=P @ x@_ D  9@ ` . L 1 .2LL +L .N .#@6  @ː @"@@43@@&@ @魐 2J`@2,㿘@RQ  -$@@fL@`" @% (2 @`L@  @ `@R8 . .. catchmodXchgrpX cp dd df edexprXhostname0B ln lsmkdirX mt mv pax tarcpioX rm ksh shsttyXsleepXsyncX . .. binmdecsbinshare . ..bootc bootxx binstall$ installboot ...E4 J4P4V4b4l4v 4t44 gcc2_compiled.filestore.9bootstore.10prom0_fakesaveechopv_putcharpromdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.47putchar__maindvma_allocprom0_icloseprom_ioctlprognameallocprintfprom_sinetif_debug_udivpgshiftmemcpynbpgdevopen.udivtwiddlendevsprom_bootdevicedvma_mapoutobp_strategydebug_rttbzeropgofsetcputyppromvecloadbootblock_countioprom0_strategyvprintfdvma_initdonottwiddlecloseallprom_initpanic_uremmemsetmainblock_tablesprintfprom_open.uremblock_sizedvma_mapinprom0_closeprom_boothowexitstartdevswprom0_iopenobp_closedvma_freeprom_bootfilefreelistfree4 `@# ` "x" $@` `T@   bx@"@H*/+  "bl  0  "# "# * "#!` "#@㿐@#  b"b @ "  "@`@  @   "l@@㿐 `@T    "@`  @ D ? c' / - + ,`2 @k      @^@w @`b@S@?@2 @a aa @\` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @#1?㿘 #@(1 @#1㿘@ʐ " ܒ㿘 @  㿘 #` @ "l `  "h  ` ""hJ  *@J` )*@㿘@  #` @ "l `  €bh  $€bh 2$   "h @ߐ#00   $  $`$` 㿘# bl`   ``*  `bl   '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 "l  @@ 0(@  㿘  @ $ ? `$ *㿐 "l/  0T@㿘  㿘 "l`t€㿘) ! ?N  @  "b0b0$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @"#H+  " * @7 $`0 "$`4 " @$` @ 2!&  %!  @#h 㿘# a  @ 4 "$a & 4$a㿘 #*`@   #@     <         #@y` ` #@  #8 <?*  ธ آ&@  `  #ะ@㿘?( ,1 \&"l H L` T ` X P d l$ p  t @  .@ ༔༖ ? * `:```?  ` "`"     ༐?"  ༝㿘 a'H'L'P'T 'X "a@EH @5#㿘 #4 4D44H4H4H4H4H4H4H4 x4H4H444H4H4T4H44H4H4$ ( 㿘!   l'L'P'T'X$"@L"*㿘 'H'L'P'T'X#`@ H㿘 #`@8N@`N@`%` N@`|`  *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈 #Ф@ @,@  ?L?㿘  Ā`  !  cJ@ #!Ր @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" %s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx4(4,4444 4444   4x444444444,4 D74@4K4Y4 Hd4<q4444`444444 4 40 4444444"4*480 4h@4tL4Y 4 _4d4j4r4y 4l44  44,4 44444 44444 444!48,48 4p (=   @=׍{Y( @@=@@<@`dT U=@@:00(0pLl ?@A=I =t=t&FA=/=2=3% ,glA=v== ._PA=4s=4s=4s i$m}=v==X`hpxr8$m"=v==X; /o=v==.h=v==;3 7g`s40܉pO$fPGHߗN#w@ 8Mou ‡X^`N`**v5/[ |UM!78pt:#L2c'_X?m)HVSTĉ2š(-*|jHOƬ׭tgUGDXjѶELF4 L4 (  `5XOpenBSD㿘|à 2u @Z"au@1  @D* @ +#@㿘""D@5|  &@ / &@ &"D@^@1r*`:` J " 㿘" ?" `     , `2 ?,  ??@@??㿘"` "  8HTl`㿘~ua@@1!x@1 㿈!+7)#u%|5-'/u%耢` @"l*` €"$" %b &T %"P@~b| "b@xb|"b@a?ؒ?& * @&X %L "`%$H"`   '''  @1 ?ua@ &   ua@ɔ  "u!$""P Xu@C!Lu@?!Hu@;!u"@7""@Ѐ u%b"@aȀ "u@b u %bb(@ L@Q H@0v  @: XuHbH@ِ @ @0d @T`2"@HubX@  @ uHbH@  "@*ϖ 2ububx@ @@耢 ub@ @ 8|!Ф@ u"     "   u"@̰ 0@В u"H@ @c u"@0HȚaB + cB + 3`  *`  @1  u"@01@: Ȁùu@f"0@^b      a,c?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?%" @!  ?" "  ?c@ ! @  @!  #? "? ?c@ ! @  " @! @" "      @ #""""bu#`u #0 u #X@H@ ؐ@?3 bP""u @>#"u`#u#u#@1 u@-#Ȗu"#@'&@"@a &&  `  㿘. >@( 2v@v`@Ԑ @v`(@ɐ 㽐@ ubH@ @Ԓ |v`@@ b F """|"" b * "b䀢 v`P@ "P`v h@ b @P'%v", * "@ P  @b @"P v@ 04v`@    v`@   v`@R @ v`Ȕ@J @? ubД@A @bb(v ؒ Q@ 0 v`@+ ฐ@/@0^༠@/* @0V @+P@/x`v* d0!, &@+@xb* 0@"0 ;  @ C@8 " @ v`P@ ""@P  v!@ ( (  `P3/vd,b*"@ P  @   `2dP `v@ `>P v!(@ Xv0!HĒtP+)vd,b*"@ P  @Ő t `2dP `v@ `v`P@x  㿘 `R  $D`  $$` $:  @.ܒ  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  v!X3@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .     $ PaT@㿘 !|"J`#|"" *@$"J@ -"J`v" `$"J``- "v""$"m?"J  $":"c @ Ð 2J c-"X?J`||b "b|" `K ?N :G|!v~!x2b : ""bJ8c|b 2"b"J@ ""$||"` ""v"$"N`:| :" ` |!v~c!xb@   ?*`@"bv"`$""c$ PaT@㿘'L'P'T'X@L㿘|a~!xvb@ `@ v@ b@+x% PaT@$ PaT@$$ PaT@㿘~'H'L'P'T'X! @ H$_ PaT@$ PaT@$ PaT@?ch?# @  @  Ժ ?@ ?# @!?4#a/?#?  ?# !?$#?#?  ?# ! ?# ?#? ?#  ̀??#`  ?`?``?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ?#?    ?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2  2 @ @ ,  ",, , `L@  @,@C㿈   d' '> ' 'L@?"@$ `@3Đ ``*@L@` 2 *@L` /"耢 :*@ @   @'; N "&@?$@3 2,  ,N  &㿘N  +@V @W2 NN  2 N@V @V - N  @U @V@   H" 㿘!  @Jא@Kq 2 @̐ 2    @3c$ `$ 㿘  @Qm  +N {2( N   `N { }   ,?2 "N  逢` # u$0e    `d$< , i, @& & &Β"@`L& 0B> "& 4 N { },  ,? ,% 2# `&  d`@@@@,g  2 I I I K M4 M4 M M N N P Pl O O Pl Rp Q M Q Q Q Kt Z Z Z Z Z Z Z Z g g g g g h㿘 @ؔ X'D'H'D   H H DR` H?D@ {@0   (`@L# DR`YD D"`D  `  *`#cT:`'H$ Dg J#`4`/ "! @T @U_ @@"@   % #   ` P`X@@  @  @<"` @H ;'HD` 2 ! DR`"! DR` !  d @:` d @"` @ D `%D `#  %' @V 6 '`R$b` N@J@H D@?* : `<!*` €HD@O'0.DH`H  'HH 'H@!  d  2 d  @R @ǐ  d` 2DR`!! @ @ DH@` @ @H 'HD`'DDR@ !  d ` @R d ` 2 HD@u`@H`ܠH "'0DR`DHŒ aD`'DDR@ HD a c@A  `d 2 @    @3 @/@/c# `   @; @-  @L !  d  # 2@D  d c2`@o @( @m$  쀢`$   @ @[ $c@  $ `$ $  @  H `d ?2'HD H@b0VDH %`D!E'D `D R@  `? DH H!'H03D!(`?D '`#a'''''0 'D` " D  d`   d' 2@ d`?  @/@. `d @   'DR` * `D@R` '@T5DHʒ a'`0'D@R`@T" DH a'@o '0  d 2 d`?  @.@.] `d @   '0DH a'D!DR@@  `? 0D `~D!r DE D Hf a0=D |D`'DD`aDR`\D '` c @1  '@ D 'DD 8DR`01DH a$D`D@HDY 0D @W@'@I@.DD`@~ ` !D@@DY ؔ@' @."bH @-  H!  J#݀`@- @Hǐ 㿈 'H#J` 'P 'J`    2 (  "@T ?@S  HL  ^" @ 'HH A @OHp b   JP 'P*Hd ` < #@3͒  # c@3͔a p?+   J#`Ȧ = #*`   @ 'HH H `Hp cT  `'H ! H Ha @P|H H ` Hh   J؀ 2  @ "B7  +)  9M!`(`2  @Q  @RĒ @<`  `  P  X  @c& &  &`@M"P@N `H   @_  c & "c& 㿐 `L@C   J`/  c ƹ$ ?$@C 28@  '?@V `   <   I  ?    "&㿈2&@I  / Ő 2X 0VQ"@Q@_    d' '2 ' '耦`:@H : @F@$" @*@ /, "@@*@y N@ ɲ`Dz  㿘' @% ! "$$ @4  #  #@/H$`, @@5h$`,$$、 ?      / J "`  #   ' ' ' ''''J`!!'!"X@LŐ @M} `  @HÖ@ ?`P"*` €I G" J `B&  @?@ <  30.."   @ `'L -  L 2 #     @ | ! ؔ` @Ht |@ 1 ?J ` ba(@ " ?@w$! ! 2~?  "h  """ @>`@  c? d *`R   ?@   d` *2 "@@ =@    ! `"@H   @>b`@ Ő  +?@'?`@` ` p"@   @ 9@ X   @3X  㿈?''D 'Hb@  ?!  d  @@  ' '쀢`  `@v '  `"""  @=` @ _쀢 T?@3<# '@' d @~   H @'"#@3?@q䀢`  d! `@Ր D" "$#@ !c@ w  ``$#큒 @6g @6dD@'p@3\?0@D?  !`@=#@  㿘 + )'% , `2 #` @K'c8@L!J`@8@K#P@L@ }` oH(  @K c8@LJ@ ۲ @"$ 4 * ?  H㿘.`@ X`@6y㿈   @@&     @#   '"\ ''@.B 㿘.`@6C㿘   @@&    "<`@. 㿐   `A`?K  K " K`? ) K  : +@  +@K `@* +@k`    D*`  @F?`?   $ 㿘`   "`1   H耢 X T 㿘\㿘 &c`@ .  t t t t t u x x z w w x x x0 x@ xP y y y x@ xP x| x x` x y0 y w w x x x0 y y y z zԝx"'ؒ'@&@x'ܐ 'D'L'''@%' `d @|ܐ  􀢠 *@"@%  L  1 @ o H@%@ ` (2ܐ '@"`"@l @ܒ ("D  @ "@K 0@J L@KD@% 㿐`C!ԓ.` €  ''&"  *( )"  * @Jn  !X @//@ *`#@ap a aaa@  0b@  @% 㿘 `Y ߀ ```#@ @u`! 86& `"` `?.& 2- (& `@b ϐ`$z  @R@  @E d `:@ @602  ),`@#*`  @`@  @ڒ  ` ` ` s@耢 ``    $ (  `!*` € @  @  @m0   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @z `  @ `U   "  $ ْ@` `  "   8  ?3$  @   $   ?$  %8^ @8   $   ?$ "  `$ @"@J@I2&   ,`* `@㿘` "#L  `2 &` (  `* @ 4  [ L * `2 [2 ` @N 2H `  ! @&`@@ "` d$@$є@Gq d&`p`[ & 6 _'   _  *  @2L #"Ld $@$@&` }"`" `"` `@I d <`' '&` # @* :  ` 2  @4Ӕ  M ` 2&` )&`&`㿘@@K` ` & "@ID @H"& 㿘N 2@@2 .`*  I $ .`*  > 㿘!  d ` d""" " " * 㿘N`  @@" @b @H  @ "$ ` @@ @G&@ @ *@&@$            X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 0 (        % ?3`C<#*` € bx@B ,`@~ `d @#w@3b`  @1"  @ؐ" @(CbX`* Q   `2 2"@" `J@ `@A{ =    d@#`$ @ ,@    2   @"V  @ @1  G@sB `@p"6  2  2 2  @Z"  `" @ @  @    @ @  @ `@֐  `?`="# ,) )7 5 3+Ȑ"h":@0# $"@0c@@ 2 "@0c" ? @-q"  `d @ @Ð `  `!`@7S#@˒  !@0`#" ? (@,ܐ?   `!@7-#8@l J#` #  @Ea#``@F) # c#h@ $cT`  @+ 2 `@#F @rH    #'`$ i' '' "  $" @!"@@.S & `@,x,@(L$@ # $@6Ţc@=@,f 㿘@ #+ ) ' @?  #, L " #Ȓ   @# @ ,? c@%c㿈`  d@!r`0V@|@|    d' '  ''$@"  @!o@xĔ@x@1  〦$ @Ő# @{ߐ "@$@!F@x$u㿐@#P /  # ` "h* @ h*@  #Ѐ `+@K/ h `!@)%"  #L ?    1 `h#В " : ?@p '#@\ #Б* @㿘 # `h  2 h  @D  h?㿘  c h@3  㿘!   hcЀ # c% 0  " Acc h`?$ h$0    hЀ`"8@*`   㼄  "# 㸐 㿘 `h  Т " : `? @{ cаcБ. @@ #h@!?- @@0  cЀ c@@0 cа&@ > cв@@ h@怦?㿘 )  l' % hА"@ : .  "@@ޔ В̓,  % l$h$Ё㿘 #Ā`"! # "1 @> 1 # # @ # "c&# # c"h$#" @Scȁ㿘! #Ѐ    "l c["? "`h$#Ё㿘  c@Ð@> 2* #`@3  1 `l#Б* `h  [c`l#Б* ?:""l#Г*` ?*"&h㿐 J#`   "Ĩ "@B0 @C* s"#  @rc$" @l! g@ޒ !  @$##  @u   ` "#@ G@,B #\   @q ?"c ?   ?c@%@@c` @) `l cc@I c@c@@cc#@c@@̍   @u+ $c " * "        2   0  l'@; %@ 2  p# c0$@-@Ւ! &# @  @Ր  @\@x c@o @f@Mc@t"2 @?  0  2? "  2?@" "@  㿘 H@`!* €@ 6`4 @`* / @`* ) @`* # @` @ `  `hЀ ?  @`& o `  㿘  h cВ$ : &@@@ "@*  1 ͒#̐@#$㿈! #@ˎ #  @t,   #@ )E"@ ##\   @! ?:c  @ڒ01! #Ȓ   j# #Ȑ"@Ȱ %c>  > > //#///@ #@xx @#  @s %c#@> 0@㿘! #@4 @\#$#㿘 `8@Ɣ  @ 㿘   "b",N'H'L'P'T'X  3 @t bH@+@* @(b@ 㿘'L'P'T'X@a! "L@+ @*@(㿘   "b",N'H'L'P'T'X 3 @C  #`8@+bb@+ŔH@*Ő @(nb `   J#퀢` "#@ 㿘'L'P'T'X@ ! "`@@+dL@+@* @(F @ 㿘 !  #     "  @;     J- b"@+8`8 ! #     "`X @+$#"`㿘 #'H'L'P'T` 'X! "@+MH@'㿘  ,'H'L'P'T`'X`h  "@+6H8@m   <   ` `㿘! " @&   0@&  ?@&   "cЁ㿘@#    `  㿘  @  `  `  ?א @~%㿘 ` "T@' ``@~0Ô @~㿘@i 6 Œ &  & 㿘@}@} 㿘 "# ` ",NN  2(N*: ?А @ `+( (  %` `  2  p N  @G!&?? #"#   㿘! #`  @@}#?$#㿘 c   c` @}?$ 㿘 # `  @}o?$    `("@?㿘  1 # `# 6## #@}H?&#  #@}@?$   @}8?& 㿘  `!8@v- @ ,$ @$$@)@V  @%M $  p$$& 8 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 8 4 4 4 4 4 8 4 D 4 4 l l l l l l l l l l 4 4 4 4 4 Ȱ㿘  P "c\ "\@\  " "b@6 ) ' J`  *`   @$ J  "cJ   x`! .  * $ @5 ?. J` "J`@l @< 㿘 #آ ' ) <%  p24  2.  2 #J` "%J` 2!Ԁ2   @ Ғ  @䟒  2  @ Ò @䐒  2 `@ @p@2#!  @ `@E  @@ #J` @*` 㿘  cJ` "J`@;    `'  " @ $@  "` `!@/b!Ɛ $   #@5C ! @F @ &0  @2  !`x ,   *  @5*?,  9   c 0 @   `!@/$!  $`!@/!ؔ~ $@cԀ   `!@/ "n $ " @c$  b8`  5 @;b01 `"# !`x ,   *  @4ϐ?, #  x`! , *`` 2` `@4 ?, #J `@;A㿐` ^aH  c@ @O$@$`$``$` ! #܀     pb`M  c#"#"c@` `2$$ $  p $ $ $$$ $"$$($0  "#"cԐ@d ` 0@8 ) `@j,@    `#  0`  @i@b @~ "`?"$` @ "`p$` #J ``   `  $@`  c  ` `@ `@`hb@zcbK  @; @`#J `` 2J  !`x ,   *  @3?, #J ``@hg `#J `!    @3ǐ  @3Ô b2  @f>"  @z_@ub   "#"c* @:;* @3a`[ bb@ @@`8@yb  # $0 " `" `#@#J `! b@&"(` %` "@&@`2` " @%ޒ@#@`  @ 㿐 c@  c܀ `@/" @ 㿐 c @ c܀``  `c c0  @k   }H@  @` 㿐  c@W   &@ #؀  p   p@2 2'@    p   @* "? @$ `!P*` #Xb?`@ɐ  @    &@㿐  c@ @   @ !P*`  #X30) `2 @Œ 2  ``2  @ቒ  @ᆒ 6  `!@,#X  @ 㿐  c@ @b   @ !P*` ː#X`  ` @ #pհ "`(`u#`(  +)'   2$ $  c  #H^  2  W X @"I"2$` @' `"` @K` 2?` #` `  ` @87`4# - `h ```@ !`   b@8  @8 ` h#``` `@+ o0a`   ?@ $`"` A``@ɒ  ;`  )`  $``   `  @7b# ! #  @w`  `! @+#Ș  @ !#@+# 0 #`` 7$`@  @Ɣ 㿘 #؀'   p cԆ  " J` "J` 2  2  2 " 2    8 @  H @  P @L   㿐  c@q     @ ` @` !P*` #XB  #؀``    ! %  !`  @ @۔ ?   "$   2  #؀ 3 "@`X 2  @  㿐 c @   cؤ '  #L` "    @ @ ? 8 "$  2L` ؀  % "@_``2 @ ⴒ @ؔ 㿐 c @ϔ c`"` "` @Ô  c㿘 #  !!2  @.`h  2 ,`p& 0B   c   "#䀣 7$c) +%#؀  "! " @6   c a#耢 #`  &#@#@#؁㿘   (& `  2 & , `p"@ 㿘``$`$ #J `"` @j \ `$  " ? @.$$`" @. 2^ " `   `}$ $#J` 51  #`1  .  ! @m $`($!  @u 6   `! @)     4  @5$ &',   2 $  @5b,  ?R$   `  b@5  `2, ;$,#J `  2$     x * "$@- $   `""b#J `!  "#ؠ" @$@W  #J ``@p  #ب`    p    2  2S" 2 @quD@qq#؀  (`" `  @`2`  2 (  '''"' $" @# $ " @# '''' `$` `  $`@  ?@p  %`㿘 2 (`z 0`  `  4@`2` ,&  ``"  &  : &   &  ? # c 2 0 $  0`"  @2   ? $ c   @c& L : 8c 2L @j L  -c   '  d!   `"R``2 2 #@ #@0 @c# ` c ``@cJ `   #   ?& & `"@ߒa@ `' ! ,  @!:0   ?` ' ! !0' #؀2 +" - ( ֗*';      `0C( `0>8:?  :* @# 1``"./ :  !@ `!@/!' @@ !H`  2 `2  `2     2  /  * @"ڐ`` ( !X @ ė; `ah@ `` ap@ `2O %`!x '!`H@   '!` !`H`!`H@    ; 7  3 )' !H/- +`` P #\#\@ g2 a  !H@ Z     ڀ` 21   @ D`X㿘   * &*@ Ԑ cؔ  , "  2 ,؀ |`   z 2 p`:  %`m k&@L`?F!*` € # #؀ V` R`0T@  c؀ I  J 2 @` #؀ 7  ( "  @!  `"`2.&@-    2 (`@l; #؀    (`@! 2`` 2 (`` &@ 㿘 ` "` c d  ؀`" & ` 2@`"& 㿘 ` "` cː @㿘 #ؔ#`@2 @a 0* " ( `    @"`" !   p @ ` c?"c`#& #`##"  ؖ2`"`0"""" """㿘 (   "@֒ &? 2  ، ؘ ، < D L ל  ڈ ܸ ݈ @ < < (  4 t x'X7 / 3 - ?'xX'|'p't @d'h 'l Hh '`'d% &`H   , @% , 7  J@  \ `"@ {  " #` &``J@  \ `"@ ] 퀦 `?&`@ *`  ?"`  Jc퀢 "''`  `   *` `?$@5``  t-` € [> *`; *,d@7  @\ # ,,\L  `?$@ `, , L d\` @$\" 8" " "P% @ + ? ! 'J` `\ " @ ( ,Q,@ '"  \ "+ \098 \J@  \ `"@ = ,,``&` t@ސp %*  , t@ϐp %  \  ` $9 ,/ ,J@  \ `"@i $͐  \ "` ? `` ?$@U`  , \,,J@  \ `"@8 (: {J@  \ `"@% (t  @_p %  % d $ % @ t2 @Jp %  % % | U  ,,@`J@   \ `"@ : # ,,J@   \ `"@ # %@ t @p %L @ t @p %=  `* @ 0  , X,`?$@`,J@   \ `"@ * `2`, ," X `?$@k` , X,,, ,, , $,@$t  @p %  ,%  J#퀢`Φp @ @ 2% @ ``~ ' p?2@kp ,`&` " \p?2@Wp   ? `* € ("  ) " '`.  \  (  $%  ? % %  %  % `&`%  " \% 2    %  '2 `% ?&`  2',$p ( )  % 2, ? % J` `\ " @ )p?2@p,"@`d   $ @p3 , (,  % %%  } *p?2@pϐ  } |p?2@p Հ (0׀ ` \,2,J@  \ `"@? $", \ " 0  ` ,  2,  \, ) (  ?Z% J` `\ " @  )y @ݐC 'A '  =%  \ 'J@  \ `"@  P, "t  @"p %  ,``h&`8  % , _ " \ , %U % J@  \ `"@ $  \ " `  , \, ,,+ ) | ,?p@ڐp ( , * , , t@p % J@  \ `"@] ``?$@ U`` @#!" d < >` L@ } ` `* @ud ` L`?$ >`?$J` `\ " @ <- & >* &  >  $ 28$J` `\ " @ - $@$ > <  $$   > $ | @$@$$ $d!Wl " `2h,`2e,lL )"ذ ) ; & ( 206 0 |J` `\ " @ | ; | &!,!!!& &$!@? J#`J` `\ " @[ (~!@)0zdlΒ$  o"``@ c `@`@ J@  ` @,@`@ `J@ `A @o|$ 2,?L? J? H!@"  @#  d !  } d``- ) #H@" #! !8 "  @$ """ "8d%`v`)?!㿘   XcX   @ `X  X$`X㿀 y  '`  ` "`  d!' '! ''+ -   $ ` c L@!?$@ , cJ` `\ " @|`ڀL  `` 6@A% '@<?$@ `, cJ` `\ " @I` ߀`?$@ A, , $ `&  `?"`㿘 #'H'L'P'T'X`?  H `8`? (`8"!  H"Ԑ  @^"J㿘r <  H?$`$ $ $ $ $ $ $ 8 $ $!$ 0$ 4]! 0$ , $ ($ ($ ,$ 0$ 4㿘 c @J  $@``n$@ *` € m H@b@`   $`$` $`X$@` `   X$`$@M$` P $`$`G$@`  `8 $@ P" `  J`"`8@'ܒ ? "@ `"`8`8` $ :$` `  `$ "  `` ,`,` $` $`$`8$@%$$@``@  d` ``8$@`2 `   H$`$`$@  ! "@@X@J  x$@㿘 #J  ` ,  `?   @  (<$@ 4 (,&` &  "  "`d@b2 `J`  J` J`  F$ & ,F+ "  `D@ ? & ?#+ %  ( @"@  `$  `( `"@"ɐ  ("  J "   ,$ (" $٠?@ѐ (Ҡ? `@ ` %c "` " d@aː  , && @,$ ,    2)&@f %&# #`2J J ` * J  *`  2J    &   @ 㿐 "# V0Y@+" @,'@b*   B@Җ J`$1J`!  'J@ ! `J'@ "(`  @]J`@!  d'`'@Ӑ  d @]͐   #D  "`Dz @  "`D@Ӟ@*"0@+! $ D㿘! "@@㿐 ' J  \   `" @`k ̓.` €, :  # ^  `* @ V  S  P N   *` G`, :  [A @U 2."8 L # ?&@  .L  `dE`J  \   `" @   *` ` `2, .: @\ 0 ?&@.p 㿈    d' 'ݐ ('  '') J@  @ \ `" @U?$@P,`: , [  ]":`  , $&`?㿘 ` ?"`  # `H `#@` "@`$  * * # " " 8"$##㿘  `  #@J  7"@ `   # $` J  '"#$` ! #@J  "@ \#J` "  # $` 㿘  d`&!" !$ $ 㿘` ~&d``?& !t8@%q   ( "# ( ( `," 9   # ( @)"H      %%<#   "$ @b 2$  2$ ̀@   @$  2   ,8  ` ! #` ##̒#@'$` $`@'  <  $` " 㿘# @>` c@$` 4 #ؤ@$[ : , @$T % N? \ @` ?@h  L  @$< ? . @ "$㿘 %  #  y̐vc̀ 8 cB $ $$ @ 2 $ <  2$ $ 㿘 @("P @)  `"X"`  袐@,  |  |        t  t   t 8 (@   p @!  #" ڐ  ????????'7ː  @'<"`d' @') @9 @%5 H;  L@  #H@   @ @1   8@ @'!P`"    2!`     2-!$㌐  @P     @P$@'!@) `#ؒ *@_*`?@@#b `@#yc `@#sb  #ؐ *`  @   l#ؐ *`   #`  @*   `@ "`p'#    @*"x "@'S"(@(ML /@P "0@  P@2 T@ @ 4J@ @ I 4J@   H@( @V@'!@(@'"8@#N @h#@h@(ؐ@'"aP@(s b`bʐ`    @ D &#"@"H"@@&"P   #  @'Ӑ@" #  #D @(=@vդ##   @Q@   ,#,  @  6L @e  d `. @ $@$` P"X. @ R%`N '#L  #d `. @  $`  @ } 0  $`  `  !"@ܠ"p#`&%` `,Ӑ bx$`   @  $` @Z @Z   ,,"` `  $` `"$`@S <   #ؐ#J `"L @ s #L  @ f, L  dmd. `?`@%""&@a L , 4L , J@ 2 #L  bݐ #L  " @W L `2 # Ǽ"  @K #J ` "Д @A 0@%"@&Ǧ J@    @0 @@ 2  @%ِ!@&@  ֘"#ؐ *`#ؐ *`#J`  ぐ@4*`@  㿈'D'H'L'P'  @  0 'y?L    d`''0''@  `d @X  4L @ ` @    d" "?`!T*` € A "P` "`7 @)cn L 3   d"`H" `d `'D`d" @` "@"@ C` @R `d" " 㿘  d `"`"@@ 㿈'D'HD `  J ''` H@  #' '@ 쀢   " H`d @X  :?`.*`!t €쀢  2  L X J#߀`D `  D "`D D`H""  @"#@ @"ccԐ  #آ %  (`@ D 8`L  D`  D` ?"` 쀢  #fD D@G BV .  L  ?'`(D"  3 `H  F  D&`H"`H '@.   L   D ` _ "b V  쀢  `H 2"`H@ @Z  "c㿘   #J `     `   xJ `  !   x@ !  dR`!*` € `d@W   d` 2`@ d㿘# `d Dϒ`44  `d`$ $ $ $ @$`d㿘  d` " `  `@"` @#?`  ` , R@`" 䬐  $` ` R `  @ G @c` 'dT@ !  J#`F(`  "  2    x, @ @ @  @bkb$d`㿘  d  "    ,`R@ `@br`$  v$   2 d" 㿘  d @ @  㿘!  d@`@ d`"`@㿘  !   p@2@]  2 㿘@p / 2@ r  @ɒc@ 㿘 cH9 А H`      0  3 J  ( 2J  㿘  – @  2@ `    @  2@ ``2#XÒ #h #x # # # @#!㿘  D?#,@YO @?,@c 㿘   @Z @2㿘` x`@m* 㿘 @    q$  &@ $$ 㿘#İ . @ " @_   ". ?㿘 .`@ #J  "P`"X"`@ x "+"hب#'ؤ  ,` "`@Z8$?$ؠ @'آ``",` Đ" @ 0⚐" #ؤcĢ !N " `,``"`≐"``"(N ₐ XpcĔ #؄ ` J@  @K@ " *  "`  d*8`㿘 #J  *`6 5 1     &c* * * !* ` @q! @j $#@#@L@x@L@   c*       `pԀc* "x J H H`   -"" 4H@Y, bb p"p4 @YxcĠ J`  ``  ,@`" *  "`,@*`  J#؀`-   @ / ",` J  -2,`  ,` H p@  #شcS7`A2  `o`?`0* `0'? ? ِ8  O.  , R @,#i`s# # `  " #J`@2`R`@  #P@<耊 !`ؑ*  `J`-`+`J  ``-  #J `2* * !ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @%GJ`"В,?bಐ &?ؑ, `2 ȑ*`4$ @d ؐ*@'Δ ؑ*`" ؔ*`2'؁㿐 @4N J`2   <#$&@  㿘 "/X `+ @XA@X>@@" $ @  d `Ƀ@ `?@h㿘   U + M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  c@  `  | )`02 `  2 *  ``?㿘 0   @퀦   ?" ` [ * kπ # 4 Ȑ_`"̰ @̐ €Ű ?    @ "   ? 2 @ "  2  } 2|  @֐@Д "m   ?a 2` @ N  F 2E  @N@ E?B  @# @ 2     ި   @* `?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% #   ) |?? |2  2 ` `@c 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@ "" * " " " 㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@ 2J N :2` `&`L.`#` # 23`:`;;`,@+`?`J O  `&`4&@`;2N/&` :2` `&`.`M :#0` # # #(  ՙ<``   H1 ? `#@* ?`@ &`%&`2$<`@+`?`K    *`  &`   `* @`&`&@&`<`㿘L    *` !2 L L  *`a" L #P*0/L ' #Y%1 `'`$ "` " ?L@W   " *@`" L  `#`㿘  d 'L`R `l @XŒ " @?@X` ` @$@]ْl@X" $  @,   `/-+ @]Ē@ L h@p@`H @@&ڠ   d&`㿘`' @PД  `@L@ "` @P& "$@\@ $,㿘 @S6@P.㿘 @   # ` # @  $$` 㿘 @k   ?  @k  ?  㿘    d$`$@e`   @S `d  d`㿘 @ke ? ? !  @Zx$ @kV 㿘  `   HN@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@S+"@@O@J / /,  $'" w@O̔J / /,  @R "@^@O "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘   ɒ   H@Rq  c # "c`4 S$`4`4@O+   H  d\`㿈@RP `d ' '$ @ ''@  @2*@ /*@`*@`"@㻘?&@b^N /"N Y@Œ / $@@R  N .F 2 N .2 N .  @ (:N@ /@ 3  /&@.@` @" X@N@.@ @Fٔ# 6 .  ` O / @ " 2N K M M M M K M M M M M LX L M M M M K M M L Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt Mt M` Kx Mt Mt Mt Mt Kx Mt Mt Mt Mt Mt Kx Kt Mt Mt M8 Mt Kx Mt Mt Kx J Jd Jd I Jd Jd Jd Jd Jd Jd J, I Jd JL J Jd J Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd Jd J\ Jd Jd Jd JT㿘"!  d0ے` d`0 "$`,$`$@$`(@Cǒ   4`  @hƐ@W  , 0` 2@Z㿘`"`` @h   "`  `0`0``` cxؼ    !  dy`&  d & !  d0o` 0& b d`  & ,& & & & & & & & & (`&& $}㿘`"`` @hI   "`  `0`0``` cg     c (6 cX  & & & & & `& & & ` &&& $1㿘 cؐ 51  d 0` d   &,B B `$ @?& &&&&(&&& &&&$㿘   @_@V &?"$ ,0 , 㿘  @C@V &? ?& & & & 㿘   ` &  @} & * & " ,㿘  @"$ ,0 , 㿘! 2 0? 6cח h  $"  ?@  *@ &  ;    @Jݖ  & & @ @ 㿘!   6`b h  $" r?@ `j * &a ` d@$@2Z?  ,*`   &  " "@      @  + & & & & <& @5  "@ $%  @t 6$   (&& $@ &  @W @& @ 4 `  * && &     & &  &㿘!2I  6` ې @h  $ " @ ^ ?2,?  && !      &  2  "  4 6   & $ h&& &  & 㿘    "`W?h  $" O?@  ?2D?@*2&  6   `" :  2  8   : 2  (   "@& &  & & * & @I 6   `(&& $? 㿘`8/ ``P (` 4@JҔ @"&& &@`@ '?@ @$@( ?㿘`h `4 `0 ?(  @!,@@Jy " $  4@J{&@ @"&& Ң@,@㿘2 `կ   Ð? ?  $ @`$ 㿘@2@`Ց @('?"7?``@` 2.? ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` 㿐@?`J ?">?@ "*`` /`; @( `$" *?6`   `@ "` (&`$&@` @x  퀢 0 2 ` ?" ?``?&`*@`&`㿘 " ?@L@㿘` `6`  `@@`4 @I$@@"&&`9^ ?23?@ #`@9T&@ &@%  @ 6$`  (&&$&? 4 ` @IP@"&&㿘'L'P'T'X@6Lh'P'T 'X` a yȒ4 P@hȖ'H'L'P'T'X  B H@P `  @, `:  %"N@ `2 `& * & ``   U`* : `L#͐ ԓ*` €CA?"<@;N@7 261N@ -+ )  *` &,@: , ?Ѐ`  ,@.,* :`@  ?Ѐ` "N@`  & , 8 ۦ ۑ* : `S̐#*` € Ϧ * : ``\̐#0*` €   ,` @J" 0,@@T^ 2 =` u> -9 +42 /`   04  ,@# 0""!0!H`   4  ,@  x X,@ 0,@%$@`!`@K4 ` // `d`% @"@@ L@`+ @`-` `0  )?"*3 0  ? 0Ȓ ?&   @*@`& ?` ` @` x 0  ?*`:  `&   @*@`& `?`@  0 '@, `2 < & * & ,    @?  ?L@w &   @*@`&  `?$@@, `2 < ^& * & 4 @, W(?㿘 #! ` `?@}$     "` $   "`  ` ` ` ` @ $``@ 㿘@  * # % @   @ 2   @J  @C $ ` $` |ܐ |$ސ $`㿘ϐ "# % Ȑ  !@P   @ ` $`޷ $!瀤! $`㿘  ) +  ``% ޜ %`  ` @c `瀦 0`* &! ; &   @ؖ 2 2  @Ȗ  @ $ % 㿘  `  $ R ! "` #   a# % ``$  ! `` `?@, `` & J`   & X #@ `仐!p"@"X& 㿘    @ "0  "`@ 㿐@Y  @ @U P!  d `  d @` @''' d @` @'''ز   `  %`ѐ ,  "`aaa tЀa!a `{ a`( d  , d oa  00"  aaa d %`̀a d %`` d ` d`0 @|%` c #$ T耠 ` " `@:  a`$` ਐ %`m%਀a"a`(c!0ja!,% צ%`ؐ" :  " :  2  @X# "4" :   N #  ``@   d$< , b, @'''``" '  d$< , K, @'''``" ' dT`" : ؐ" :   ؐ" :  " )@p  %` %`  (є )٤ {̔ }Ԥ@Đ  c$%`  d$< , , @''' d`@ ,!"@`'!   d$< , , @'''  `"@`'@  ۔L༘!a'%`'''''ѐ!" @m @X! ``@    da !!!  `#$@;@A@$0$@2a   @? @$ $@6 !!   `$@! @$@@#  @$$!  @,!  @   @s    @i    ! `` @~!$,␐!% , dC` $ % d,!$ T  ; d  d$< , , @'''"@`' d"@ $  d$< , , @'''"@`' d"@  $` d`㿘 `   "`ۏ  "`! {! }@  ֐ _ 㿘 Y!@h ǐ  & @ @& 㿘 `    & \ , "`!!  &   @֐ @=  & &  㿘 `    $3   "`! {!  }@     @`2$`&  $ $਀ 㿈!  d @,` @'''@   `  $`   "`( $`% !’  d$< , , @'''`" '`` $` % |ݐ! $` d$< , , @'''"@`'d"@ݒ &  ~ ) `` & $`ړ % 0 !j 㿘@ @L #    *aaȀ=aJ 2 @[  #`& 6 `&  {>   "``d ` ]2` /& @@ `d& `t  `d"`n   ` :"  @* `* `* `"`dV`  "`  "@ "  `d` ?2`㿈!  d @@` @''' `    $`   "`;: 8$`%   d$< , (, @'''`"@`'` $`ؐ $਀߀ ;@W " :   d `  ,  d ,   '''"@`' d"@ 㿘@" " " 㿘  c̐ @ !䀢`! T` "`@@ѐ@k" `"T`" `@ 2T`㿐  #   "`   " `"`䀢` " #   ` @䀢 @ "@R` 2`@  //ؐ #߷ " " " "   㿘  d 5`22 " " " " " " 㿘   cX "#"X"#   㿘 J#퀢`* :   a)   c@ "  e r`@  r t`@  t2 @`   2 8   "  "  㿘  ` $ ` @ Aؙ  "`     J# @ ``H`D `A ``9L`7(3) (`  `` `  ` h  d @̒`     `  ```X@}`? .`,$ 2 `  dD.` @``@`*`` `d$< , [`, "``"`@"``@" "@㿘  `  $  @ "`  !"$ $  @`* ` `d$< , ' , "` " @"`  ``" "1  H 㿘` &  ` @ " !" ?#` .`  "`DJ@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` V  @*``@$.`6 @G' 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 @ב*`㿘T  ?%  * @ @N N@@2   @p 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@@ /2T* `2L`T TX*`T@B6  $@$`$`$`$`@>`4$"R`"`"      㿘 @`㿘 T` d `͑* T``  "@ 2`T` &"@: ܐ(묒, &㿘!  xϘ!`    2 *"J 2"@` `#` x  T` t#!a 4"`#"`"` ` @$ T$ t$!$ 4$" $@ @ @ ` @! @ܔ 㿘  x!ݔ"!Ԑ!`D@ϔ )㿘%  d  @?   $d"`0$@?$㿐  `* @ D A 4@ 1 *  x;  x %  /`@G ,@A8 # @W  2 @6  @ @A#  @Ք  2  @  ΰ  㿘  x. @ "  ` " (`@ " 0b"  2 " $ "`0`"$`@$`㿘  0`@4"@ x  "  @    x  " " H2 @  㿘 d   cq"dn "d " ( @ " 0" " $  x      "  2@ 㿘  & 2L " @ ""9 ) ""3  " !  & ~&  a! "1$"  ! Pc &  & 㿘 " ( "`0  " $`x  $  "   J@ 㿘  x  2 ` 0 @i< 㿘 ! #̒#W & a` & N@ !    "@& 2 !  J#` π&   &  &  @( 㿘 " `    @   `  @    @  㿘  " @ 㿈< ";      `@R 耢 `` & &      J#` @ "&  & !  '& ''@QҔ  㿘  2  ` x  ` π` & ` `  0 `  &  &  0   ( H H 4   X h  H p |  , D \ h t    T l l | | $ $ < X x  , , D D \ t |㿘 ?* : `lߐ!*` €   #@`(  2 0@   K#@`(  2@ @  P@`3  X `@{ *:` ` h p x @i @b @[  @ # , @`@N  , `2 Ȕ @>V 2   @4 ` %)@)   #@`(  2@ @  ؐ@ `'-`+)@` "`   )  |@  2 `@```` @֒`! @ΐ (@Ȓ`    @ @` `R@ ߀` @ 0@`'!@*: aH `!P!X @`@ h`@  p`@x@{'   V  !!  @d  @\ @U `6@   @@0`@ 2@ @  '@   `    > R @'Ḥ @ 2@ 㿘 `       4`  @ @ `  @ `0r?`.ߐ!X*` €` "؀`@"  `@ϒ @Ȓ 2  @(0  !" (@㿘 `    ^ $g  @c0 2   ^ $YV ?0S㿘 %N  , p@€NҰ NN`   " ` $ \1N) $& (N`&* : N  ) $ ( (N` * : N  ) )  + " ( " $N`{  {N  sN  NN }   }NҰ  ( | )˒~N㿘'P'T'X@P h'P'T'X   B @P `N% Nŀ`:~ߐ!*` €zL s *`:  L  iN(bdd 2 `2 ߒ `? -,L K *`Z:  L  AN9! ;  ;C @+ ;`  4?  $N *?  NA  Nr㿘 i | 4 4V  @^$$ ` $  $ ? {$  " $@@@$@  `$@  $   $ ? {ޒ$  " $@@$@  `$@ " @Ȓ$ $  $ $ $㿘@  "{@7㿘 #N + * b@€N  N N  N`  ?N  N?@? ` 2Nՠ?N?b¯ NhȠ   e B#N  * b@€꿐[NA N< $ (*  : 3N`? )* $' ( (*  : N` )' ) $N`{  { N  N  NN }   }N  ( | )N㿘  & ?z  `- z $@$`$ `$ ` $ `$ ` "` %$ ` "`$ ` "@$  ب - &㿘 7  " z  " zڒ   zҒ  " zʒ   z’ " @  ϒ ̒z㿘  " z " z  "zz  㿘@6;㿘@2] 㿘   @@s?$% "8$ @,C   `!"H@$/ `@5    @5   bp 00 @Q)  $ `!@"   >   `!@" @@(?$ b @@㿘!  @@?$   P p  T 4 x  @ d t h  @ ` 㿘!  d Py`y$`  d` "$`$` $```$`` $`D$`H` d`$`L"`㿘  d```L"`T`?,` `@!"?@`@ @m ?@$ ?<`  `(" t`, t" `0" `4" `8" `<" `@" y/dyb`㿘  c̐!b "`  @>ؐa"`@`" 㿐&@@В @0L@ [,@I ' &@3 `d݀`ے `dy``d$@s #(& 0`dy`㿐!  d`L@ ` *` h d " d P  " $ $ ,  $ @ + `+ ` @+` + * :`  ?Ѐ@4 +`@- $[$"L``U߀` "!*` € #E$ d @$  ":$ 7$  =ݍ$1$ - =@j*   0L 2`@M`@$ !$㿐!  d J   *`   d $" $ ;$ Ҕ`#    L   " L" @ $""$ $  @`@$ !$㿘! @  T H M  h  `  & `" ?.@5e ?.@? `  #?. @#m ?` . @; ?.@ 0 0? -.0@@㿐@?2 ! C㿘$`"`Ȕ P M  - H"7 " @ @6p @@ `  } wj &  ?` &@@ʐ @m ۜ &   &_ 2   !&@' 㿘"2&   d """`"`   "`  !&@㿘! @ L `"P?" &@J @2L@  HL@   :` " #` - #- & # $4+?   *@`    ? ??ɠ?  6? @?@ ?L@ ΢`2 &@㿐2 b  & v  `& & "!&@㿐@50@ "$  d `vW0@V @0@  "#( "  `2"@ #@ @ @@  @`* @!!#\"  H֐* "# @ ` `@ `2`@ N@N@ 0"` 賘 `@1@N . "  c `"*@ `*J 2 0@N  "  c ` H*@ `*J 2 㿘    @4ܐ@4ِ &u@& @1 =,  $& @1  u㿘@P " L [ =@ɐ  @  6    * @` &  L =   d$@   J#``@g a(@a a0@[ h!8h6` `^ .@ @S$ 2 Ȁ   du?`@y  p   b@ b2   bb "        ?$"2` ?$$ `* $ p$ p@2$ " S  `"  ? " t $  ?$`"  tϐ  2 o H"" &  4&   b    `    H㿘 " t @` `"&  ` t t `& `! @ a&!@㿘  `* `  N* `2 ` [@i 2J1 (*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈!  d!sȒ`!''' d PT? H? ?  ; ʤL  3 " L@ ?"@ L "   y&$ d$< , s, @''' " ' 6L2T d$< , sw, @'''"@`'d"@ sg㿘@Jp㿘! f!Ӑ  @ 2`㿘! !T 5㿘ݐ ?`9"d*` € ~`,&@|  a" $ >@J.&?*  l >& >&x  cT  >& !&8 ?`"*` €# b ! s#J#$b- 0Ӓ L " h ~I&}'e   0# `  rޒc$`ӐL /z@B  u@  p<  j  ce$` ~&3X#`Q,!  G$ l D$ lЮ՞ ~&Р  ~&@I!(& ~@&א$ "!" `&  "" ~& cT " ?" a&㿘 ?`/"*` €! " 1 rI# c֏#$"r 0!H   "`h1   r2c & @ 0h 0Ð 㿘 @`$2$   &     @0qԐ !@恐` ~$@$`$`$`$`$$`J@ `]"?["J  ][["  㿘 [@q   d"@㿘$` \         8 < < <   ʤ ʼ ʔ , H H H H H $ H X H H H H H H @ H H  H H H H H H H H H H H H H @ $ H X H ֨ H H H H H H H H H H H H H H ք  δ H  H H \ H H H H H H L H H L H H , H H , H H L H l H 4 4 H H H H Ҵ $ X H H H м H ӌ  H 0 x H X 4 H H H H l ݨ ݠ  l 4 l 4 l ݨ ް㿘d8$@@͐ Z# a  ` $a `$a@+5 !쀢( "0 @  @2 @4 @  ; b  @   !` a@v ?@& a   ! ?! @! @78!  .! "  㿘 !쀢` Т#ԓ*` €! !؀+  $a ^@_ "a ?a a @M$a쀢  ! ! @ "a쀠@ @ a쀦    ?π #!X"\?В "\$a !(*  #!X@ $a@z ! /"` "`!! @ * а?@  a쀢 k @a! !!T"` "`@.@  0!p   !`@ @ @ a*@ "@  C$a "c  `  \*` * ?3"\ X !(* `L"X ?π "`?В "`$a !X (* J(` f#!X!p  1 $a "c  `  `*` * ?"`! !\ !`$!\!`@7 $!\ !X (* J(` 7#!X!p   @`$a$a쀦  $aX !(* ` "X$a쀦   @ !   J!`  @X$aa0 *@ @z! $ab0b0 2 ᜀ a0 @  @" a "@"" @  0@$a@  a쀦2  ! "a "" ?  ! '  !0 "#  ?  `2   "!0?c ?  `" ?  !0@ @ᄠ? "@" $  @ " ᜀ' @ ۰ 0!0"* '  J#`ᄘ M  - * ᄒ`"  *@ "  ᄘ ^  @* ᄒ`"  *@ "   * `" ᄐ  @ }"c a쀢     W 0X  0Ua\$a @a( "   ?5 0G? ? 0B!؀` "! @ S@ 9  !\$a쀢 ! $!# !@la " ߀   0%!؀`La`s`c`C @b   @ Q@[! @ J@ #   @   @ @$a 㿘 "!?# a         #!"a#a#" @ -$a@Βp    .       㿘 "0 "0 2< !؀`   !a` @  0! ?#!"` &` ?"  * !``  ?"` `?#   #`@4y#`  2! !  "a" @4h !` `" "` "`$  !`@h !   "  @4M!  "@ᘐ" " "ᘐ# "!~" a   "! C .  €o  `"   " ! "  a  *" J! s c C  a?@XI@  E  a@  ?  J#`!  @  5 ! !  ?@ +? !* # aؒ`"  ` "  @3Ԑ!`  "` !*@aؐ  "!` ` "`  "  㿘  %@p  @@" @p  @ @ o ! 2"  2@ !`2@! !# a"@` @3!   a!# # #a@3x @?* : `y p*` €@n  `!  , # cH:角N` $?  ! JN`@ @Ԓ J @+  ``""@  #̐ k @'Ҕ`,@`  @@'Ȕl,@ ,@ $" 9"   ! a   "!܀`"  #  ("! !   "!"a @  ! ` "`"b @$  a @x" "N@N``c b @   !;` p ` `@  &?N@ c' N` w W ! " @  ` ᄖ ?  `2?     N` %  N@ c@@N@ y@" N@ c    a !  ""a܀   % # a@Ĕ ᄰ? a` "? #` !   ""aܠ % # a@  ? 4   !` ?"` a o?  ! a    ""! ! @! @!` D?B"`  !`   # `""! ?!@  "!'$! !    "!"a#! !   "!"b @$  a " "! !# a@Z@ !$a$!! !# a@M"@ !$a"$! ! ` !   ""aN` `@    *  !     #!"" ! `j   !  "!܀@ "#@  @& "! ! R  !耢` * c  ᄐ #  c   " ?"ᄀ   "" ː ᄰ @)6 $ ! !    !  @"耢"aܰ  @!`@Ӓe ! !   !   "耣"aܰ  @#!`@"!`"H"`  !"!A"# a耢 ! @! ! "!3$a  !܀@  ?" "!N@ "     ?N@`?`N% `?'  @ᰠ   ?@@ 0"!$$? & ? G "J# J   `2 "* ?& "#J  ` 2J J   `2 " ?2J Z '    ##  L '    #  "#  `2     "  J 2 ᄐ   䀣#ܐ " "#JJ   ` `P @ 2 ?@  ?   ` ?#` Z"a ! ` Q) "#    ' % a  #  $a#  " a$a#H*  (a` `??"`a# ! !  *!("  a@ڒ   J# J#`"?@  @  !؀`  !` @" 㿘@?* :  `t  "X*` € !`?@ߐ  !`?@   a   ?@   a   ԰?@ː  !` &ɰ 0N@ " N` "!   f F` ` a  N@ , `?a @  2 0'  `?`   '   `@ 6? `  4{ 0y  a   p?@ l  a   b?@ ^ ' ` ?V "`  2 0L ! ` 4 2C?0A !` < : !` ` `@_J@  $  ` ᄰ ` ??  @GJ@`"`耤``4 0?㿘 ?! % # !ؐ` a@`? ? ? !` ?"`$!ذ 㿘&@ ` "! ! !@@. ["  { ( ) 0"  } ]  0   0 ???㿘# a! "( @.Wa ` ,"(㿘  b(! b( "@.D" 㿘! #̤f f$`$`@۠ $` $`$@㿘`` @{ ` & `& @@&㿘! # ff㿐 !  Dp " "`` #!"""`#` p"`" "` ~{ D  l"@ ?!    ""#"@  $!#@ #@ $!"b$ "" "``l?@# `l# ! #b f&"$bbf"$"bb@/` " @/\  `l "@     +b "$ #"(㿘@ 㿘`2  !@@6(? @4" !  &?@"  @-|` "`  @-p `"`㿘! ! " @-_!&@ " "  #" ?  2 ?,? H 򀢠" ??㿘3 a X??U "  @.`@@ !`(@"-!` 6)! (@""!` & !!!@2! 6 ! @(@"@!`` & ` ??2 @㿘3 a NK " ? <`2? 2`@(?!,& `(2? , @(2  c@2  ?,  @("@  2?㿘5  NK " ? 9  2 / (`  6!?`(2 ?  c2? 6 ?.`@@?2ð 㿘3 a '??$ "`@` & `#` & ` ??2@ `0??, " `` 2` "` 2`! , ` "``??2ے 㿘5  -* " `2 #`  6 ?`" ?2 㿘` !䀦@40?@'  ("!'` bH^ ?% @#>$  "   @+P "`"!㿘`"E? a?@"=?"`N ^    `   "(@ !?ϰ 0?ː3 a@"a$  " a @+a"`㿘 " b*@  @, z z @"  "   "a* 㿘  "$""$@ # @2b $ * +  @rb$$b㿘       !  @O ! `  "   㿘 !`      /  $@2  : a @" a `  $@2  : $!! @  2`@:`$@ !"㿘 `@k@ 㿘 ! b     / ) c7  `a #؄ M - ^  @` `   ,b `@, `2,(`b N`  b ,b `@ , ` `b @ `  2 ,, `@ `@, `   b @@?b @ a a   @ @6   , `@   , LN@@ !@3yL! %! ``a`  +` <  >N    @ yf!.  %!!@㿘 ! + "@yM @  ".$aN@yA`! @$!#$a$ay3 a?@&a$a "" @  $aN@y`! @$!$a㿀  ) !   !d!d  a %!d\$ !d " %!d !    #\#`|՚ @b?0A٢   %!d""`5 / + -  3 @   P b 2?@,`@@ ِ~I `?!d  " ``"`a %%&&a 㿀 ) !   !h  @  $  !h!   !h!h  a  %!h$ `%!h`   !    #`#\|O `@ܰ?0G@@԰?y|ݐ 0s ',`@ | @+9 7 / 5 -  . @|Ԓ @2   ,`@+9 7 / 5 - @ 2 @|w+   "`?9 7 / 5 - a%!h`a"} 2쀤`   " J?`/   P~ |p &&'!%3 㿀   #\#` {  y+ |Q 0@<?    H     ` 㿘 J#`  w"h   w ^ @w㿘  D "  " 㿘@w w|㿘! !  ! ``c$!$`$`㿘@㿐!"p@hڐ b@(   % @~@"p?* & @ @p@N@ #@ .!% "@ `,`@_,`N@* ?Р @# N`N@ @ .N@ .4`.@`N@}x@`!% " `2N@@6N@@(?Ц@#u `N@ @N@ @! "#@ ``@N@ @`''  @qג     㿘! #bx@!x@%Đ 㿘@O 㿘@8# ! %+ - / i  $"$b̐ $b$"@@ ? fb* & @ @@V . @%?@t   <   $`@q`@Z@@%y@?#(?@b@ @ @M / /-`?< @ /@u 2L ?`? ` L /"?* L /2? @` #@@  @&r@  2  Ȳ@%#8 @ А" "̀`{@. u "Ԁ` @.    #!xb@Д2` "Ѐ`+@.Ғ  &@sk 2" @f(@}Ւ @~  #O1ax) "# @#\` `/ # ``? "`@   $Ȣ `  #  ? $ @Ր  $Ȁ` 2 `y`Y2e @  ]  `#@>S @<   @.k  #@S> @-  @ဒԀ @C#0. @2 @<   @B   @@f #P@ 0@<  @ @㿈 @,   "&@! 6  "@В@$= @fO "   ?Ò* @Ő bĦ ) @ @$Ā  %"@  "@0+ @rbȐ@oĠ ""@@f  #`@@#@#Y @#!  ,  $ #p@y 3 6 "̀`2#@l@p #@cD@.$   -D #@R ''''@b耢 #@C@# " @eƐ  #`@0 㿐'D@,E'H 2!#DHc @dp"@@MP @e ?  @ cH  @c? : 05c@, 2!  `D’ch @d>"@@M @eR ?  @ڒ``  @ђ``  :  0``@İ 㿘#! #!xa’`p@ڐa@Ւ`@" 㿘@   p                       ,  ؝㿘@  2"  @^ "㿘@   @ &  @L  &㿘 @ @2   '"@% J-`?` J  " +  (*J?Ї8 `2 "@ 㿐  ɒ 2  @T $$ 㿘 @$   @   @ & &㿘 2  `?J@   Ɛ "   㿘 b    8"b ."bL`*L   =° @ " #""L  `<"  `>`!  0  0  "b  "b  "b2   "b"㿘’`@n 㿘! "    " @"  0h b M+) VT`@@ "  @*!`@*  @? Ȁ ؀  *@ "     ΐ̐@KE 㿘 "/;    ’`@ސ 2` @$`& ` ’a@А @ & @ &  Ҁ Ѐ 㿘 "     ’`@  ` `" & a ဤ 㿐Ң  b sА T -O (?` X!*` € -@@J H @D B  /@1 3 ig?` -!*` €  @l $! 0 @l82  @l2   @l 4 0  @l`? @l@ Ð      㿘w b G m( #   b 㿘 b   b 㿘’`@bƐ ` ""  "`"@: `@b! 0`@b!(А@ "㿘@h    `N" |0 |@’@@ r`M`?䀤=  & в?'Ȑ ̖ @ њ ’aH@s ` @'̠ ’a`@W  @"̐ 0''Ȑ  @  ’a@S @  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @Ɩ Oـ  #! `Oؔ?"`` ! *  #! @ !@aޒ`@ ` # `?"`  * " @  㿘 #’a@1!x@[ 㿘@㾘 #' ) @6@ aЀ? sⰓ* & @ @'@`" @W@ ’a@ @ɒ! ’a@  !@ . 2*!@ax@ 㿘! #b@ߐ!x@  h¤"X @  )  Ȁ @Ӕ  2@N @K!@O >Ԓ?@@mw!, @j!,!,O@㹠@mO  `m#@| < @ @ `0#$@m[/@ِ ˜ $@ @̐? @@פ@Ő? a ,@`:#@sP @     ``@?,@ } `#@,3 #@%, e`e@  `#@@ @. :`@ z` `Ð @.    *` J@   㿘@w*`a@ ??@ @ @  $ @L 㿐&   "`? `ä h@ / @  `@;  ab#\Ôp$@Z# @ & ?$`?  "Ô@<$# @ Ґ& ?$㿈   ?'  @ ?㿈îÒ`@ ت ~ c@- @z # 2,L@ Sä  @  JÒ`@o  # @  L 0Òa@PƔ ` a   @ `Ò!Ö! @ߐ @u â a(@$ a(@Ӕ @? J *@ 쀥 @@㻘@Uc  ?"8a0Ð!@@5  .`2`@i     `ÒaHؐ @@.4 J  `Fa`@,@m  Òaxؖ@f 0-;ä9  ?- +Ð@ @a ,@f$#0'  `@F0@p ߠ @m&Ð!ؒ @ "@ h Ȓ @kN@kJ @kF!@@k2!,!, @@ @㿈   ?'  @g ? x@-""耢 @"0 2L'b8 /+@"P @ؐ"` L@ @w !# Òbhp@gV$Òbp@$ $*@$$O J@  :2`*@`J@  "` :"`  $ܒ`J@ 瀢 $L  / @V .?'t@V]t t t@Ӕ$@lP : ?L 2,? t  t%b耢 ?@? ?㿐 b@Yڒ ?㿘 b :@U@ 㿈  b///@Xؔ찒  @c@@ @&@  *p (P (P (P (P (P ) (P (P ) (P (P (P ) ( (P (P (P (P (P (P (P (P (P (P )p (P (P (P * (P * (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P (P ( (P (P (P (P *` (P (P (P (P ( (P (P (P *X㿘 " 1" *#0N% Nۀ`M  "*` €``,`` ! `c  #0ސ@ d 0,@ d c0Р @  0,#0Ɛ@  0, "][N@ N S@Q N @``` "    t` #0+ )' @   `p`""0t@z``  #0:1, `` #0:v1,@9 * @  `` ?$@* $@Ne 0@ΐ$@`>8U1Ð@S㿘 d  "#@ ` ,  N,  @ *  ` ?Б, N`.*  c ` *?Б: @" N   `2 N *2 N@ *` ƀ: N   `x* 2  * !*: *`2`:`@: @ 1 N zƀ? N z 2@ : :*:   㿘    b`  ?   b`  8 `R  $D`  $$` $:  @  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  Ð"3@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .        b`㿐?  @  ?@ `㿐?# ð Z # B#7ąB' B'@    @o @> . 6`  `6 @3 @Å?# Å$%#7ąB' B'@@ f #  D'…B'@@ F #ddÁ#dd`ȁ B BЉBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @N  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  Ð#ؓ4@   "  d`]664,@ ,    "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d ,6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@㿘 `R  $D`  $$` $:  @,  @ @ $@D@`@ @  $@$@@`@ $@:`  $D`  $$` $:u @?n #@a@? ?#@  Đ ؓ3@   2 "  S Q 664+@,   @ "@ B@ `@  "@ "@ @ ` "@ :. >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         @    㿈 2  ''   @P ?`@#찒   @> ? !  @7$  ?@,@/  "` " $ 㿘'L'P'T'X@JL㻐/ D57 #@$ @ː#@  a@ fĠ!@D%D - J # @ $  @ $ @耢    @ $ !Đ"$  @m à@Д J `#@D$`@S @ J `@ $` "@8D %DJ #" @+ $`@& $` @! w$` $`$` @ +@{ gJ c`a#@\$` @ @b NJ J`H@F$`` @C$!Đ"@ !" @m *Ġ"(@f #@` @Z "%` b@ @^  Ġ"@E %`  @~ O 㿘 #@`@:    1  #D㿘@* " ! @ #D #D 㿘@  !  @  #D 8! #@ "@M 0#"0@cQ  ̀@<    O "`@b@ $#@  `@ 㿘! #@ @ $#@pĐ"HĔPb0   ''''''@"@ ''ĒbX '' @| 㿘 @`   2H( HJ  " H?" J  H  2*? " 2HJ% b@$| b@㿈`"  `` @'''` @  &㿐'D D@>ݔ 㿐'D D@>є 㿘'D@D$ b@$/ b@$ b@$̈́ b@㿀'@ ?''@耢 @ѐ&Ц@ ( Q #@!    #Ēc@앐!x@H ` "`& & & & & $H$ $  $ @$ H0P' '''''@!@ - 4@b`€ $$ @J $ @ v &  &@& 0 #Đ!x@Lc @!?  @h/@h @    x   @ #@`㿘` $  !㿀@( $` @ʩ`   @$ @ɠ   & &   & '@ɓ$ & &  & @\ `$`@2`8  $`''``@s  @  @  ''  €@ ~ "  @$`$`@&$ '@ n``@㿘 $@   @@ $  @@㿀 $`!@' @%  @  2 @#8 @$a  `@㿘  ! "J`#  "" *@$"J@ -"J`# `$"J``- "Ē#"$"m?" J  $":"` @5 2J `-"X?J`  b "b "`K ?N :G! #!x2c : " "`|J8` b 2"b"J@  " |$  "` ""Đ#$"N`:  :"` ! #`!xc@  ?*`@ "`|Đ#`$""`$; b@ (㿘# $` @g ?`  ?  @PT ?$: b@ OT O Ox O O O O O Od O O O OT㿘@`@ @"` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  "4,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘    @ #h  @     @ :, @ #x .",   @ ` :  , ,  , @ 뀤,#h$ b@$i b@$S b@㿘!  @xɢ @% ؠ  @x  @ 2 ؀ @x S T T T T T T Sl ST S S$ S S S< T T T T T T T T T T T T T T T T T T S̀``  " `2+` `  `  `  +`\ @ +G` E*` \+  nq+ \+  rk+ \+  be+ \+  a_+ \+  vY+ \+  tS+ \+  fM+ \+  sG+ \+ Є 0+> + 9+ ` @ ` \+0  00+ 0+ ` 0"+` \+  M+  " `   ^+`  ? +`@+ -+ +  +㿘@N@:`H@*``2`"*㿐@?*L   "# `  *      2`*: .  \  @2`*.?  ``*N@:`"@ @@*  : 2.(&@*`"&`N@:`Ր@"*`&㿘 N@`N@8N@N@ "*㿘'L'P'T'X@L㿘a #!xĒc@J`@Đ@@c@j㿘@ >@  $>>2 㿐  ?  @( ?? $' b@$  b@$ b@㾐'LL'D 1    "`, Ő     &   !'x''@ X@ h@ @| H@x 8@t (@p  @k  @f %@   ?????'Ԑ ?'ꀢ  /Ȑ @  ???''????'???'Ȁ` L@DD@]/L ?"  / "# `  `H* / "*`@ `/, @Zv O` ` Ԁ,Ԁ  Ő`@\ @F , @S x @֐ X @Ґ h @ΐ H @ʐ  @Ɛ 8 @ ( @  @  @ @K`, "& @Y`,@v`,`" `4& ` &  㿘 c ޖ  ,h`''' ''''' '$'(''Ȁ` ``    `` `@ "`?㿘 "1 N 1  0 `@ې?J? / J /" J / @1  0Œ`@t$0@" J /2"  1  0@d0  ?"` $# b@% b@㿈 ! !  #d  #\#`@ 㿐 "#   `2   @7 J: `@ `2.@".@ .@``ݠ 㿘  0ƒ  P````#\` #d@#`@l@/Ő @J` R\?@y߰ @o0V@lS  J?` '< @ؐ , Ŕ, a@$ @Q̀ '̒a@Ā Ȓ@ @y@  @  @ @  "`?㺀@ŐŐ @` Q[?@yu @0U@R  J?` '; @n , Ŕ, a@P$ @쀢 &a@'䀢 @$ @y9@  @_ @9 @ܴ  "`?㿘ْ ( N  2!  "#@ ` " N  `2 N Œa(@Jn@   "`?$ b@$OpenBSD: sigsuspend.S,v 1.3 1999/01/22 06:07:56 marc Exp $ o b@$t b@$OpenBSD: sigsetjmp.S,v 1.3 2002/08/05 15:29:28 art Exp $`" (0= (`0$OpenBSD: _setjmp.S,v 1.4 2002/08/05 15:29:28 art Exp $" " " @" `&"`@=6 0`$OpenBSD: setjmp.S,v 1.3 2002/08/05 15:29:28 art Exp $  0 " 5H P """  """㿠   @" &  g @㿘Œa0 @Y 㼘 ?  c'Lت  ` $  `%  7 @ `8H$H" . !/@ *`  @ *   ` 2@Ɩ &s @N "n %@<  @'`    ٤"@ @Nِ HL %  8<`8 @" 4&88 @ &8/J@ @ .   N . 0  b`  @ǣ@b ے @8"` 8`  "`  "` p !X` @ ?ؐ@ # @ O؀  Œa@@j   { /-+)L f"e4i` b2f``2c`   *2#"0  $@廔H0$@崔`0$@孔ax0 #\$!@@w@ )  @@ @w` ː@w  "& 2   22 & @l  ``4 L  f 㻈 !X` @m?@kM # @N O耢  Œa@@̔   9 L f'4+ b2($@ƹ@v@   @@ @v c@v  0@*  4 L ΀ f 㿘 ` @:@Y  `  ` @<㿘!  @! @   @4  @ 2  @㿘!  Ő!@a$ @ `"`㿘!  " @$  " 㿐 `   Ő!@a $@5 y J?` 2'#!  @, L@ #@ # 2, " @?  * Ŧ @aȠ , L% L "  " @ӒȢ ,@`@7  " ""`  "'$L " *`:    $@ , @Ƞ " $,  "$L  $ 㿈N 0   N x X2  N $ "#  @ I, ?:` D , :  *??  N + :  . @  $@`  "# ` 2$@?$@`$@:   **   x" '" "  6؀ ?  '$ b@㿐 @?.@ .  ?#@.   ?#. ` '@  $Z b@㿘 !`   @JV  $a !` % @JJ $a8 $!5 a* @*`@*`@!*` ' "a@ta * @*`@*`@*` @t$! $!@J $a*` *  *  !* @&a$O b@$6 b@㿘@ts . "``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ *㿐`2&@2&'5+L@ 1Ť" @Ā  2  `@u 2  `@ &@  & ڤ   @n=cx 2& 2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ ` z z z { {4 { {㿘 !@4 `   А *`: ?А *`: ? *`: ?ɀ`2    ",  €,@` ,  ,@ ` ,@`@*ᘐ $@*ᘁ    *`  . *@  ` :   *`*@` *@` *  *@!㿘@Ę `@[ @5` @0`  ``` @    㿘@@; , ?@6@ 28 @ؒ @   % @rސ  &@ #Ɛ!x@`H @  @ @ @r@&@㿘 :     @ $OpenBSD: ffs.S,v 1.2 1996/08/19 08:17:58 tholo Exp $| "2 J "2 J   "2 J  J  $< ( b("" c4" p ?" d ? l0 "  -  ? s8" w ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$  b@$ b@㿘`  "`?@q 6`? -&   ,,-`@Y  6 @J 4ݢ2ت`k@: @,` @- @,`  # @   @-  @,`  (5 : @@  6  @,`   @,` ڨ@q $< b@H @4 D% * @,`@@,`@*` ,  &, @& @? (* @,`@@q,`@*` ,  & , @f&  2?* . @U. ?㿐1  X7   5 ;  3   &Ȕ(&`&T""P'`#Ķ  .( > @?*   ⠖P (@ (   (. @?*? (  и  p  .@/@.?$  0  h  .@/@.7$  h ./$ H  , P' ɆP P ,P  , "''@#   # @4("(' @4(@'@(#ײ`` ʐ     لPP   њ PP  ) ! "@  @    ȇ(@'@('$"    " %@Ƞh  @  ``̇(@'@('` 􀤠O   ( .$   P ࠔH ( ( . '   (@&@$ . $(   Ё Ā       2*`0"㿐'L`'P   P' '  І'' 7 P7  P@7 7 .# /  @4. 954 @@  ;@ 4#@  @. @   @ @c@  P  cPP)>' ~!~      6 . ( 0 .`@.  @6  / 00@@ @@/ 6 P?1 "P6` (o  .P. P3 . bP@ `?   P3 3  c 3  +  , 4 * 4  #4c %/ L P  @   @P  㿈  Ѐ`h֐ / / / / / / //''.@.`.`.`.`.`.`.`㿘  Ѐ`2 2  3 bP  T@  ՆP"P6  a" 6  $6  *@ .  a &0`@ * ( 0` a*  0` !,@ ٕ(`"P  ݆  "P . !P   aд! &bP  b""T     < a @3 ޢ@&5 -22 5 -@ !`P@2@ 3 ޒ@   ږPbP@ 3 ߕ*`P @ "P3`3 ߞ  @bP@ ۖP 3 ۲bP@3`  !P  ܖP 3`3 ܔ bP@ @ @"P  ` ݛ+` P P @ @$@ $$$   㿐  Ȗ *        * $ $*  㿐  Ѐ`L   H  #  + @ @ @   $` ?  H (( +  @ @   ,@ ($ b@㿐 #\.`2`@0\'L'D'P@'T  @;!p L ƒa@ǐ!x  .``2 @D@Tģ,` Ɛ!x@a  4`@  DLP@T@KWظƔ4` @  D??@ ??Ș '''@pR ΰ? `! "X@G!D" '@* #''  ax ``0 ?V'`=" ` 5/`` !#\! @ ƒaȐ@! #!xƒaؔ@ @F%`/`!` #\@ ƒaȐ@!Ɛa@`  ` @-` # # !ax@"@ϐ!`@D "   # ! # #Ɛ!x@׽a `#Ơ!x@na@׳`  @) @f?0-@Ր`@J` s`@X`2 ƒb@MS '@!'@ 2 `* @kj  @AƔ @@Ð @M/@ @/ ! ##Ơ!x.b@6 *   +6`& *``+ &%@   @ :   ! ##Ơ!xb@@@.0 #Ɛ!x@(bht @B   #\  @  @ TP ! ##Ơ!x@b@n' '@  #\  @    #@T# #@O!  #Ɛ!x@ҒbF@LL @L@PP @L@T T@L @I  D @# #`!Ƣax@e"@֩O @Iє   @LZ O`   @(z @j0 @@jΐ @(f ?p  ? ???'Ɛb'ܔ@nqԀ ?0@! 0Ԁ   @    2 @ ?㿈  ?  ?//'@ 8  Ɛ"@c `@u @Z @ͽ`2U?  ܀`"N?@\[ H Ɣ$@ؓ@RN@ƒc@p@`2  ##(<  #@T` #`` @#x  Ơ#  " @h?㿈  ?  ?//'@ 㾐@h!? # * ( &# "   J ` `H*   *J   * ŐJ  2 *J      J    "#  J `J    * *J  @ L + -L   @ 56 @ -   @bv& L   @ ?@    @bZ @N @IL@ + -L`  @`0 # ` @b>L`  @ `` @b/ @   ?@`?  ?   @Ғ 2L?h !#\ /ؐ! @ 29    ? ???''ܐb'Ԕ@lԀ  0#@D 0 Ԁ Բش !/  !#\ @w 2  @   2/@$ h  cX#\*cX /! @V 2Q  !#\ ! @I 2D    ?? ??''ؐb''Ԕ@l;Ԁ  0-@X0*Ԁ Բ !/  !#\ @ 2  @W   2/ cX @@ 㻘 \2װ?ƒ# @    @  *`@ İ? @" ?  0`-    ǒ @ `" @@ @@Ȕ ,`ǔ 2"@B@ o@   0: < @ 8 22` 2`*`        ?#@2  2   2     ? ?  HF  2C? .@" 6?@ @A  @@ (@?@G "?  @  0@ ? 㼘 @" (?@e`@@ `@!   ? @ %@.*` 㿘 ? ?  ? ? ǀ  @5 " @' ǐ @Z  ?㿘 cP @@4 cP `cP @ cP @㿐@f   3  `" ` 2`22  @ @&`㿈`Ǻ h@X   #ǐ!x`x@o?@`   @?c 2@?0&   @EZ  @1t ǐ @?0ysQ ǐ K  @ @#O @1W @v @#F @#B @7  "  `# #!Ǣax@Ӡ!@@#. @R`  /@L 2 / J  Ǻ!0 /@I  ǔ8@:w  @Iz  ǖ@#\@:g `! ##Ǡ!x@aH@ٔ@" #@? x؀ N   @'$ ǒa '' @`@$$  ǐ! $:$$ @aA    " "l* 㿘? @ 㿘@ 㾘@ !``  .  /("`,  @#A &!?4@c44@ @:   `0 4@, @?@$?㿈 ''@Dm 㿐N@ ="`@@ѣ "w @|*7@* ,`` i   l `  `X  `l@e0*` *,`$l `"X@d*   ,`l@|$l `l" 'L% L  =2 $@dА  l*`" (?`*`l* : , *`: ,   =2 =,@ *`,   @* ,``  㿐  l*`  "  "@ 㿘  `` ! @;"P@ !  "`N  "` 㿘  ) "H@;w% L !  `@̒  @;k  $L,`  `@ @ @}@;["H @;W"H "㿘 "H@;M@  ""L@;G ` (  *88 " (" x@DŽbؔ  ' #'''''! '@S耢  ?$OpenBSD: Ovfork.S,v 1.2 1996/08/19 08:18:01 tholo Exp $ B b@"` `> @3 2& "! "耢  ` @  2` "`@ `@ 2Ȕ@] 2@ @ϔ㿘 " "  @  2 Ȓ @;1Ȱ"$ b@xȐ"hbp?' '> ''@!y ? "   @!k '? @!f  `lȐ"x䤒@  @N  @J ܐ@8  @!N @= @: ??܁% b@$] b@$ b@ | p d X L @ 4 1.؇(+"("%""""#(#H#`## # #  ɐ 8$7 b@$! b@$R b@8ɠ А   @$ N . N  2ɰ ؒ@Ք$ /@FR @`  @(*`J@ /"*`檐 &i! LL '楒 2#< (@ 2``   >N"`# H! .@@  =ɠ آ$@@>$ "2! N@ / N``?O @@ $  ?"` ɒ`@'@$     !  $     `   "`@b# #  /,&@@@b40Đ "#.@b ##`' .ɒ-@ @C-`d ' " ' '' @"ʠ?! * .* '@b @ ' .- - -@E |`Ւ u /-   @I b @.$?#5 @I  T L` .2 `L` `  ``@*塒 " ' $` `   `c/`@a "&@&@@ 2 `? /, ``$ @@D-f' `'  ' ``@ai`@ad @D $. b@㿘  "`@a' ( `&& & & & & & & & & $`& $@$$@ @ hɬ `@ ^?46 `.  @^ K@r H`D&`6`6&` $@ * 2``6`86`8`&` &`%   צ@@B &"  2 8 $ɐ   &  $ & $  "`@J@`Ȑ@` @`Đ 㿘`(`D&`$ @@D1 / @2`L`  `@@ &`( `0&`&`& 㿘  ` @` T 6 6 @`  " @  @`@`}  $ `       $  `@`g " ?@`a 㿘 $@3 < `4<@ &48`&8* 2   @ * 2``848$ ɐ  G $    48&$: "4:*2  X`"  :$ @ 0 @" : "J  " @$ 4 8ް` *$$@u $  @Ԕ? "" : ` 4 :$ "[$ $2@   $$@ C$S@_T6 2<$   $ $ 〢 2#@H * 2``48$  ɐ  ޭ $    $48: 4: 4< $  J / @  /*@(`@ՒDO$@_o T6?2 @_i " $C $* T62 :$ 22&  $   !    $$ @$$$} 2@? $ $$$   48$ 2`<    㿘`@  E"` $ @>" 8  9 27   "@w@2  $& $ T 6   J`/ $ @& ɐ   @&   2    㿈  $ 'H @Bt   HH Y    % S5 82 $ `  ?`  4 ''쀥 H2'@@z  H 2 :%  :`@B5 :'  ' $ J?`/  $B  / *U 6 `'"'    2 `L` .2 `L` ?` ` `@` "%  `@ '@ `@ː  % @^8@@A 5 8 $ & $$ϰ   "   $  '@ "4 6$  ` $ $ ` ` : 4 :  4 8$ 4 8 6$  쀢" $ `  "  $ $  D $ #4 8 $    ($ @I D D$ @  4 8* 2  *`2  $ &```@E 2` $`@A?耢 @c $   2--􀢠$H 29 U 6   $      @s?  5 8 $@W& $2 H  5 8@]v@@@ 5 8 $ & $  ?="` @8 $``@`:    > 86 > X>> > > > (> 0> 8> @> H> Pf ``@>ђ #!  ` 2 &`$ Q    &`  > X>> > > > > (> 0> 8> @> H> P:  < @ ((&`0 &`, N`D`.6`4N`E  ?`Dc  2`  `2``0"&@`R`6 6`,  @  @    㿘 ( *@\$  2 $   "$ @\$ $   "    @A[  `"`" 㿘`$ H@\x   @`$ ``6 <& & ( M ?& @@咐 D㿘@\}  㿘 a   "& @\k&   ?"`  @\y&  2 &   "& @\Y&     D" "  2 D""  P66㿘   @g8   8 $ ,   %  ? ?`0@ `,@  "` ?*7 *&㿘 #! @z$\ b@㿘@:@Wq㿘q@bm `9 1 *$㿘    $ b@$ b@$ b@㿐 '`v`   ` $  @@ @̐@: <  "  >(` :`@?? D8 >` > >> `` "`@Z`  @Z㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @@?@ kby@@?@ژ 2 8@Ę@? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘   "c#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @R 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘 @ N * @@   + " @ N@" `   `2  `      ,  `        `0 "  @?  `c `@ ```_` c @ `2 _` `c ` ``_{   `{_  {  @2  @ @r`& ` `㿘  0@ N * @  + " @ N@ `   `2  `      ,  `        `0 "  @X?  `c `@ ```_` c @ `2 _` `c ` ``_{   `{_  {  @2 2 @ @s`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@;  7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(``   ` $  @@ @ᩐ@: <    >(` :`@?? D8 >` > >> `` "`@TQ` "`$@TK`$@TH 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @/@(?@ kby@ @?@ 2 8@@ݘ? c3> ?'"`. @ . "@2 &  : +   ; &   + : :&㿘   "c#% .> @8 @"A @!@ @C @!@  @"@" &@D(@"f  , N@: @` ~`* @w@@@ @  `s @2   " @:h N @  "s@ :[ N@ 2W  hQ  @    @ N @  @ @ (:  `24 _"1 @ :. %@@  " @ :" N@ @  2 @ : @ `2 _"  @(   `_` . c`$ .  `-.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   "@ &@ @ @ 2 .` @ @.@ 2 2>, /` " `/` @>, " &  2`# ?#$!" D/  > > /   @ /  "?>&@ ,   :, :[ 2"  :@, ,  &@  ::B "   : 㿘  ,@ 0 ( N` @N  ,@ @n `@J/ " @ N@`@< "   `2        ,  `        `0 "  @# ?    @ `_  @ `2 _   ` _?{    `?{_  ?{  @ L@ @ `@ٶ`@ٱ@Șa& L@  `㿘  4@ 0 ( N` @慒  , @ / " @ N@ `  ` 2 `,`    `, `         `0 "  @i ?   ` `@ ```_`  @ `2 _` ` ` ` `_?{    `?{_  ?{  @& L 2`@ @ `@`@@c㿘>!`+@ @( "v`M) PV~ОDŽ@ d Ş@"x@@n@耠5$@  h"@&("`8@2@ ``2@{ z@u `2u@n 2o@h 4i@b `(`_ ` X@S   @ @. @@O@ H/@(D A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  " @㿘 @? @bT㿘  @bL $" b@$ b@㿘` ` 2 `@Կ   "`?`?` &``@ , :   @ * &@@t$ b@ < \ \ \  \   \ \  \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \  \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \   \  \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ $ p /< /P /P /P 1 1 1 1 1 1 / 0 1 1 1 1 1 1 0 0ܝ(    " @'@M!S 4x * @`*`@M$` $` $`@MАj @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@$ D$ H@ i `?$ @:   "@  @!  @ Q`$ $@ @ @ @ 54 (< DbE$ L$e& & & @n ` "`@ E`㿘   @J @:  J@ | 2@K  @&J@ |!` & "@   "@  " @ 5 "@   " @ ' "@$㿘 @?ܑ* : ` X&C#* € @ @   D`" D D  ,  " @ @J@ )} )  ,  H" @ J`)a&@ɒ ]@   ( "( `, N"`,@y  `( "`( 0 A"0@ =@ 8  `@/ @Z *@& @ @  , &@:` @  " @ @q , :`@ @  @?֐ , :  ? {Ր`  " ` ` &@J , :  +"(  ? *"  , {J"@ "@ "@ "@{"@ "@n "@ "@  @ " "@  @ $@ N@ @J@ ,2`& ` "  !@@@Ԓ @9 @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @  @  @?֐ , :  ? {`   " ` @ 㿘 @ @ &@ *J㿘   @ J@ ^2 `&@$  `( "`( , ", @-  @  ` :J@2J`` & @  `( "`( 0 "0 @* 㿘J@ ``\ & @ @   a&a)xa{`." `[`*`0 a(&0 a}a9a1 ~a?Z0} `@Fy @ t@;p@ l  D`" D D  ,  " @ @ `  J@ \J` ) \K )  ,  H" @t @ ` J@ \ J` )`)&@ %,  H @S `@7@I @    "`H@y @ ~  @"J *  &"@A "@" "@5 "@w p n`$J \j`$J {f`$&@g @ J@ ,` & ` " !@P @! !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘   "# @ ` `. J* ?а  `  ` . ` @ 㿘@    ˒`@  2&   ˒`@  2 (@K  & @: J@ ^2`&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@   s ` ,`?,"` % "@ `@  `"?@* :  @ `@* ` ,`?<@` @7- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @@ɒ  @@ߐ@<0@Z@h 㿘 @ J@ - [    * @ 0*:  : ="40e   &@y J - ]@o @ @ @e  @  `  J@ :J` ]3`@R 0m   &@I J - ]@? @ @ @5  @ ` J@ = J` ]`?&@ 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @ ` * `@   .`㿘    "#  @  &   ` b<"` @  @ 2` @J`2`@ 0!L  @ `@* ` .`L `  `@@ڐ L 㿘 =@L@ ` + `@.`㿘 @ @x   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@F . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2   bؠ" b@@  2`@J`"N``@   @ 0L@ "  H * : (H㿐 &  ]&///+& &㿘 ` `8 "c` ` ː* : ڒ0@y`   `4, "`4㿐 &  ^  ]&////& &㿘     .  `yD *` € $" r&  "@K`Ԕ  "@'  @i" "@  @` $@ 0M "@' "@  "@J"@  @A $@ ` @ܐ 0% "@ "@0@Ő~0@t0@  ""  " " 㿘   "    _ `& 4 @۬   @E,  "`@E,  2  @E` " "  ` "4 ` @E !"`@Eؒ 2  @E` "  "  , `  :`@n` @$ ` " ``%   @ @۔       -   @D:`$   %  * --%% `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@`  @&`@D @D  ` "&` @D&`  0 ?@&` ` ` *? ,8    ` "     ,8   `  "     㿘  '`8? @  Œ `4 &`4,@ @ 2  ʔ 2,@  $ @ $ @㿘  @c@ .` *  @P. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@\* "@    (@> "@㿘   @C.` 2& ܒ 0& 㿘 &`  @C*` &` ː &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@CH  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@C   " @C  " <@C < @B@B$ $$ b@ ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?؝㿐!    77˒ (   @$@C  ` @ @*`@2 @, %ː@ `( ˒`0@ `@,'L`  @ L 2  @ 8@*L@6 ˒`0@ @ `J@ @ υ(85 Oh( @*@  `J@ @ H*@`*@ $a b@$OpenBSD: sigprocmask.S,v 1.3 1999/01/22 06:07:56 marc Exp $@2@  0 b@2"㿀!  *`*    *  *   "  @  @#\ #d#h#`#l@s 㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& 㿘 ~6 (2.?  *@`@  /2*@N ) @i h @4P "%  @2 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@  `- `*` R #@$  㿘@1@㷐  #\#`@  (\`  : /6@ܔ " a "$  /;< 9@(@2 @۔ 2  2  @ /? 62@ `$ @4  2 `3@  /22#\  / 8  6 /  #d#h@#`㻐\`dhe 6' $@G 2  @$ Q?€ J? "F 0DC @ /41 y)" .` ." @4 ` @ ? 6#\#`1 2  2J` @@0@"㿘`@`` *  @?@>Ґ` ` N?@>J&`  `` *`@,&`?$@&`  @ `"@: @@>& @ "@@>?` * $@`&@@` * $@` @   #@ "  ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@>(?`@># & 㻘  @Q$  0˒`p@ $` @2` @!@㻘@5$ ? @2$ߒ€㻘@$ ? @2(@t€    (*@ ` 2  㿐`w ? ? ? @  gc" "" " W W W W W W W W W W W V V W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W`@ 2@A@5 #  # .@-@) :  *  . : .  .  ̒ `% ` 4`4 `4 ` 4 4 4 @  @ `*@ @  @ 4@ 4` 4` 4` 4` 4` xN -   ˒`x#\@@7#˒`#\#`@,#!#\#``@!˒`@  @@e!0aN  ӑ* : `K`T"*` €   0,@  ,@L@  @` + 0˨ "˨ ت#耢 L@ `" 4  @ ,? @,@?@@!㿘`&    @ `   @̹$@ ? /`4 / &/$) b@㿘; "'Dc'H  `-+L  L0 L x XL )0  ) #?)  >P    $ `%E    7 G "T @ 4?@  @  ?1  *&<@  b 41@ @  1?#? &<@ B   c     H  DH"@ ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ``@ 2@@ #  # .@ސ@ڒ :  *  . : .  .  `` % , ,  ,  ,  ,  ,  ,  ,  ,   , , , @, @ `*@ @   @  ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` xN -   ˒a #\@ِ7#˒a0#\#`@Ś#!#\#`aH@!˒a`@ @@e!0aN  ӑ* : `K`V#*` €   0,@  ,@L@  @`!p+ 0˨!x"˨!#耢 L@ `" 4  @ʈ ,? @H,@?@?@!㿘`&    @χ `   @R$@? /`4 / &/ @ 7'''L'P'T@'XXb'''''@ L o pP o o pP o o o o o o o o o o pP pP pP pP pP pP pP pP pP pP pP o pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP pP o n$ n n$ n n m m m m m m m m m m n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n8 n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n8 jT j l` mh op it i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| i| h i| i| i| i| hX i| i| i| i| i| h h h h h h h h h h i| i| i| i| i| i| i| i| i| i| i h i| h i| i| i| i| h` i| i| h i| i| i| i| i| i| i| i| h i| i| h i| i| i| i| i| i| i| i i h h h hh h i| i| hp i| i< h i$ h i| h i| h i| i| hܝ     @ ` "# `  % ?& &   4@Ő 2@ @ `2 @2   @ xe`Y!@,  €  4@ 2B @A` ?& & ޤ@ l2ڤ`פ,* Ѧ?V!  > (" 8 (3"("/ - @@& @# ("   2@w2s"? `VV!     @@< ـ@  ? & &@+ 2ɰ @ `2  8B@Y!,,  €"   @@ & @$`%@$& &@ @і "?/ J #  ?& &   4 @Ґ  "n0 L`  ?& &  a@  4 @ @J@0 L`  ?&  ,@&`@"=,@"?  @ ` ?&  &  4@z " @ ` ?&  ,@& `  4@Z "$@v,@8!H ?Հ`MBX#*` €` ""    l-`R    l-`R `` %   @  ,@ `? &  &@  2 @( @8  x X@,$@,@   x: p2l"8!1 ?Հ`:+X#*` € "   $ !,@ `? &  &@ 2 @(7 @@ʒ@. @ e E@ @@$@,@@Ē 2":"$@ "?0 @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘@~ 2 * $@ʒ% &&@@@@&$@ @8@"@&&㿘 0 @2 4@5_$ $& 0& 4c  @,@< @& ,@5  @@v& 4&& 0 ?㿘?,  d`2` @` 2`0  " ` @5 E?` &` ?6` &``  6` `0  ``4@& @ "@-?&@*` %&`` ` ?߀6` @@ (` 2 `` &`&@``@@ `B &`&`<&`8&`0&`4&@.`B$„ b@$OpenBSD: fork.S,v 1.2 1996/08/19 08:18:06 tholo Exp $  b@"` ˒b  ''@S  @`L!''H'L'P'T'X'\'`l˔'dشШȺ'h'   * ` *J`|`:2 *@  @͔ ˒@Ȕ  @b 2X    @c X $XĒ@ : X $X @?"Ē(@~$(#0H$0@w8L$,@pˢ@$4Ē@  @ aP 4Ē@[?  4˒H@QP?20@,$8ĒP@DT?24@8$<˒X@7?. 4HĒ`@-? `4J˒h@#? 4LĒp@? 4N˒x@X? $PĒ@\? $T˒@`?$Ē@d?˒$ @˒㠔 @˒# @˒ @˒㸐@  ! ` a+ /////@Ĕ?8$|$@|$ @x? x $ Ē@t 2 t@ȓ , , pĒ@?    , Ē@ @2a, `*`:  p  . : ?4@L  L  0h/@p? l`*`$:  4   aW$@36$㿘@  @@`x "&@`@ 2@ "c ` > @^| 8 h X x H 8 h X x H 8 8㿘 1 " " @2 &""" @ ! `@2$" •` "" """ @Ŕ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ 㷀'X'D'H` 'T?X  # b @T ! "@2=$ "b@h"' dȦ`@2.$ }     ... . .. installboot . ..Amisc Bkeymaps (=   @=׍{Y( @@=@@<@`dT U=@@=(((0pLl A=(=(=*QIA=1xˀ=,=, DA=2b=3%=3% 3#WMG)=|e{O `pskH%1~E_~a43*cu7X̲|Zseqն𮫎5V 侵t˾S}CJY)!#_83g8Fk=PeT,3u yC-^OZTR~S8|7؛XiJ\ˉ &rߊ"woj|(e  @ A'$@ #/ "8`+   @ #T@C ` @@2@`@1 D@" @ H"D""  h '`9 .M@  `(;,L \27, , %$@1 $@1ܐ耢   ' ?@*M@@$ 4̨耢  ̶? , L " #"T@ 2ݦ\  @ 2Ԧ ` P` @1`??x  ?L: ,?#\$ ? 耣 Ĭ@1j0" ?2 :,??L %L  : $ " ''L?`: :, '"@ #@%$@1S$&@ '@12耢 l@1*3 @$ @@z@1?̒a = X耣 $H$H"@1 2 @0  ""`@0?0D#@ 㿈@'''`?''  ? J ? ?  &@J `?  JJ|:? ?J:|?  㿘@@㿘1 " " @&"   """b" 㷈 "`$b b   b@_ג` r$% `   ␐ "P @_r ␀`` @W@ b$␐`$b`  0@_` $0C*? " ""#  `   *:  : #"  J?`\2#" #"J?`\2" "9,@ $LJ  : \2$@"%@ 'k?0; @ ޢ@ @_ ␀` ` @@u $␐*?̒` @O'@, #\?Q    0㿘  = ?@/ d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ _ ԓ*` € * ? *? *? *? *? * ? :*???*?  2N"@/f`d 2  ,?@/G(? dN :  ^ \ N`:`2 *" @/A 2  ?@/"?&㿘h = ;?@. d 2L4? d  `"@@/ d 2 `"?@.?@ dL : 2*@*@`"@@. 2 `?@.ߐ?&㿘% # 2N@2? 0  `N@ x X `    @ā`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@~.`.`   (8 J2J " $ b@$` b@$ b@$ b@$9 b@㿐 "` "O"@" "@ - #)|b,  ##@@Y+ @ +` *`" *" *  ** " b"@ "@    b #*` *  *  ""쀤  "b@ *` * 㿐 b    "*`̐    ?  "@  "@   ?0   # *`  """㿘  "b  " ""@ :`*`  "C   "# $"#"b?             "#" $"   ?  $""c#"  `* "c  $b" b "?"b"@ :`*`  "㿘 @P @  b " " ""@ :`*`  "`4. ` ,`"X  bD@    ""#    $c(  "@* @ "" * @"㿘 "`  "q@Вbm `9  * $!   b@ "# 2` b b   #bb  #b "#b㿐@@w'@Ȓ ' "`?$$  㿈'HN@ r'D w HJ`   "`n @, ' g 耢 @, 0]Ȓ?` H @9 2   @ 㿈 `  # @y )̠ @yΒ  " #\;``# @@#`` #㻘   ,`"` @y )̒b8@y ̒b@@y   ,`   hH@ܒ$`4,``  ,`@⠒@@yK 㿘 `@` , N  , @@ N  @ϐ"X  N @y / ̰"8$ b@$ b@ $  b@㿘*`$ #̐  А :`b@x 2  .2 N .2 *`  p @''Ѐ  "! 0 `?` "8c '`    b9@Lx#@ i`@܀ `    @ܲ @'ܴ %  !'"aa"""!  ??=  b9@LC#@  i`@܀ "" @M* 2 @M* 2 @Mܐ* 2 t 2r3 0  4@ @L$ i ܤ%@@ ܲ @'@ "9 # @ ` @x-ܐ@'%'$@K$ &Ȩ  "è @Z b9#@  @ 4  @x'А' @Eא @E̐@Eɐ̚ %@[ : 07 0@U1Ѐ ܐ %"`7 b9@K#@ &x ܀  q  % "4@%@`?a @ܲ @Y'ᘠ@T܀  ᘐ %ܒ"`@[=N @2 @ ` 䀢  ?#@  ܐ @%ܐ @'  " b9 '  ؐ!@ Ԑ  'wؒ "@֔ܤؐ ''؀ "  ? ܀ 6 !P !d%@` #@  a@ ᘀ @x 9 " @   @w%ܐ@%'ܐ!P   "9 @ #`  "` 㿘 ! !P ` !P@N?!P@Z   @   @ ڐaԁ㿈 !P ` `@Nf?`@7 ` ?       /""   "`  !" " @v .  "@4א 2  "# ` B.N? ."= "<@S  ! "8!@vP   !$"a'a& a#a& $# @ " # `.2 J 2 J . #  `D`@vP : 2NN :2AN $N? .9 "<@R ! "8!@v<  !$"!'!& !#!&  "f#` #  `D`2 *:  : . J 2 J .  # @ O  ̒bؐ@v   9 L f"( y b %2#`2 @J@%@  @3#@ @%ݐ@6`2L ̀ f㻀 !Ԑ !P `@M@? @2`? ?@ ?@  "`  )`&    ?#@"       `    ?    /  ?  ""J!ǰ -  @ `#\ ` `@ǒ$-  )̪ @2#@i ?@ O耢  ̒bؐ@u'  @  ̨#cM@ f"{ y b y2w2t@-o  #, , , , , , , ,,@$@ V  @1@    #, , , , ,  , ,, @1@   @$ǐ&@$Ð "<& & @/ !"!"`aP  @8  & &  " @" !M@ y f!㿘! !̀ ̐# @Sc0$!@T "!Ё㿘! !̀  !Ѐ`@ $!́㿐 !̦` + ̐# @Sʒc0 $ ?@Sq  %` J?` 2'#! "8@T, N #ߐ@t/ # 2,̨ @U'c8  "<, @P   @P  !X @ '  '  a    <"!!""" "L'  L "  " !"`&! @Tޒ#8 &P,  !L  `*`:    @$@`@TĒ#8  P,  PL  P  $@8$'!@Z%`!㿘 !X @   @ 㿘 0 @P   $   @Pג 2 㿘 !" "       @ 㿘  aa   " " "  #a  p " / a̬ @T=c8 Z ,%@O$ L  L "  " c@@T#  aL " , a  %a@sR  "4@$@`ð $aL   "4*`:    @$@`@S8  a,  aL  a a$@% x !!`  @P\ 2 ,   H#\ @J '  @"!#̢cX$@@e䀢  N   "`㿐@    !` !@P % ! %  @"!#̢ch@$@ef    "`㿐@  .@?` .@`.@`@ؔ 㿘  % !   & &   @ && @ $&@@$@ `&@ 2@㿘P  @ '  `~ /   d .@2` 2 ?(R& `@  `.. V?V 6?6@?`&@&`@ 鶇2J  J@ `2J @#?"77'''''L'P'T'X@[L*@$  b@㿘 (   "`?6?@ @2 P (    ? 2 0    : @  0f  < :@ f  "  :@ F㿘 㿘 @bP㿘 䀦 #T@Q  0?,@  @D  0,㿘͐ 0@p ͐ P.   @p@q8 0?8 @o @q,ǐ@o "@qA@oא$Ä b@$ b@$b b@$ b@㿘@q5$_ b@$ b@$ b@$ b@$ b@$ b@ d t t  < t \ lI @ Jg" 8o-"H XJ+"FG* ?`C*  u2?*  !00  `  `+ *`+ *`` *``*`*`"   *"* 2 㿐L V?'$ = -92   @  8 ?  "#  `8` @Q3  ,02+L*  ` 2 А L   @ ' 0 2 0-3  =@/@  L g  o a *`:  u*` : -)$8 :  + - =ڐ`=*` =  ?* : ` uq!*` €$ ?" ?"" II -@ &`0 ? ?@ -3 =`@ =` ="  +` -@ ݐ& ? ?@ -3  X@r  -@{ Ő& ? ?@ -L3 @Z=`G =` =!``=` ="  -@V & ? ?@ -=`3 @5`" -@=  &`# @ ? ?@ -3  X@AL  ,**` .@U`g"*`o`= -`X`+`-0?0<`u07*2 -2   +* )2  &2 *2 <c* 2  * 2 +-  =  *   - +  X2`2 `: J@+-X2@   `J@-+`8  X`8  `( 2 **   2 **  "J@2 ** ʐ $ b@ 0? (?#$ b@$ b@ @(*`  *02 @㿘@@ @nQ @㿘 `D  @i 1 #x`D@KŒ Ȁ N@m  "`D`D`? "`@< @  "@ ဢ0# @ ` " L   `2 L "Π#x #"ˠ#x  c`"c`  @*@$`L $`$`@ɐ$`L $` @#`"` "`L M @ '͐@_     ` ?|$` c@_     `  j$` cȐ@_}     `  X$` cА@_k     `  F$` cؐ@_Y     `  4$` c@_G     `  "$` c@_5     `  $` c@_#  M @L  =2 M @@n$`@%L pM @ #" L #2 #` L "  " #`& L "& @l 2,J A 倠"62 J\2 J ""  *@'`# *@&*  2 *@* J "   "   J "  "  " 0 Jŀ"*㿘@l =   㿘1  D  ͐#@L`& D@ @L+ 㿘1  D  @8& D@  J " 㿘@ @' `@@?` $@@k$`@i@ 㿘@h㿘@ @l` "&@㿘@ 㽐^  .   <    "` O ?@ @$#"` Β`P4@^           c@ @@0%@'  $@䀤c``  @Ր@Ӑw $@c&  5u"   ` , %   `$@@$ '@G , %` @ @kĒ "$  2``2$`@ 퀤@   8 @T*  2 & $& @I&  & @h  & && & @M& 㿘  `@ `= @ 3%``@$@#6 $"    ,*  @$@ ֘ Т06`@Ӓ`@̒`(q@ő6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **@-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =@p%``@$@#6 $"    ,*  @$@ ֘ Т0a@6$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  @9Ė@/%㿘@   H  L*`    H#" # # #?㿘` *` L@@  2 "  @  " : @  & &   @6@  2 @$@㿘  @&   22 &   2   2    @  &   @ 2   "   & @ `"   2   2  㿘  % @- # $`  `  @  `  @r@  "&& 㿐@ Ϊ_ L [@IR Q" J``MJ  1΀`M*`k`G`K`(#  `m`g  Ψ  !Ψ % $Ψ $! @"% @ΐ @ @ ! ΐ!@`""! Δ  @g  &&  &&@ Ё$8 b@$v b@$d b@$ b@$+ b@?ch?# @  @ Ժ ?@ ?# @!?4#a/?#?  ?# !?$#?#?  ?# ! ?# ?#? ?#  ̀??#`  ?`?``?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ?#?    ?# ! ?#?  ?#  ?Q#M??#?   ?# ! 2 ?7@! 2?#?  ?c@  ̀@2 ?"@ ̀@?#?  ?c@ ! @" @! @2 #? G #?   ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ#  @^ ?`?D '#\   @2@   z? " @: d? M J J`, , 4 $   @ J 2, ;`@ :E4&@ @? ?`)` ` % _ J _"@eĐ 2 `?$  ` , `4  ` ,  "J 2L Т`  8 & @ؘ `?@`0#@ݐSF ӄF @   "  ?b!?#Ȣ@ 4 @ 4    n ΐ i#h ? &?`0@`.`    #\   @ʘ??@ J `  @i 0:*` *   ?#Ȓ 0   @ `( ( @Ӑ @Q  @   @/@?#\  @o??@ ,`4`$`` @  `J 2,``e0P %L@?`C@ "?L "; @d " L _2  @d 2!` $` ``"   ``  ,` ,` 2  ? ,`4`  ,`` @ "L ̐  8 "   @" @10@㿘 !8?  , @€? 㿘 / ?N㿘`? "`@  "@@{F $ b@㿘 ?*`  * `N  2! # a耢 @  $a@b 2$` 1 !Δ0@I 0 @c  㿘 ?*`  * bN  2! # c @  $c@ 2$` 1 #Δ0@ 0 @c  㿘  b<  z"  c'  r! i" "8`@     @  Vb㿘 M"@    @Ԗ bL@:"  㿘  b<  ."  c'  &!Β㿘  "7 '  `&㿘 "@E    @ bL@e"  㿘  b<  "  c'  ܐ!Β㿘  "7 '  `&㿘1 "8 "@B\1 "T 뀢`""P@Ð &"T  ΐ!8@B aH&"8@ 㿘@ 㿘! 隐"   ""L 鑐"㿘! "8  @v+# bT $"8`""P@ $bT㿘! "us`  # ) "P p "X` "X@@  `%"P@k "P  4V'# bT`bTИ#`% #\ "X\aP@U՚ؠ@LbT $bT$bT$\,"X aP\@ mЀ @3%"P"P` "X#΢aP@m@UР@%"P  @"PԒ@@%"P', "8@?Ò$ 2' @a 2L"8{"8`? "`@y7 @  "@ k0 +L :i  e@?V y !  S%"P"X "X@?_ K"P #"XaP@Ζ` @0"X!@!h@TР 2)"PԒ@@!΢̠!x,'̒@ &@ &@  ""P@D ȔJ@ "P@ P&N&@> Βax@ ̀  " @a "P %"P@aА ΐ̠ @ qax  &"!x@a 2"P!x@ b&@ ^ ""P@Dh Ȁ@J@ 2"P8"P &̀"P̀  c@%& J ,  *"@`    ""@*"@ `" ̀@  '"@ 㿘N  @̐  " @a] $ "h ""h$ @ 㿘 "h " @a 2   2 㿘 "h` @@`@ 2@$h㿘%  b t""`t `(L ` ?@ @`"@t @`"  `L ` ?@А @`" @  @`"  `a" "  ""  `L ` ?@ @ے`" @  @`"   `L ` ?@ @Ò`" @  @`"  `L ` ?@~ @`" @v  `"  b ` $# $"⼁㿐N@ ' +J@` :'J@ 2`a'@ )&@ %& @ ! ] @C*UJ 2 N& @  H @CAJ 2} : :& @ & @  . @@ڐ'J 2c #@4^ ' @$Z & @ א  @@ J 2H @4E @4 & $@ ΐ!& & & $a@ & @ & @  b` (&  "d`"  2&    ` &  ` & `  2& `  2& ` `2&  ` "` @g 1 bl? @.%"l"l  b æ  "` "@<Đ $⬀ y    ! 뀢 "G! b , @) "!!ؘ#`% #\ "b@R@b  $b $@ '! $bh$@" !Β! b⸘@ '؀ TJ$⬒@%̀ @$⬀ ""lJ "l@" !!@@Q؀ #*! bp  @" "!!"p@ܚ@Q"p@$⬀  &"p܀ "Q"l@M"l! @ "@' ذbt"*@k ;"l0a  2`/"@  ''@ N"l I1 "tJ + -J  @"t    "b  "b@^0 "@^̐  "bp"l2)"tJ  @@I԰ ̀` J@ F @t @"l9"l"t XΒa  1''Β/!@ 1 " ''   " ؟   㿈O% 9 "t? ) ``"d)`2#$` "` "@;d "$`%"d"Βa@ 耢 2 $`@ а  $`%"d$t%"d$t ` "`@ A    ""?7 9 "tJ`+`-"J bt# bb @; "tJ   @" _"! " @ $"b !΢!@! "@PU" _ "`@ i %"2bt@a ̒@Ĭ @)?⠀ " J  M" !!# @"@Pb "2! " "%"@ 3%"`@ , %"bt %'Ȁ !!# @^"@Ob  ! " "O%"@ K%"""@xbb,ېbt <bt $05` `@@ ̢ Ā` J@  @ @btސ bt@] bt⤀  @&J'"`S ⠐ %⠀ ⠐ 2/А В@&  ''@ߐ ! ⤀  @&ٰ %'"` 1/@ݐ`  В@`''@ "`  @&  "t ` "`@y C D  Β Ȑ@z  "b? 7 9 "tJ`+`-bt # bb @9ǐ "tJ   @" _"! " @ 2$".b !΢!@i! "@O" _ "`@  %"2bt@  ̒@DĬ @Ԭ?⠀ " J  " !!# @1"@Nɚb "2! " "%"@ %"`@ א %"bt 'Ȁ !!# @ "@Nb  ! " "N%"@ J%"""@#bb,bt ;bt %04J ` `@@ ̢ Ā` J@  @Ô @Sbt  bt ⤀ b @&bD'"`T ⠐ %⠀ ⠐ 2/ @Ҕ  ''@ ! ⤀ b @&b  '"` 3/'@  ''@o "` b @&b  "t 㿘! "   "b"""@  T$" ""` 㿘 㿘! " 뀢""@ $"! " 뀢`""@  6$" ""`㿘  ?"bl-" !ΰ"   @^k  뀢 "b ! "h  Βb@>m  $"h 㿐 b  x 1 ! "l"p @ &"l 2 $"p"p "&"l@ &"l$"p_ "p ""t' @* .`` t"  @* .`` ! "|@ ` @ ` @ $ ` @* .`` t"  @* .`` t"  @* .`` t" @* .``  b@Ҕ `$@@@Ȕ   $⨰ 㿘@ & 2 Βbp@ & & @  P &Βbp@ 㿘  @2 *@ A&  2 & @ !&bp@Ő  * "  & 㿘`  @ .`@ @ ` @*@ @ 㿘  @: ,`@@Z# 2 `@* 㿘 "L@ @#@ L@ @ `2` "` "#L@ @K   ` 2  L "# L    `2  " *: #&   `&@ s Βbp@9 @@* & 㿘@ ]  2Βbp@# `$ ,  ,   )    "@ _ @ Y@ W 㿀) " / @ @ $ ,@P"''  ?0@ 0@Y耢 &Βbp@А & @"@ ! 2" 310 0"""@O@K䀢   㿘J`"V #%J`#N   "`&J` ` # `2 "(2V &@ΐb.?,  "&J  c@ `  # @ &@p@[ @@  *L 2 㿈  @ΐ"@03_< 1 *'5   ? @p0 "` &Ē㿘  ` `@X  `  @X}     @Xq   㿈;  @0ΐ"@'Y і 1 M ' " ?:( @ 01 "@  "@  @@  Ð@װ 0@Ӱ 㿘@ Βbp@p  #N Ζ"h`N@ Θ"h@v0㿘Δ#Ζ#  Θ# `Κ# @v㿐` @֐" @А 0@  㿘ږ   Ӗ  ɖ   ” $ @7"NN? ,2 N`@W6(  @?  @I 逦@5 㿘 "|! `$"% " $b|@! "  ""@"  @@"b| $"  @$㿐 "|`'! "  ΐ#0   @Zr $""  ΒcH  1 @4t0@@WJ Βbp@z . "$|     "@" "‐ 㿐! "'  'ΐ#0   @Z* $"" @44 cH D 1 @4( `@`  `  3`  2  2 @Vؐ (I 㿘'L'P'T'X@L㿘   #ax!ΒcP@r7` @uؐΒcX@r-!Π#`@L@r%@O㿘'H'L'P'T'X@H㿘   #ax!Βch@r   @uΒcp@r!Π#x@L@q㿘'H'L'P'T'X@H㿘a #!xΒc@q @uΐ@qےc  J H 2* #2HJX  N "q @ @ `"j N@ "f @ @('_ &'@&Đ@I  S #ܔ  ?''?'?'' ` #\  ̒ ؟#܀    `@K`Đ?"`h@Xఒ !`@Q& & @{*@`@B'@ ' @l@@*@@VA@Jā㿘@U @U` 㿘 `آ @@1 ` `؀ @㿘!  p ϐ p@4`$ p@4 `ؐ"`؁㿘!  p " @h$ p " ؁㿐 `p   ϐ p@4h` % p p@4 y J?` 2'# p! "Ȓ@, L@ #@Tђ # 2,   "@5ƒ` Ҥ, LL "  " @5  ,@`@5Đ" pJ  p# p "ؒ""`"``!L  *`:    $@5 " $,  "$L  $"́$I b@$y b@㿘 @   "`?$% b@" ( 㿘.`2m&  $ b@<8=<(==> *` €!đ* <%!!đ2 8%! 5"#  1"c ."#  *"c '"#  #"c  "#  "c "#  "c "#  "c %  %! #А $#$#L     "c#\   @? ?"ctܐ @ c 2 #h? !"cl( "#x &#h %!!Đ *` @5%! "c&`㿘# ?c|   * `""` "@""" 6 ߐ 4  cl"  * #t   "@  #t"  ` #`. @} Ѐ`  c "c@㿘? (    ) ?:   :  #t,    2 2 *   *,`  @    6 6   : 6 * 2 2@6 6 & @ 6 @J@GM 2@*6 6 6 6 &  4 `   ?2 * #@ `" 6   2*  (   #  `  +@ 2*` +@*#  $@ ?6 6 ` cl #t * "@#t&"#t7 #t `  "   `* @ " *` 6 #t"@& c#: *   ,    @ 㿘 #h` #`@n   #` 2 h! #` @c 㿘 #`@A #h`2 a!#l4` "@ Y!@ #p R!h #t*  ?@E!`@ !`@   #`8@6?@20D )  * ?@#!?,@2 2 *`  2!  c* 2 @2 @ 0А!  0Z   ` @0@@㿘  #h` !0#` #l6 "@ ڐ!@0 #p Ґ!h0 #t*  @0  *@ ?. 2 !0t2 *  2@  ` !0e #` , @ Е,@  *@$@    `4  #t* @#t 2  @"@ "@   :@ @" @ "@  * @$'"@$@@@2@"@  cl2 " #t* " `2  @  VT㿘! #А b0 "  $#5"@# ?$## c?$# "X㿘! #А bh " $#"@##?$#㿘 А"x "c  ""@# ?$# @ p# c?$# "X㿘 Ӑ"0Ȁ͐!0?Ɛ!0 t.` " `t* @ # 3 `   ct" ct@   #`+  @ #`@͔ c  $cc" " " c|`c|" "A&c| ` :`@ 2@`@ c"`" &` "@0$c` @`&` @`%&``2"@  &` &` &@" 2@`&`&`  c" "&@$c""@ 0# `aĀ@)! ` #@%@U #@a`&`@&` @, `  #l2 "@  $# #cp t+ " cp  t$OpenBSD: brk.S,v 1.2 1996/08/19 08:18:02 tholo Exp $ aȀ@4   : b@ a$OpenBSD: sbrk.S,v 1.2 1996/08/19 08:18:10 tholo Exp $ ̘   : b@"$OpenBSD: cerror.S,v 1.3 2002/08/11 23:01:30 art Exp $  `??WWWWWȝX\r   `` ? `dh@ `` #Вb@jv!x `  "h"`$ X  `2@J# *` V 6  !$$$   $  ?$  $ $  8$ $ \$ T$ $ (@lg$ $ ''''' X@HՖ @HL +  <`€$ P 6$  '     '    `"`"@Ie  b~~$ @GS$ $    㿈`'' #\b'D ('H? \'L'P'T'X'D`@'T'P$'P('T`!ؐ` 2 *  U@Ԓ  '$$$ $$$$H'|'x8'@$8`€PX@3€ D € PL€ 2   $, `€'<'HH XC<H    $0 $, P  T F   X'7 ' T''' p?/b@!b?'8 2`* `*  $ 8   ?% X`x '` | 'd?``d'xP '|TH , $,  MhV hp"@l'`t"`'d@?`x`@|'Xd@'\@?XX\'xP '|T&  $,r ȠL )  \'L|  " #"$0Ր$,Q (uX`@ 2o @GU @F .@G,, DD `€   $,$0  %@F3 D@  @  D'D @Fz''$,",, ,"@0"`4"`㿘  " 8 8@% ("$"($"(""" "  "" """   㿘   " <z < `@ 81/ada\aTada\xxxxxx㿐N ! '$ @/B  `   J   8  ????' $ $ $ $ $ $ $ `?"V  2y? 2u? 2q? 2m??g? "   "\?$$  $ $ $ $ $ $$ !#l`#l 2`"    ".? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $ '  ' l' ' ' ' ' l`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   m 2l?lg? Vl$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @+`` `` `     2 `?&   "&@&&㿐 !M@  \ !X`@!? ђ`H@JE  #@ O ђ`P@J5 `+ J@ &`J@ f" y b  2 @- @p@  `J@ ဢ f`@= `  & 0  `  h*` €???`@%Ԑx& '     `1 @ 2) @F  "$  " ``@  $  @ $  ?@  & @%Sh&'ؐ@Ȓ 2= @  6 @% & @`2"?@~ $?@   ` `  & @% 㿐@ 2C @  2 < @I9 %  -@I $&?4"?,@   2 @?&`2㿘   @I{&` ? 㿘`ڐ &  $  $ $  $  $   $ `$  @$ `  *`@$  $ *  ` `@0 㿘@ 㿘`"E    2?         3?1?/?  "(?@$?c ?     @ђ 8@&ǐ ߀ 2     2  2         㿐N (?`@? ?@?@  ?@) & ! $ @+| &  ? J  ??c0'D  'L????؀  D0z2y D??c#@#@?Dc    `"`@Θ& `@   N"`@?@8   ="`'L? " ?@?㔚"? D @ A`@ "<@@5* 2 `@0* `4 @+* 2 ` @ ߒ?0$D@c$ € " @ِ@ 4?@9Z? @耢 (}@@J @?@<L %@*k@@$  ђ`X %@*Y@2S@2M@$??c@@?@ @H ?㔖?c `!?#` ?#?c ")@?# 2 @\  ' ' ' ' ' ' ''  '~ @(? %@ ?     2 @ ??"  @??㘖 L  #`    8  ??????????''z@   u@ 2 ` ?"`T     0! 0@ '''''''' '@''' @?''Ȑ@\ db% Ā   $ `     2$ @>㿘! ! ѐ @%`$!@%㿘! ! @Y$!?cp !`ѐ @%w`؀ %a| c@! ?#@a@# "o L #?ђ`@& Ѩ ,@&`蠒 ?,  L  *`:    "@&ɒ 蠒 , @#  ? ?L  ?#` `` '`'`'`'`''''ؐ  ? #@$@` ?  2@?#x  ????P  $ ` ` \  LP  ? ???+ђ @EW `*@ `@&N 2*@_] `J@*:    "  @&4`蒒 " `*@``"`J@  @` `'` '`'`'`'` ''' 2' @&@`  2@   $` `  P #Ĕ  #?`??? @"g  _  #`#ڐ ` %# 1%!Ѡ @@7 !%` @'` '`'`'`'`#?@'   $` ` @@7{# 2##   $`` ?c !P `   @` " ^?`??5?#@`'@ $`` ` ` #\#`@#d  aP  @ 3@t@   2   2   &`@`2` |- €         "`?  "`㿘 !P  ``   @  "    ""`N    J .Jd?`2J J .`?  aP@ aPTgad2  ? @` 4[  aP `  87aP b1 a ,a@@@ 4; =4 "   "  2     2 `"" `@  "@ @   $ `? $?㻐 !X` @` " 2?`@$  ?N .2@CC @@ $  "` ?@a$}}}}}}㻈 ? &aP`  @ " H?$#d#` #\  @  aP  $@1   ("`@ 6  "` ` ` x*` €         "`?㿘 !P  `   @@  "    ""`N    J .Jd?`2J J .`? aP@ jqaPad2  ? @f 4a  aP `  ;:aP b4 a /a@@C 4>` =7 "   "  2     2 `"" `@  "@ @   $ `? $?㷈 !X` @` " (?`@~E?"N .2h@}h ,@ #\($@`f$㻐 !X 2x @^p!() 2p lѐ@!.a8 "g @b YJ?` '#N@z, O  "#@ ` 2 L@`L@  @@ `"`L@ 4 ,@@ ) "#` @ `2`!`L` `  1 #J  @ `"#*$@Ai@T0 @ z @T H !P `` d@  " ? `  @@L!P2@4 *` * $ >*` a ?$ 'G'$@^?2\?$@Ӻ@7 ʰ.2 @.2  @  ?4  <$@` @ @w  @s @s  @k 4  $@` @. , @_2 . @[2  @\ /`2 @T ` @|@4 &㿘& @*? .@@; )?# .@12  . . !X    @  @ `   &6` 㿘.`  .2 .   ,,`6 @H2 @iq6 , 4 @@@ii6` ,`6 㿘@^%?' )!$@{> #c4    2@^w2cР$  @^p2c$  2 ! 4#ؔ!  2c֪ 5 3 - 7 1 4##ؒ @{*  `@^P#$@{ c4 $` Ѩ!@ ,,`2   , @z4*  2` , 2  @i` ,2`x 6ڒ 6bxw;"z @䀠 ` ? &6"z㿘!  w)# bx!/  ##܀ ! t! # @]$##bx 2 @/@ $#a -   #֠c)`#@@h!?4#а` bx #Ԙڒ@ 5bx c z . 6 8T\8    Ԕ P*@ @ * 㿘  8 Q !P L ?# ߐ @ @2  @2      ) @`  "$   0 # aP ?c 2 `"  @2  㻐 )@$ @?@* `4 @* 2  ` @V   ܤ 㻐  & $?  @$ @@U* `4 @P* 2  ` ` !P 'H'Ԁ`'D@H?"I?!P `'H" 'ĔP  <''̀  !'ȐP  @  ' @  `   @? ` * "Ѐ`"  DHВ`"*` €   )4?`Ā !P"`'Ȥ  !  "Ȁ`" @ "%b @    $"̀ $b  *`! $ &   *  "bȠJ@D H''''b骔 H`   *` 7ްb5ޠ  ް"@*` 7ހ  @ 6(̀ % @'j @h* 2 ' 77"7ހb ހ   @dB!P"b* &7ޑ* 2 ""b蠒 ޒ"@*` 7 @ "`  ! Ȁ  " @ !PȀ @(   [$"̀ $b  *B` ""Ē!P`$ ! `  Ȁ"Ā` ! "Ā  Dba䀢 # $"D b@"HH"Ā   /'7bK  $""`D bH H Ȑ *t!P!P* '@}` '耢 4' ''b  @+2  \b 2 * +  &   ɐ #   `b0B! >'' "`b l2؀ 0'Ԑ '@b!P $ (u b (2 DH b     !P *@h!P!``"D  `  " @Y'< Ā !P ` `!P a @F "Ԁ`  DbԘH`/"*` €   )4%?`D  `@ P Ȑ  '@Ā  Ѐ   ="` <"`" ?㿘! "  ?   $"""""́㿘 @? @$㿐 R?@t8`0`  `@@"$`0C $`0T` $` $`;` 3\@rޔ `  ?`2  `C  $`4` $`$`$@2(" $`4` $@ $` "$` $`$`@"\|`|l|x|||||||||||||||||||||||||||||||| |,|||||||8DP|||||||\|h|||||||t|||||||||||||||||||||(|||||||||4||@|||||||L||||||||||||||||Xd|||||||p\ \,8\\\DPt4hh4444h4d,,ddhLhhhhh(hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhLL4@@@@@@@@(@@@@(@@@4@@@@@@@@@@@@@4@@@@@@@@(@@@@(@@@4ppɴɴppɴɴ㿘`!(*` €1!P1!X1!`1!h1!p1~!x1{!1x!1u!1r!1o!1l!1i!1f!1c!1`!1]!1Z!1W!1T!1Q!1N!H1K"1H"1E"1B"1?" 1<"019"@16"H13"X10"h1-"p1*"x1'"1$"1!"1"1"1"1"1"1"1 "1 "1 #є@X_ 㿘`+#*` €1*"1'#1$#1!#1#1# 1#(1#01#81#@1 #H1 #P1  є@X' 㿘 !P!` G   !\cX@U  !P`  @? @  @* 2  &<`aP!`  !`?` '`@ * '@ @ 㿘 #@a 㿘ђc`@U<   !P# " @@U,cp2 `?`&`@ * &@@ 㻈 !P `@?k!`  ( ``" P `2`    ̒ `<! +`  cx@T`& * & @P!` (P?`&@ ; ;* &@rP!` "@Pђc@T2``ђc@T$ђc@T"ђc@T!ђc@T ђc@T @ђc@T ђc@T ђc@TP!` !P Ғ`@T{ !?#Ғ` @Ts Ғ` @Tn Ҕ `0@ThP!` +" ?`& * & @   tP!`  "?Ғ`@@TE? g !P-+)`  @@T5P@8`   @ @ $ @ `s@m`  " `@ * @2 @T`X`@8Z`   @ {* @ܑ2 @S h` ` "? ?`&* & @ ?<`@/  x?c#\  7 %@  #\ @) @  #\    0 Ґ@S`0Ґ@S`Ё㿘"㻐@ c$ O ?`&@ .* &@ ! .@ W㿘Ԕ"㿘@ 4 & @s J?`."   .  *`㻐 ؘ$ @ 0 ?c !P ` @ "    $ @ @ *  2 @ *  2 @  @ !Pa`*  2 `d!PҒ`@R!P!`   !@Ӑ!Ҕ @R@Đ @R`eD *` €``2@%?@rS   T"@ @ G@  2-T"@ @ <@   @ 6* ҙ2 a ` @R?`&@  Ҫ!@ {9 6:5%@6  \?`&@ \* &@ !?` &@  * & @ `*?`&@ " "* &@ M H a@ %6:5%@6;  \?`&@ \* &@ ϒ?` &@  * & @ `*?`&@ "} " 2hҒ@ ې!(Ғa0@Q^?`&@  * &@  "\ ?`&@  * &@ r Ғ@ !X@ CҰ @Qa`@ :!Ұ @!x@Q@ .!Ұ @!@Q@ "!Ұ @!@Q@ !Ҡ!@ް @Q!Ґ@ !ؑ* 2 @Q}y !Ґ@ !ؑ* 2 @Qr ' " ?`[&@6X[ Ҡ!@ <9 6:5%@5N  \?`&@ \* &@ ?` &@  * & @ ͒`*?`&@ " "?`&@  * &@ h "?`&@ "* &@ 9 6:5%@4  \?`&@ \* &@ v?` &@  * & @ a`* "?`&@ "* &@ J ?`&@ * &@ 7 ? @ Ȑ ?   .@  ߒ ?`  @ Ւ @  * @ 4 * 2 Ұ @P`a!Ұ !@PW @PO @PGC@  * @ 4` * @ 4 * 2 Ұ a@P0,?`&@  * &@ ĒҔ " ?`&@  * &@  2h| ?`&@  * &@ @ ɒO 2M!Ґ@ c"@OېB  ?!? @oS !T#"@ @@ Gb @O  * ' ``@  B@  ?`&@ * &@ @,`*?`&@ ) )* &@ '?`&@&  * &@ @* 2 Ұ @Odb Ұ b(@O^Ғb0 @OX?aX ✒$@ @+Ҧ1Ҁ`?2@O@"8L?`&@  * & @Ӓ`@倌`?}b@@ё*  cp@2 @OҰ b@O@p ҒbX@O@Ғb(@N !Ґ@|"@w @N@t@o @N!Ґ@e"* 2 @N ?aX ✒$@l @"+Ҧ1Ҁ`?2@NĒ"8L?`&@  * & @W`@倌`?b@@NҒbH@N@jҒb@N?`& * & @2&Ґb@N 㿘    @Ґ 2 2 &   2 2&㿘   2 2&   2  є@Pג 2&㿘   2 2&   2  8є@P 2&㿘Ғ#4 㿘Ғ" 㿘@"K1"?1671O1 8121F1 11A1 61.1(141 '1/1 '1!1%1 "11 1""8 "@"H"X"`"p"x"""" " "" PԔȐ@P? (㿘  1  xԒbА@1 (0@l <@vŒ <@l <@v <@ly @v   x` (Ԕ"؀`$"Ԙ"@P  x$ 6r n` , dԔ"$"Ԙ"@O x$ 6T P  ` , CԔ# $"Ԙ"@Oʖ x$ 63 /` `25 x22 x 2/ x`  , Ԕ#`$"Ԙ"@O x$ 6   x  .`*` , , ?,㿘  @kۑ2   @kג  * @v1 !԰ #(@v  d d@kŐ@Og 㿘 "#    `1  +   +` *  `?Е: L .+`   `*  :`Д *` * + Б: @ +` *  #*   ```@:`#,`@u 4 * $ 㿘 "    .(`(б> `c2ci.) (б> `c2cK.+(б> `.2*c!. 8(( `(/ 8а( (`/ ?Ѕ8c"c2(82)h((` (( (( (1 ((` (( (( (1 &(& (82 ( " ""c"c2"㿀''@k'@ @  / /    /逢`  2 쀢 2   J@ - +`'?J@ + "`' "#4' 4' 4`5 5 5  K ' , @ *  `?Ѐ K .,  ' c ` '* :`Д@ *` * +`Б:  ', @*`@*`@@tڐ&%c  @ `   ' @ `  4  4 c4 ' @ `  :X.`/c  `' @ `  c  `' @ `  :/.`ؐ/c  `' @ `  c  `' @ `  :.`/.`.@.` .`.`.`.`.`.`.`.` .` .` .` .` .`㿘@ H'L '&%Ԓ@@L0 ` ``*`  `* `*`     `*``+ @ +`**@ *  @`   / /ސ†"??ڐ!  N S/ /@W#@n#@W <'@n <@W  <@n <` W/  E/@V#@n#@V <@n <@V <@n < d@V d@n@s @.[+  "c@.T "c@.M "c#`#\#tL#d;h#p;x`###@LBc cݾccݸcݲ㿘@i   L ." `@ &L L * 2?J?`.2 㿀'@X 1  l   " " #\  #`#d@K 㿈`B Ԉ#   `2`*3  *2  `? /// ///ꀢ`?/@p:??@p5@p1`?@p,T` . . . .Ğ`? ///@ * `@    2`*  2+ 2  //逢`?/@o ?@o?@@oԔ# `. . = . =..?㿘N  ^  "c   Q`# @,Ȑ _ "`   `9N +`3N@L"@* .@*  `C"@@: .@@**`  ` `3"@@: .@@**`   @%"@@ .@` N   @ `2N=Ԁ=@ N    #9 64? "# @ `  =N   `2N=2?N   "#  `"?N ` @ ?0?㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@n  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ ??"? >*@*,2$? $     ? " ?   " @ H*`P㿘D`4 ` "' 8?, ., \" Ґ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*`2 H(P㿘`` &`` 2 @@`   "`&?@``"  @b! ? `@?&`*@``&@`  @b  ?㿀@fn' ?''@_J?Ѐ 8?Ʌ(8㿘 B :@' .3+1// # "4 c `*   ` D "$ Ӑ   *  c ` D "  ,  .@`   ǀ.   4  6%* . @ 0 07( @ ` 07(*& @* 2 (P㿈'1 ##\0@H 㿘    @  @% /"` 㿀  @ #\@Gِ    "` @)I8  ???? Ȧ 4 :`*`$*`#@ * * # ?''  ?,` ?'' ' ?Ā@$'''', ?Ā@''?Ā ?'P ?# :/ Đ@ 2: :Z ,2 :Q ,, ,Ā  , , P$ 7 @d@$@G'P )6(   Đ@    @ :,  ",@(  "`   !P!P'`''   "aP 2 $  "$ 5 ,4  ,$@af d<*@  $d֒a`$  $`@(E|)ր =-@Dݐ!h 7`!@(6L` '$DH \  .  $@` ' N" N@ 2NNN    2 .$@!x@k '! ֒a#@' /e'#a@a, a@ߐ .O P֐a@ܔ  )O  $a 2@N "  " N 2 0! !!@'֐@a 2."'a@  2AO  ; #@!   N   `L@ y @ b f,  ,``L@ y @ b f , "Ӱ a@h  UO  Pa`2N "  " N  ! !!@'G@'; 2.&?L!?耢  ?@N  . " $@`  N @   N   2 .$@ 'aȐ@ 2O  2 N "  " N d a ֤ "# `  .J  #@ `"*  ??  ??''aؒ  5@EJ' 6` 1`   +  `@_   *  @l!    `+  @_   !`*@" " "" ' "@:a@  O  ֐`   `!Plcc- "7N "  " N π ̀ ;@ `2N N`"N@&CX 2 NN ; N.@# B !Pah-`$@X@&( %`. N   ;  `" *: @. %h@k'%@@e'%`h*`c"  ' S'@  @k N` -`@*` '@ @@"#"#"#"# . `N   ;  `" *: & ./ @3 @6  ?    4,, *,`` ` =.a@   O  ֒a@x@ ` P"  !Pd `**` "d@9 !PL`` @6  @%b . `` @%e!`- !`"!` $@N   ! *:   .Nd`!?@$$@@%7 . $@`@$@y  P @  " @AȐ" @ b !P` "` 㿐N s !Pc+-)'%֑*:  N "  " b@    @ C@ "c  2` ``7* ad+  < -$adb @ڔ  '(@Ԕ  `"0@˔ 2`$@@” 2` (P@  2N` $`N   2 N  0 ???㿘 @ $OpenBSD: bzero.S,v 1.2 1996/08/19 08:17:56 tholo Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` IG 㿈  ?'  @h6 ?? 8p㿐@ ?㿈) "# `y 0   N x X   #*:   `  @i ?;   D` +`ɚ@ ;  . = $" $5# `0$:  `2 \*` €?#@!耢 * #@?#@耢 쀢`* *` ` 耢 쀢`*   *` * @`2&@ 㿘    @  @G /"`?㿐N  / ( ֨"@#_ " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿈 @i9 N :   N :"Nt K N  `D ?#֤"@#  ֤"@#  ",R (N`:`.`GNN A >4, ,   6  @2l  0+N`°   !4, , `$   ? % **   @[Ȕ           @ ` "֚ @ @ @`  @ # 2 @ 㿐 J#`` @    #`&@#``?㿘 &J#`` #` @ ! #` #`& 㿈  ?'  @fJ ?? 㿘`6 "@"&&@[C+, @[& `"&&@[)&@`", 値@9u ހ" ,㿘# `t! @G#P @"- `  @""   20 `cP @" cP@E 2cP @/t㿘   xc  / 㿘!  Ȁ א @`$ @? cP"cP㿘!  Ȁ " @51$  "#P㿐 `Ȁ   א @` $@  J?` 2'#! #ؒ@Z, L@ #@!\ # 2,  "ܰ @Q` ,@`L@L@ "` "``@@ ,@P  J Ȁ?#ȗ* #ܔ2"` "`"` @ภ "&$@,  "!$@L  `*`:    @$@`@ภ " $@,  "$@L  $@#܁㿘 H* D   "?& H& D 㿘 4@8M 2F&@ @Y  $&@ @ "$4 4$  @Y  $@Ò D@Yɐ$"@$@`P $@D@Y@8  ئ&@D&@ 㿐@<͒ & @W  O! 6  "Ԓc(t6 6 & $& ,& (& &    @X  㿘 @R    6 " 8  d`@W(` K  ? B ; > @X/ @2P  @ ? 2 ?  : @ 0d < :@  d  " : @ DE      "`2 @V| h €d#t@2 T & Q 2  <   (4 ؐ$$L4 2T Qɒ Ȫ@B 2#0 @" P  @ ? : @ 0d "< :@ d0 " :@ D8<" @d  "@@d   @2'L4$L@@@D 4%@2L@%@&0$  $@"$0u $0  ?T4 L  :  @ @?2"$0` $@@"$0R $0 @ ?04 @6  @ "@$"$@W' ?@?20?0`@@"$0% $0 $ ?4 $ 㿘 ;   J H ? 2H  J  㿘7 " @ `` - +L@  L@` 0 L@ x XL` ` 0  ) #@G@_Y$ $    - ) "6"&? ? %@dc"  #?% @dS  @`    Ҡ? ??ˠ`2&@ 㿐@$    "  2 @ 2  @z   "`x   ?''D'''   @b:       ܮ   @b( ܚq  h   2c  ^ T`  T ` ?@` ` L`D/ 2 ` @`>  : `   * @"   ?     + "    ? 2@`2@@+ * @ ,`D "ͧ0ɐ"* } ͜? @cܢ @    2  1 2  ) T %` %` @V \ . %`  T@V{ T   ?@`` ?%` @Vk D`%@ h`Df / 2 ` @`6"Y  T`` %`` %`%`  *  @"   ?    .  @"'   ? "%` "%`" %`  @c@@V@Ց.%@ܨ *a 䀥@ D%@""ߐ 㿘ِ㿘% " @ `` - +L@  L@` 0 L@ x XL` ` 0  @a?@Wy?  /  "#@8? ??%@bO  @`    ? ??ޠ 4 `&@ 㿘'L'P'T'X@L㿘 aܔ@1㿘 @P!܁㿘 @V!܁㿘 @܁㿘 @!܁㿘 @a܁㿘'P'T'X@Pp<'P !܀@ גa ## ##` :    #` !܀@@Ԣה@:w((  (6'$@@!נ"@ Ԗ@Ӓ & 6$@` 2` 2`!&``ה(@:G & 6$@` !"0@:4 & 6$@`   :,@` ,@`*`0$ !-+ב:` % N m @ @0@:(b8@96?&$, ?*`ّ:`,P@  & 6@` $@'א$bH '''' Ք `  `` @@L@@ 6@6@@@ E @@ (` 7` א"P J:  >@ $@א$b` ''''ؐƘ^M a܀@@b㿘?"& ^=?&& (?    ?3& o  ?,  (  ? j ?/???????????נ/bh7@Ĕ h j? ]&& 㿘 2&& "&   &㿘]?&&  `"`㿘 H !|*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<**<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<*<!"""!T#8&H#H#h*<*<*<$D*<!T*<*<$$%%&H'(`()*<*<*<*<*<*<!"D""#*<&H"D*<###$d$*<$*<$%%& '(@(l()x㿐@G'ؐ! @ "`2*? *PLG`%=L`z7ǐ"*` €0``א"*` | ؐ!(@<``א"*` ` ؐ!(@,`` א"*` 0 ؐ!(@`` א"*` ؐ!(@ ` d@Z<'lؔa0@cX @ ߠ'ה̐#` a0@ږɰ` a8@Җؔ!@`a0@Ɩ` @BX@BT " ؔa0@`ؔ aP@`a8@` @B4@B0 " ؔa8@~`a0@v`ؔ a0@~mؒ!X@f` #`#\@wYؔP!`ؔL!h@a0@ZI`@'`'` '`'`'`'`'` '`$'`('@ 'ؔx @7`@B$ה#ؒ!@7` `?@Yd"ؔa0@ ` " ؔa@@YP > ``'l` $2m@A d 2 n@A! 2mn!m@A d  !n@A}! !m!n? @Au$?@Aq $@?& Ζ 4` -`` -` 5-`:  V g ؔa02 ؐ ' d@AIؔa0a@ؔ!``` " @Xܒ ؐ @Xג ؔa0@`a@wncPcT '+` '@hf' '` d@@'lؔa0@bQ`ؔ'la@YH`( @^@` D`  b @ @O9` 5`$`6ؐ! !@=@Xn <@Xk <* , ,  <@@ؔa@ cdØ  . L  㿈 @6"@@ `@  (*@  J ? * `` x    ⴀ`"  Đ'L  ( " `x  @   Ę'L% (( ` (@  @?` #k  N : /@/ / 2 ؒa@  2  N /@ .   2Nذ!Ѐ " ?N :" N /`?"آ!`"?@SS@SP #@֐ؒa@@@ . 2 c  2?F ?? @ Z 2ذ?I`F`C`&@@` &`=`$&`:`(@`, 2&` ` 4?` !r4?``24? 2? 2?* + * @ @` ?@@  *@ $@@$@ r 6``, & ` `` 6`e @*` Y`` & @` 6` gLܐ`& @` E&  @``@& ` @4Y?`  `   #L@ @*`   `#L@*@ 6`!L@&`& @ ` ` gL" "` L@` "` ?` `  gL" "`L@` "`?` ` JJ Ѐ ,-+2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ۖ $* "@*`@*`&@N :  ʖ ; *@" * @&@N :   < 2@  &@㿘N -   +    @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` v  "$ N . `      &@` !m` 2N  / u` &`㿘 ` @># d 2  @>! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ؐ!*`@ ?* @*`" *" *  @=В    &@ d@Uq d@=Ð,`@*`@*`@Ud  ``:```: .`" @=  & @,` +`- @* *`ؒ   `& +` * "*"@ *` X '@Pϐ!'$>?L :ݒĠ 5?ؐ"h$ 2&@L 'h$ (!?L  , ;  2L?Đ1'L 2L`ؠ"xL , ;j  ࠒ "?L , Ȑ "?L 2?Đ     &`&`&gL&gP&g` &gT&gd&gh`eب '9خ ĔՐϔ$ $@$@,`$@ ,,`$@ ,` "\ @< d 2  @<ے! . .*@ *`" *" * Ȩ&` 2?  `@e gP* *  ``gL   eؔgP@gL * @*` ` @6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &gh  &`&gL &`&gP&gT&` &` ` "8?#L@@E @@>  㿘ؠ!  㿘 0  ? x"0 ْ 㿘! "㿘@/" # ٞc0  "0@4 4@O@!@ $c0 "0@ŒL   x"x "T#Ēa"""P@"L0 x L :C N㿘! "㿐  x``'`  % gP@ *`` eؘ% ``   *@ 6* , 'L@ @@m &  #L@@ *" &(㿘! "ac [㿘  c8" ,S " 㿘 "B c4 !  "c4#T9#T@,` " "&(㿘 ޔ㿘  c8"̔ , " 㿘! #8Ŕ㿘  ? D+!L!P +  2.   4  ?*      ?+    @2   @     @??ɑ+ %T@Rg@:&@ T T!  ?"  `@RL.&@:.@RE <& <@:&`@:  & &0'@R2!m`&* @*`@*`@ <  d@R$@R! <  d@R$@R !$$@`Ѧb\ @:T d 2  @:N! ,  , @ , @ؐ!*`@&&&@`*``*`&$@ @ 6`&$& & 㿘ː@h@ "  2`㿘@ &8@Q@Q8@VӐ@"&@`` ` ` `@ ('D'P&@`'H'L'Ȑ  '̒`'Д 'Ԗ 'ؐ  ' ' $'('' ' < K?В < C?  <?ܨ 4?z'l .?Ԁ )!n'ؐo? "ؤ  ܤ  \ @9t d 2  @9n! ,  , @@ `'Ԁ!n(+ؤ  ܤ  b\ @9P d 2  @9J! ,  , $@ 'Ԑ*  Ԁ!nݢ'ؒ"@ 'Ԁ  ''ؐ  ̰?ؤܣ*   @9  d 2  @9! ,  , * @Ԁ@ؒȶ 8 ?Ȁ`;8''l'4'?ŀ ?Ȑ ;''w''Ƞ 'IH"@   x#T? |,* 'P@P@耢@2-?? (/ * 'L@L耢@@ " L'H 2耢@츇???줄ϪC?LH  4? `?' *"@' *@'耢`   @' 2?'LHD P"@?㿘  w 㿐  &  `" K && ϐ"@   x#T? :- * P@P@ @2-? (,* @  L`?"@  && `2 "@  " `?&& ޢ쨅?Ϫ?㿘! "ϐ bܐ㿘?" 㿘ϐ& c 㿘ϐ& c} x xL*` 㿘'DDD&㿐'DސDD@ 'א D"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  㿈 "Г*ؒ@ "@  *"ؒ@ "@  'l #h #\ #`#d@,ؐ  㿘  ch#0 < " ȐJ" @ J2  @(*`  @( *` @ (* 㿘N@ `@J^N    2N@ 2N?2J@ "J`  2J@ 㿐 !А@S"@'@H"@* "@*`@*`'  8`#`? "77''''@-[*@㿐b "h @8 c        6 2 {  Dc$$ $ $ $ $  $ $$c  " $  $ ] &$ X $  v $$  $ @F|$  @Fx    @    _ @ ϐ $   #԰  $ 㿐! #  (  & #'@ Ð# "  2 @ h 2 @S; 2 @$  2  X  L " @IY @`" N@ " @IN @$' '@Đ@  z #`@ $   쀢 `'@ '@O 0_ @E@@*@@E0U #ܔ Ė ?''''''''' ` #\  X П H    `@ߒ`@Đ?"`h@ 谒 !H`y'@ ' @E@#`@@ *  H@ʔ " H@ i@āP\ `N "w @H @`"p N@ "l @H @$$a '$@'@@\  U #ܔ  ?''?'?'''' ` #\  X П#܀    `@^`X?"`h@ఒ !#`'@ ' @E"@@*@`$@ $ @E@@*@#@ @oH'D ;  ? ^  ? ` # O"P O #? #X  ` " @Đ 2 `%cX`$&@D ( @G # #X D@ ޒ  2 2 h l   @Q l?& \& h  h 2> hDٔȖؒ$ @*: ?"- h  #  '''̒ '@Q̒@ N& hNlN"̰ ZȰ     ?А   ?؄?//'a'bД  @ 2 @̐ 耤" 5 #    @" % #'''' #\@"$ D耢  "   #D!x@&` `€ ?f& h @ `* @7 `/# 2 & H"W S   & L. H. I& P& T ` . J ` . K A. L `. M `. N ` J. O6 X& h@ D #'2`@:`' ` ? @& \a''Ēb H  \ & `@9!0& h \ ^Ĕ ?@Ԑ!@cX&%cX`2&@ 㿘 ` @?& \& `㿘 㿘 #X  @   2 ` @`$@$Xe0 aaa``aap`aapaaaaaaaa㿘1 # 2# !&##㿈 !k  `€!@r!!@(" ! @M$@ 耢`;א#*` €!@!@(3ْ@(" @ @,$@ @얒 ِ@(s@(k@(b @(Yْb0. @!0ٔ8 @(M 㿘! ##٠!xb@@%  D* 㿘! ##٠!xa@%㿘Z  /  `  `!!ڠ א  !ڠ ΐ @1@'!    @'! ,,㿘! ##٠!xb@Đ@%W  ؇* 㿘 @ϒc㿘 `"@ J@ "@ 2N@@E  @ *@`N &*@`   d 2  #ڒb@% !x `  ""` 2@ *` 26 y  6#$   v &@6  ڔ       "``"?O LK $ $$ $  $   L$  $  ?$ @&' ''''Đ 0 @N @Œ 2  P  # K `€ P$ H``ڟ@ې#(a@ #$@$$    h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@Ӓ q $@ϒ  $ $h 2@d   ` %  $ $Y %  آ&@'`'`''@i'耢 F@  $ "'0<Ȁ2' @] $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@i $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " PJ P `@ LP2 `!ؐ` 2 * J ?@Mi  '$ $ $ $ $ $ $  >  Ȩb@''+  2`* `*  $   S `>o Ȗ"@'̒"`'Đ@? "@ '"`'@?' '`  ` & $ )?` " & (& $?" 2  6 & $& (?` & $& (㿘#  ?&`?$ $$ ( @㿀!  2  < @K @ 2$ +  < '    &  `&  && &  &  & @3 (@1 @. @& <  `@㿘    ` (<   r,qqrrr 㿘@  ``@ !㿘@֔ 㿘 @Œ` " `    ``€ @`  @`㿘@ " @   @`  @`@` 㿘@ @` " ` 2   ` (`@  㿘 &`&` 2 @n @\` @d`  @_` @Z`  ۄD*  "@ "@ "@  "@ "@"@ "`"@"`     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &``" d D" " " "  "  "@ "   "@   "   " ? @dd(*#d ` * `* `*d# "  #"@d 0#d*@  *` *` *` "  #㿘 "  $  @>  @$  㿘 "  $  @=  @$    "    @4 " "       " "   㿘@㾈`!'?2`\?@J  `   '`  '  ."`E? '` ' ) .` *`.@ '찒 +6k  # !    6W   $ @  &$  p  o6 `?`!'''#\ab7ڐ ! /  ' `''''' #\, , ڀ    "` ``  ڀ 2   "` @܀?"6 G@6 ځ㿘@C @>`  @9` @4`  㿘 D  #ې!x@̒`05@ @$ <@ $ @  $  #ې!x@`Đ0 $   2 $    $ 8`& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @- 2  & @ "㿘   4   8 2 @a 󀦠 8@9 & 4"$ 4@㿘!    " 8 @'$ ے` '' `@-ؒ@=$$  ې  $:$$ + 㿘   @*  0?,@B+  @*z  0,㿘ے @! !؀ . ې!  @:@l # ? @-@_ Đ@= "@t  "`# `@$`㿘?   "` ?"  @ 㿘?   =  @ @7   @.@08/`(@ @ @?@4@08/`(@р 6`6`@؆@tttttttttttttttttttttttttttttttttttt㻘 "?N @ / @{wU 2 @O! 2۠! @G!P ۢ!XJ B  ?* : `(3!D*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@?2 L 2 L ?0/Z ?,2, Cv$?#\   @D Cj?2???#@   && ̐?J      (+  2 2 " 2+J " ?JJ2 @(*`*J@   J@J`  㿘@& " @  2  @’`@`㿘@  `@  㿘@㿘@;ϐ e @80 㿐6  ?&㿘@  @` @(` 㿘@m @㿘@f @㿘@/  @"` @` 㿘`@$㿘@ @` 㿘`@Ж$㿘@㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐 "    0 V@ €'€   6@  㿐 "    0 @ €'€   6@  㿐N@'   .@ 㿐@'В   .@ 㿐 "    0@  @ '€@€    @ &@  㿘㿘$ "         `2      2     bX`?㿘@b "2  2+ "   0"   &@   #ߐ!x@`    &@㿘`–$㿘 "   @ "  2    €㿐 @   "7 @9$' -8+ `  ` 0!  2&@   #ߐ!x@`8 ,1&@  㿘?    (             㿘 I@8   @ @o@ @8o @ @o  "` ?" " " " " "  +[ а  ? ' ' ''''''!  ! @   "  "& `& . ``& i& &`D9 '   @3 ?#` ` 2``o   & ߒ`@ f&  @"& !"&  S   & -x 2K5 @ !& "Lc\`"h`L& & & & & & &  @. "'5 `  2   "` @ @ !  )€??5 0  "`5  @`"&>& 㿘  `"" @ & " ( " "`?@;: '|'d 'h'`'l't'x'p ?"@   t  'lt  |x!t`'t!'x| "'||!taܔ 't'l'x'd'`'|'p| ဢ@d[ "$ \ @A"$?$a| $$a$at$ax$b$a J$`&& & & & & & & & ab  $b !La0#8`Ȅ8& & & & & & & && ` "       b  $b )˔ $aaА`  @a?$ab  $b aВ N ?`a, `̀@wa  •  L!b@b ?F$b \ $b X'\ T/ P/ L/\'X/ H/ / /X'T/ `/ `/ `T//'P///P'L////L'H/ / / H//L!b@   O?"@~ _2z 'pb  $b $a$bp `؀!'p"'pp@ 8'p` b  $b b $aԐ $b $bp$ad p?*  'dpd* @ *'ddaؐ@>?l@>??* 2``4aܐ 4aaЖa@͐ +$@b  a@@3?b  $b  b  $b @b  $b     O"`` ` "aaЀ?< 㿐 @    2 2   @  "`, ` 2,?"`@  "@  `2? $4 $ $ !ڒ 4 $ !ؒ @?X@n  @i 0?㻐M @ڐ ߔ ߖ $@?'g @א?~ f  㿘  `"" @/ & "  !А "`?㿈  `@ $   "`'?@  ?  @@ 0#\  @ 0!Ȱ" @ @@0@$ P" `2@0' ` ` `.' .. . .' . .  .. '... . .. 7...7  `?2 .O.* 2   ܄ؚԘБ.`2 7 **  '. ***'**** ' `* `* `**' * * **`*`2  ² 0ki* 2  e ΰȞĆ.`2 @7 **@  '  . * **' * * ** 1'****'****' `* `* `**' * * **`*`2   P" `2@0 ? ``U2 * 2  Ģ+ 2 @  '``. +``+`+``@' +@ +` +`+`` @ `@' +@ +` +`+``@'+@+`+`+`@ 7 + 2`*@ *t`Ģk* 2  f ܰ؞ԆЄ̪ʑ+ 2   '``. +``+`+``@'`+@`+``+`+`` @1`@' +@ +` +`+``@' +@ +` +`+``@'+@+`+`+``@'+@+`+`+`2  7 `+ ʒ@2*` *`' . . .'. `. `. `.'. . .  . . ' . . .7. .7. ..t#tp * d * #p* l t`*  * (` (` ph(`  #l  * (` (` l(`  #h * (` (` h(`  #d  * (` (` d(`  #` ` `* (` `(` `(`#h ``"b @@ $`b   "`(    `    "`?`aܐ < (`Ԑ@/? '' @: `@: `aܐ Ԑ@?Ӑ '' @: @: `aܐ ̠Ԁ2 a@ @` "?)`  Ж@ 2 @ ?  Ѐ @@   Ѐ "`b "`@m?2 `@@ ?`    ?  "@ @ #\@< c0m,* 2 2`   , "*@:  ,  6 "@6  2  ` &  $ ,@ `@9`@9`(@ @@ 2 a`@2a`  4`a䀢 2@  2  5`?2 ?@2@ $a 4a쀢 2 @`2@ $a4a$a@@z  2b @ b   $b 㿘 @!袒 2!I&!& 6 ` ` ` ?"@  @*7!䀢 2`` 2/*2 2`?@2' @ &  6!6 6!쀢 2* 2 @ 46!쀠 `?&&!@  㿐  `"" @ $ "  I   B @L@   6 " =  @\ /'`?2  2  @/ 2*?  @N`?2     @  ?`?@   "`? "  $" 㿐@ @ @ " @@`"g@ ,@   @ "ް ` ?2 ? =@ !?&! 2"- 2 `@@  ! "!2! @e&!@͔  @W @ 2 @! "!2`! &!@@`2@ y@4 @ "y @ i`e ,@   @ "c   A@ !?&! 2""- 2 `@@  @ @^ `!"!2`2!  &!@ݔ @E 2@  ?@ !"!2`! &!@"`2@  @%&@`?㿐 @ 2z x? 2  @n`?  @P 2&` @ 2M" `?2  2 @S <?0L@w H ? 2 @ ئ ` ?2  @" ?#@Ӕ?"%    4 @  " `?2  @D  @<  ?@7 ?@ ?㿘?r# @  ` - @  @  ?"u`?2  2@@   4`!ڐ 4`H$` @ 2q?@ - "D!i?`` @$ @75`?@4`*2  ?#  2*`2  `?2 "?* `+ 2  *2*` `?4`@  @! ,@&! 2@  @   @  ?@6  @ ƒ  㿘 (@   @  .@r 2m?.@  `` @ k` ?"^?` " @@` @ _@ ?2@P?`@ ` &@ @6@6*?#2@   3*`2   ?2 "?* `+`2   *3*`  @?6 ( @ @2    2  ?6  㿈  ` ,`" `  `  #\'7 @( 2 7'@ 2 ` W,`?2 ?7'@  ` C,`2`"@ + %' 2`7@n 2 `" @  ?2 ?2('`"$'@  /?'7@M 2 ` ,`@   $@4`@ ~ '7 `#\  @  `  ,`㿘``"`@ ̔  `"@ X ``" @  2`? "@ G  <\<\\<\ dXddXdܝ㿈 ``"@@ ) $`` *` € `( @@&  "`? @b#\a@0ab  @ @ 0$`㿐`] *` €     "`L?@F    @ @ . "7??2  "  "&@)6` @  %   * @  @  @  "??2 `" &@?2 ?6` 㿐  `  @WS @   D "" `D6` ` ` *?2`2 @5  @ \  @ ” " &6`   `,`&@` 6`` ? @ > 2 @  2??2 ?6`&@ 㿐@ 2~ "[" 2s' '@   @  ' ' 7  2&  +@ @   @ Z 2$@2D? @  >??2 4  4 @ @ @ Ȕ  !& ?2 @2 @  `2 @  2$?4  & &㿘  " (}& &  (&   . (6 㿘 ,&! @  2& l  2`*`    , 2 @6 @,   "@!&P, `?, 2   +" 2$&-`    @Y 20 4 ?2 @2&  @# 2 &6  , 2!,2"!2`! &!   @ 㿐 @ ~` ' 7@Ô  @  0 @   & & & 㿐 @ Z` '  ?2 ?7@  @ ٰ 0 @ Ԕ  & & & 㿘@`* @\7    @? 2n?$`2" @@ a   "T?&& @2&& && "B  `   @` 4?0@`2 " @"$  `  (@ $  [ 2'@?  '`@`  @2  ' @'  ' 㿐    2    * @  2   * @    ' '   !@!̀ "!?'!€ `8 @  " ` `` @ @    ``@㿘` `@ǔ $ @& ?2" ?$ "" 2?" ( @@"! 0" 2?@?"?p `` @ $` 2 @ |  t 2 €??"k?  @% @2c?$ '' "آ   24$$~䀢 G   "$$  ? '' ` '   $$?  @$Ē  ? @Ȕ  ? *@$  ?㿘 ``@@ $`@0 ?"+?@ @?2`$? "a$` $`a "a$a$aaȀ "a$a$aaÐ/  ?㿘  ``@͔ $ `  "`?" `  `@? ?@ " ?$" 㿀 @ L" !ؐ!b!Ԕ " ?'''' @0ې@  ?㿘T    "`+?` @$K `" @  &? " 0P  0` @@"$ 0G $ 0 D "$ @$ D$ 4 $ 㿘    ? ɚ @2 ؒ 㿘  `@6 $  @`2"  "`)?@ " )" !€ @p  ? @2 "   @@0@$ 㿐̀ Ȁ  `2B?$$'3'Ƞ `? "`@@  "@?2,?2,` @1@ ̀?*   !$ 㿐bK ba#a̐@ 9?D?2.a̤!!a$à &G  ~ $a. a`? "`@aa@  "@?׀aȀ?&''`Ő?*aȀ b  !$b 㿐bà aȀ  :`2 b6?b  !1$b $a$aab'b'b$b b a* 2" b@0 @ Ѡ  ဦ$b 㿐bb  b%b*'b  !$b   2 &'@Ж  ? ߰ $b ߴxߔߴߴ㿈  `"" @ $ " "-" "*8T !̀ :!Ȁ k `?"$!$!@.!!" "@0|" !'"''' ("<. € (    $!"@"  @ "@  " R   "`M? 5" )2 "!€???" %" "" '" '"'@0& " "'@( #?"`" "@  "$ $"  $"  @; xa @Ԕ䀢?/ ?' ' b@  @I  "b@@?2 @@ٔ J?     ?`"@ @. 2 #\@0 3b /$b. * 2`2   .  "*@-  .   4 "@4  2    $  * @-b b$b @$b@ 㿘  `@ $  $ @`" "@@% (  " 2 $ @  $?$ $ "` ? "  @$" 㿘@ 2@?`@ @9  @4 㿘`. @   " @& ?2I?`` @& @-]. ``@ " @: ?6`?* c2  @ 3@*`2  ``? ? @" : ?* `+ 2 ` *3@*` `` 6`b?$b㿘@  ? ?$  @`$㿘  @ 㿘  d`@  $ 2 0   " @4 G?"  @ k @? $  ?4 $   4 ` @@" <l  <$ 0 $  8 &$  2 @֐ @ h"t  $  $  ?Ȑ*@$  4 2 @ 4 4 $  4444؝㿘  `"@H $ `. (*` €@% (" ( #  $    ( " "  $?2"G " )2"!€??<?"  "`5?" " )2 "!€ $" ـ8 @P   ( , ($ $@"   @@0@$ 㿘'L!Ā !  ƒ `; &!&!!L@,  &!& "@ @`* @   !@3!̀ 2.?&!" @"#!̲ @ !Ȁ V`2&!? &!!Ȓ@+' !'''  㿐@+ ` @+& :! $ [`$?&'!?@' @ 8@+@? "@`' 㿐` !@?@@j %? $$ $ $ 4 @4  @+\ $@ &ۦ@  㿐@+A `@+=  @` 2` ? "!@   ? @N "'`'@ @ 㿘&`!Ԓ&`"  @&!@&" 㿘!Ԁ`@'   !&@" `$" $!@ 㿘 ,&!  @  J  $@& 6 m   ?2  !*`2 @`*+@   @( !2 !&! В*2 ?@    ?*2 ?@    # @[ @V  ' ,` *`  ? *`   #  @< !?&! ` @@ ߀$ 8 # <    "`  @*$(  &&   ""  &$ &$&$&$"$$"$"$ 㿘$? #ߒ`@Ő!x@(@. , $ &$@"&@" &$   *   * "" 2 "" "" " @2 &" & 㿘  *  䀢@ ""`@ "@@ & "`  @"@"`{  㿘@O ?`  *  @ `"`"` ,@"@$`$@` 2@"`" "@`@` & "` ` @`"`$` $` @2 &" &  ` `T,`&"@@ 2$I @* $`@$  ?  `@+   "`$` ,`` `  `*  ,`  $@$`` 2 "`" "@$` $` @2 &" & $"`$$``` `*` *` 㿘 @ & "`  @ &"`ǐ 2 㿘   @f?2  ? 2 s$  ?㿘dd @*;d@"7d  2/  @A?<    *  @@  ""` @ "@ @ $`"`  @ "`, $@"2 d=    d@*^ $ , d $d 㿘$ "$$$``$`@* `$@*Z$ "$ ?"`$$``` .``("   2 2  㿘'L'P'T'X@L㿐@5  8  ``  @  "` @ " 3  `!3 "Ԓc(t3 # $# ,# (#  # Jr  wa           &  "  J+b  J +    "@  4 l /  l#8*"@ J=2 l"  J JJ 2 J=ې    㿐ƒ㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘8`  "`L 2 $?  "`qL`X@   0,@# ? L X `L X`?#@  @Ē 4GA,? `L X` ``%<'+  L/2?,tg X, `Q%`8L`*Ҕ!  &@D , A, a,  `5 " x!   `'   ` `? a "L Z2c" ,  @ `ʀzŀ  x ߐ!( ?q x%   %?p    , 'l p l @&K ?2 ?. ` `.   @ ' @.  ` , , . 㿘  ``  ฐ *@? # `**ก㿘  ``   ``? *` ` `,  @ @, ` - - ,㿘  ``  พฐ (ถ   ` + *  *ด  (ค ,   ` + *  *ด  (ย +` +  *  *ธ (ด ( + *  * 㿐#\#`  @'ߚ  @'P'T`'X#?"77'P`''''@`* 4tt Ptttttt X Xt P dt          tttttttttt  Pt Ptttt Dtt`ttttttt<tttttttttt x  P P P L tt Ttd pt4tttH))))))))))))))))) )) ))))))!$ ) !t) """""""""))))))))))#$ )$ ))))"))%)))))'))())))))))))"# $ $ $ "# ))")$%&")&)'))(㿘` @&`&`&` @   ? ,$ 7''7'''''@ @J 2? @  @4 㼐@V'H'` ` 2 ` @   "`*?`   HW` HH<'$'8 ''''' '$ @2$  $< %'$'$$ $$@ '耢 'y ޤ ' $  '$''?/+$J@`'$?`X#*` €O+ $ /+ $ L ?Ѐ 8, L** ?Г:`  L $ 8  '8H8@8 .' '$.' $ '  +/+$J  *>'$L ? 8, L** ?Г:`  L $ 8  '8H8@_8 .'$.?&i?h$?Ѐ  , * $?РJ@`?Ѐ '$ $?&U?T?M  , * $?РJ?Ѐ '$ $2A'8 9'8H8@2$/ - @$J l2( '$$ 8`@.@/@   ''8 @ `.@*  : `.@:  6q  -/+`k ? g   G  "  8`.@''ȴ?`".@''ȴ?@ ! ߐ -/+ߦ!x @ ߦ! ,#`!#\7@0 g G00?@$ g g E e e f'0@>' , @ ,`  O7 @  O7`  " O7 C  -@/+  8`.@ :`:  `.@ " @ 8`.@ 2`.@ "   '' 8 @ `.@  `.@  8`.@ߢa '  q x8`.@ߦ!   @ "$/+@!   'x'|x 8 @ `.@  `.@ / !ߐ!  ''X'\X  8 @ `.@  `.@   2 /+ '?`S "  7F!  4`,  `4 0 , 806 03,  @ `0,    ` `0, , 4`  ` 4  ,'@r ' ? @/@ /+ ''O+ `' '`4O+" . 3 "b( $$` '耢 'X ? b($$@ '耢 'B O+  + $$`  0/8/98 $$` '耢 ' `4" . + "b8 $$` '耢 ' e? 4$b8$$@ '耢 ' O" - + "b8 $$` '耢 'В 5? 4$b8$$@ '耢 ' ! e$$@ F BV0ߐ! $$` '耢 ' 0,@  $$` '耢 'z ߤ,?  + "b8 $$` '耢 '` Ť? 4$b8$$@^ ``,ߐ! $$` '耢 '< $$` '耢 '* 0  - + "b8 $$` '耢 ' u? 4$b8$$@ '耢 ' _$,$,@R$,$, @ '耢 'ݒ B0,"@ - + "b8 $$` '耢 '’ '? 4$b8$$@ '耢 '  ߐ! $$` 0$0 @ '耢 ' 0 ߐ! $$` '耢 'w ܤ$0," $,0" @ t , 4 R   ./8/98 $$` '耢 'J  B,$,?$, .@ ? 4 + "b8 $$` '耢 ' ? 4$b8$$@$$` '耢 ' f$ $  @ '耢 ' R 1" , 3 "b( $$` '耢 'В 5? 4$b($$`'耢`' !8 &  ' 耢  8' 耢  8'8`@"` / ` @?  ?`/*`d * d *`d * d*`d*d* N%2   N `X!8*` €N ?` %L* @ L*`ДЀ @LN*6 N ?`  L* @ L*`ДЀ @L $@  @ d@`d *@`@4 d@`d *@`@4NЀ NЀ   +  * ?И NЀ  $ @ `@d@Ȓ`d *@`@4qpN `@d@`d *@`@4_^N@d@`d *@`@4ONN@`@d@`d *@`@4>=N@d@`d *@`@40/N`@d@v`d *@`@4N@d@h`d *@`@4N `@d@W`d *@`@4N@d@G`d *@`@4N@`@d@6`d *@`@4ߦN@d@(`d *@`@4ѦN `@d@`d *@`@4N@d@`d *@`@4N@`@d@`d *@`@4N@d@`d *@`@4N`@d@ؒ`d *@`@4N`@d@ɒ`d *@`@4rqN `@d@`d *@`@4`_N@d@`d *@`@4PON@`@d@`d *@`@4?>N@d@`d *@`@410N `@d@w`d *@`@4 N@d@g`d *@`@4N@`@d@V`d *@`@4N@d@H`d *@`@4N2Nԑ* & )d+ " d ` *` €`@?``@? ``@?``@?x`` $d 㿘@  * &@@*Ȓ& @  @$ &@㿀?"\ f#   e E  ! 9/ -/?#\  ?@D耤 g G f# fJ 02 @a B  '@@! B3'@   0`*@@ '`" "@ ``, -,   +,  ` @,  0.@В ` `0..   & 0. `0. &@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  OOOOOO㿘 !ĕ.  ` @ " ,, 0 "`"`"`"`   `ą("@ 㿘? #  @ @@4`4  *  $ 2  ,   * @& ː, " & 㿘 @  *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c@ @  @4`4 444 4  $@? #@ 4 4@4 @   4 $@  $'  "' 㿘`  ""L*  >``#! "```"q$" $@ 2^$@"`" >`U>``2@㿘>` @ *@  Z `  " * ` " * " 2@ ` "`" & C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  8 4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?` " *`"  * #??ā`@:'H "c @@ `  H  ' ` @ `2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : *'     -*   ?4`+  *  ?Ъ`M@ /9뀥 :E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*`%@ "@" 2     `H &@  '#PB?  ߐ?b@* @ $'%H #PBD? >'@ 2:%`"_H%`  ߐ"@.` ?$%% B"@ $%ߒb@*@?$&@ .`% B@?$% B ߐ"@*` ?$% ?*%@P ߐ"@* ?$% B?4$ : ""  ""`䀢 H  ߒ + @?$% B?: + ?,$ ?%( B?   "$(#a?_]  ߐ"@* ?$% ?K:4ߘ ߔc  + ?$% B?: + c @?"ߋ##H D(?)F!?()BD F?#H  ""`䀢`|H 2?@?r  2'''m  0[5 # @  I ?   ? ?2@ :?8 ?߁ ?#H! B0& #X!+'߀ c`&1'? ߀"#`!ch#`cp#pB'cpB &'??@?Ѐ B- %?,??? @'cD?   #" "D?#` cpB B?d?? @D?   F#' €?#x c 0# ``` *@ M` ܒ `       $@  ?3 6" @   4`% & $@    2`&  u & V  ?H 2"?"쀢 #㿘 t -    `@¤ `1?#  @a @@]4`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' h !'L'P'T ? ! *@  "" "!Ȁ`6'@ '@ * '  T#"@̀ ?##\ N    \"㰁 B T "\߀ְc "  3ȓ2g Ⱥ| ?* &' $2`   @Ȓ"@̐$* 2@ ̐"*@' #B?{͔ ? '?##'߉ FcJHBH ' B# 'ߐ"@, $ȇ%)'#?    '% 'L 8'LL` 'L L "' #x* €?'? 'P'P`P 'PP' 'P '쀧`   ` "!  ,  `" "! ` Ⱥ  ' ߐ b@* @<"  #Ƞ #  ?Ȁ ߒ" /`@ &' B<  `ȅ!?Ȳߐ`b@* @>`$Ȁ %B?ߒ"  /`@ $ȇ%B?ȡ<  `耢 c 9' 쀢 c艡 B ?'߅ȀF#?0D'@'&#  '$% ?ȅ)  P?䀢 Iߐb@* @`$% ȑȍB'`0-@ȍ…&' Z?ȉ"##ā) 0 @6T?#ȑ DDB?ȅ'`0.Ȱ …&' 8?ȅƁ)} 0`@4?Ȑ* b@@ $߇% B#Ȁ@B'`0.Ȱ ? D-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZXߐ"@, "P #    c Bȁ  1-@ Ȁ@ȍB'`0 H.Ȱ  ?ȉ"#B  ?ȅ$%H` 0?N 92?-@ . #艡 B?#D`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢``  <  x L̀ 2'?@2 '   ''  *`x  "@ `  ` "```@p j耢`    ܔ 쀥L  Δ   1Pɤ8 1-@`Ĥ``/܀'  Ը* @     Ԁ   ' 'Ԑ  ` Ԣ 09O  -i` L` ̀ `9+ 4`f.& ``L`̀ `ɒ  4`2N.`"K.``:  9E. `9` 9., ;..@   + ` 0.@  ђ 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ 2. 0-@` .T"\2"+dd0(# "$$  "#t       $((()(*(+ (,!(-"(.#(/"$ "(  "" "` "`"(㿘` ` ` 2 @@   "`?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. z` ``&@$`$`$@$`` "`*@@y`@"@$`$@.@` @g@@@)$@ 2` `` `,` $u` ` @K`@"@$`$@`" $&`b   `  ` @ "@  `@ ` `@ @ @@@@$@ +0@ `,` 0   @`@"@$`$@2`@   `" $&` ` ? @4` 㿘  d`2 @+ 2  " "  0` @@"& 0y & 0 &   ?6 &  6   2  " @b?@   &  &   &  㿐  C & & '&@%yT    C  & 6 & &@ "`& & & @BV  2` 6 8T  &&A  &<  ؐ`?`&$&@( "&@$ L ( (#t@"$㿀. * "* x  * ?  ? #  "8"8? P? ?    ( 0 8 @ H?88888 8(80888@8H8PX㿘  d` #@Q #!   R X 2 &  ?2 2 """""""0"4"D"H㿘@ # " `Ѐ  ` "@` 2`} $㿘@ 㿘@ *"  "`d㿘T W  P > B< P ?Đ*@4 㿘 ! V  @-  ?Ē* 6 V Z㿘T   @?  2  ?Đ*@4   4 < P㿘 V 㿐 s  ??#\  ǔ@  s 㿘 2 @7     @  "`?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘 #!Ц ? T` "??`X2㿘@" jjjjjjkkk4k@kLkXkdkpk|kkkkkkkkkljjkk(l x? `}'!ؓ*` € G  B耢 ~?|z d W  7  B耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @ : ? ܀ ?  "` ? ܖؘ @ & ??܁h rʔ   @ 8@ r’ 㿘 `g"  `  ?2  Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*㿐@H 'T $ $@  T 31?T2 7耦(7耢 2: % 4`44`44`4`ؤ45 5 ȕ4'5 5  B'? 8' `@ f`@ `*  @ \@`*  @ R@ `*  @ HT  -`@T :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', @ @ '@ . 2, @ ( ?#   ?#*`/@.  ?@ k'$$66`% @"6``4@  * . ?  @26`@4@Ā2T`#@  " . @?* :@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 8 2 + ( 2@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@;`` (` `?#;```0  ?2 `2 # "  J` ? `   ?J@"J@@  " *   J@"`   `(*`  $OpenBSD: strlen.S,v 1.2 1996/08/19 08:17:59 tholo Exp $ J " 8`    "`@!ܢ  ?$a$a?$a    a   ̀@`@  ` @ N  $ " $$a !x$a aR!?!  p! 2 O@!a@2 O`?  a  €"`@ "` OX! `(@ $a@ 2V ` `D* a8` `*@ :@ *`$a@ 8   `@n$a0@j@$a0  a @ ?$a$$a4r $ !  @֐"$    ! !`cИ#bx & & & & & & & &  &`5ar$  㿘 ?@ r " ? ?   ?8 $!x` ! @$ $ $ $ $ $ 4$! $ 8$  D @Ô  Ē @ @` TQ :  @$ $ - " @ *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$   "`  $ @  㿘 4@   & @M  *  D# *#  * ,& $& `@ " ?!.`2 ? & ,& < & 0@& (@* , @4& @㿘!4@     !؀ !!ؐ?* &! r(!??&!r!!@W 2!  ! 6!!8, @ "!r ! , ! "!r! "!q!?4q  " ?㿘`  "`? "? !4  @%  2 ?@  2?&!0 㿘!4 1aa!  &&  "& @!! @Ԙ ?!? O " &!, !8 đ, ` , @ @ߘ  2?  ,  㿘  @=   " #!,?㿘  !   " #!,?  @ 㿘      @    " ",?㿐 @ @ ?P ` ` -` G`   % 2  `@ @/ G`   @X "s ``݀@ʘ +2 `'@* 2 `@: "W ``  T?` ` @ ږ F?F ` `C `! ``+00 `6 `,@  @  & "@&@  2 `@   `?@   ?0 @?? ` ?-`㿘     " $!,?!$   $!($!$$!  ! 2!$ $!( ( @ "m?$! @ "  ($!$?$!$_ !(*  `2@ *@ @ $! $!(`  @ `!$$!  $!$"! @ "! !**`     @3  *?0)! ` @ @ &@@ ? " &`! ( 2  @& *@ 2" &@  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @ؒ !ؓ,` "  ?!! `&!&! (@    D*` + "&  ,  & ,& 0@ e㿘o  @&@ o$㿘! € , (  0㿘 @   &!  @.@   !  J$ ?6  + +* !ؐ@" ! `&! @(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?@ <  ,$ ! " "@!&& $! "㿘! ! ` "`n?     @`n7 $`nV  @T ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` @ r 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     @ 6 21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   @ ؘ 2?`"  "  @ m  " m"!2  @"``"` *` @`"!"`!"@! ` p\H4  `7 ``20$(* * * * * * * * ؔ   (  㿐  h?'  *  $aĀ   `     ` @"Kh  @  *Ɛ Kh @ 㿘@ $!Ԁ`  h``? ` ,  "??, @hF`2`)ʐ㿐  h@`     6  @   6? 2& ! $!Ԁ lw l$!#\   @M??h 2$  $ $ h2 $ $$h  * "  $ @c  ? 㿐  h@<`6 0`    ! $!Ԁ l0 lR$!#\   @??2  $ $ $$h@(  $ @  㿈  h` h   '?   @ ? h? h ,8DLTx\hhhhhhhhpx㿘 @ޔU  N `2J    < ; <"c@= <9    1 ",  ?`#& ȓ*` €#?###    (",&  &  "`?Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*㿈'XX#d#h#\#` @ Łx  ??''쀢'  "` ?  l *@ @  ' ؀ ?؁㿘  ` ?@  "`  @jֲ @ @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $OpenBSD: umul.S,v 1.2 1996/08/19 08:17:46 tholo Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@(" @ ` ?  2  㿐#\#`  @/  $x b@$u b@$Ą b@$2 b@$1 b@$K b@$Ƅ b@㿘/ "  `-+M  M0 M x XM 0  >?3? ?В?   ( 5 ! @ @    ""`?? ?Ԓ<@ B       Ӧ ̦ ``` '@$ʄ b@$J b@x@\ 7ޤޠ@+ ޠ@ ?  ޒ"@6 * 2     & , 8@ & $ , *%@ Y,  @ ?ϔ V@:?`,Bἔ + W  7  "  "  0= 9 ; 07   5 ?   `( ?  *   2`*`2  (" ` ? ? @ @ ` '' '@'` ?:    ?  "   @q @   * ޓ2   * "@ *    6   "  "  0 @ e0 ޔ"6 *`3 ޒ*  g}$  ޔ"6 *`2 ހ`*  & &  $   ,  E `[` @ݐ?`0Sހ ? * @      @` @ؐ$@$  ޔ"6 *6 ޓ*`@ &,$  ? * @      @` `?2 $@$  ޔ"6 *`6  * 2`&  $ r`"@ 2 @Ӓ?@?҉ ҅ ἀ?$ἠ  u  q0l h  c? _㿐Е a  4`$@4``$`@$`` $` ```?2 @  &`4`7&&Cfؠ 2* 8   ` @`$` @ ``$ $ 4 4 $  } 2@f &  @Ɩؐ>"fא&&㿐+ &   $@$@$`$ $ $`4 4`!ڒ4 4``  $ $` @&&㿘!ڐ?6`6`*  2 `@?2 @$$ `6`6`*` 2` @ ?2 @$ $ ` 6` `&` ѓ  㿘!ڐ?* 6`6`2`&@ @ &.`  ' 6  ` " 6`6` * 2 &@@&.   `"`  @C?2`  ? ` ?" *2 @ 6`6`&`   ? 6`&` =  x`!ڐ?2 7'T*`* 2`'X2`     -'7  ''`'-`2 2` X6  "-  -0*  -0$2 @ @ `  2 @ @ ` `  ? `-2  @   2  @ @   ?-`2 7   /`2   :/*`2 -2`@ $* "6 2  'ܐܒ`@*`2     -`-2  `-` 2  @6    - @@-`-2 @ `22@:# # "2-`- <#T@"2@ *H`--@2 <``  "*  *0  *0@ @ `  @ @ `   ?*  @ @ @ `  -`"2`64 u*` `-`2 -@6 6㿘 υ     "   ?` (0 `*`0`@*`0  㿘,` ``$, @2 `+,`2`6 $, 2  `,`2`,``2 6**`@6$ 2`2`㿘`. `@C"?. "  ,"* *`@`2 `" @ @4.`22@22*   @4 248?$8``.`㿈      2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'x2%* "@ , 2 $ @ r@ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@# 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`ז c  @W   l  i,`,`2  ' %@ '`' `# '`2#  * @  `@  @Ӑ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ܒ 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?$ "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  Ҕ`@5 "`?@˔`  .` 8` & 8 (&` 4 $ ?㿘 4@@ `2  & 4 & 4``@Z.`,`2 `  &` ` *`*2*  2224`㿐!  6@  ?6` {6`  < ?*  D@  3 *  <  ' ?*  D @ @> ~? J?  O"`B?6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.@.`@  `@?7 .@.`` 㿐!? @ 2i?  ဢ@,! "@ :  $'++ + +   `@`7 **  <] ?*  D@  4 *  <  'L ?*  D @ @> w?   O"`?㿘a% !!<   , &! ? " 9?* $ ĕ.2 !8.`" $      (㿘 D, `$* : ?: 1 8. @ @[ À2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$ % *` ,$   ?$   * ?2%``m, Z  2l ` g $Z% * ,$  , ?$  :** %  * @% , ;W  :**$   * @%  +*` $ ?%$  D D .  4  ?* D@$@ g. .  6 a( A 1  "` 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @s  :**$   * *# 㻐T ̓!`!h!x$j?' ̐?&!5<!    ! ?㿘,``$4, @2 `!`$ 6, 2 64`4`` *`$ @2`* 2 㿘!@6 _x .`!8$ .`     @  2_  ?*@    2@* *@ 㿘`*  m* 2 *`*  4`$ , 2   +  +  42*`4$ 2+ * 2 4 `|%0+   &@2 @ ,$@,`4 2 t4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2 5 +  +  42*`4$@ 2@*  2 +  4 9 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2`Ŗ I`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`  8 ?$ 8㿘`,  " * 2`@( `$*, 2 2 & a $@``" *2   **2  ?,   ??㿘 @+  ? 4 "    +  @  `+ &@  㿘`.  `2.*  ?   "s?`  .  `*  ?  ]` ?* @   2  "?ܖ -,`D?  &" !&  * !$  &!(&!$&!  ? (&!  &!(`@ 2" !$&!  &!$ ,`2 @?&   ! ! & "`?㿘`   "@(`! ]A] @&!, &!( * ?q /&!  `,!$&!  &!$* \ Ĕ $?,` 2 @  ! `c@ 0 "`?㿘@  ?&! &?㿘```? * 2 "@ ` ! \\ /$!  ,%?@*  ΐ ,` 2 @  !`` @ 0 "`?㿈\'P 2d?@ P* 2`` 4 PĖ $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ 㿘 B%s: %s not compiled in instbinUsage: %s ..., where is one of: %shostnamedmesgexprmvsleep-shshkshsedmkdirmtrmmount_mfsnewfsinitfsckfsck_ffschownchgrpchmodgzcatgunzipgzipcpedhaltrebootdhclientmount_ffsftprouteinstallbootmknodumountfgrepegrepgrepmount_nfsmorelesslsifconfigcatpingcpiotarpaxdisklabellnsttysyncmountdfmount_cd9660dd0( $@@@p| @@skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd    ߰  ޸ްިޠޘunblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %s%s: short input record    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer%s: end of device%s: short write on character device%s: short write on tape device%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) A.%sskip reached end of inputp`XPH80(  updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %susage: mount_cd9660 [-egjR] [-o options] special node ,-o %s: option not supportedhiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file systemempty type list@A0?PA>Bp>C=p< 0B %5.0f%cBKMGTPE %5.1f%c@$A%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s A@Y Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s @Y df: %qd: %s usage: %s [-hiklnP] [-t type] [file | file_system ...] ffslfsext2fsunionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd,/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %s%s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemcd9660norripgensextatt) empty type list%s,%s-ousage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | nodeufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s,-o %s: option not supported xph`X PH @8 0 ( werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscardrprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOP  #3#32x3p3h#`@X@P@H@@80 -mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5xp h `@X@PH@80(   -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk( xph`@P@H@8@0    ؀@@  C$CC$Cp`P@80-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig@ . ..CMAKEDEVDconsoleEklogc Fbpf0c G ttyHnullc Izeroc Jstdinc Kstdout Lstderr M memNkmemc Oksymsc Pdrumc Qeeprom RopenpromXSfd0ac Tfd0bc Ufd0cc Vrfd0ac Wrfd0bc Xrfd0cc Ysd0ac Zrsd0ac [sd0bc \rsd0bc ]sd0cc ^rsd0cc _sd0dc `rsd0dc asd0ec brsd0ec csd0fc drsd0fc esd0gc frsd0gc gsd0hc hrsd0hc isd0ic jrsd0ic ksd0jc lrsd0jc msd0kc nrsd0kc osd0lc prsd0lc qsd0mc rrsd0mc ssd0nc trsd0nc usd0oc vrsd0oc wsd0pc xrsd0pc ysd1ac zrsd1ac {sd1bc |rsd1bc }sd1cc ~rsd1cc sd1dc rsd1dc A . ..termcapB ...@ . ..CMAKEDEVDconsoleEklogc Fbpf0c G ttyHnullc Izeroc Jstdinc Kstdout Lstderr M memNkmemc Oksymsc Pdrumc Qeeprom RopenpromXSfd0ac Tfd0bc Ufd0cc Vrfd0ac Wrfd0bc Xrfd0cc Ysd0ac Zrsd0ac [sd0bc \rsd0bc ]sd0cc ^rsd0cc _sd0dc `rsd0dc asd0ec brsd0ec csd0fc drsd0fc esd0gc frsd0gc gsd0hc hrsd0hc isd0ic jrsd0ic ksd0jc lrsd0jc msd0kc nrsd0kc osd0lc prsd0lc qsd0mc rrsd0mc ssd0nc trsd0nc usd0oc vrsd0oc wsd0pc xrsd0pc ysd1ac zrsd1ac {sd1bc |rsd1bc }sd1cc ~rsd1cc sd1dc rsd1dc sd1ec rsd1ec sd1fc rsd1fc sd1gc rsd1gc sd1hc rsd1hc sd1ic rsd1ic sd1jc rsd1jc sd1kc rsd1kc sd1lc rsd1lc sd1mc rsd1mc sd1nc rsd1nc sd1oc rsd1oc sd1pc rsd1pc sd2ac rsd2ac sd2bc rsd2bc sd2cc rsd2cc sd2dc rsd2dc sd2ec rsd2ec sd2fc rsd2fc sd2gc rsd2gc sd2hc rsd2hc sd2ic rsd2ic sd2jc rsd2jc sd2kc rsd2kc sd2lc rsd2lc sd2mc rsd2mc sd2nc rsd2nc sd2oc rsd2oc sd2pc rsd2pc rd0ac rrd0ac rd0cc rrd0cc cd0ac rcd0ac cd0cc rcd0cc random srandomurandomprandomarandom#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc() { arg1="$1" arg2="$2" case $3 in l) echo ${arg2#$arg1} ;; r|*) echo ${arg1#$arg2} ;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root.operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7.$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std random bpf0 R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M drum c 7 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 640 kmem ;; systrace) M systrace c 50 0 644 ;; ses*) M ses$U c 124 $U 640 operator ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; xfs*) M xfs$U c 51 $U 600 ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; tun*) M tun$U c 111 $U 600 ;; lkm) M lkm c 112 0 640 kmem ;; altq) RMlist="mkdir -p altq;$RMlist" for d in altq cbq wfq afm fifoq red rio localq hfsc cdnr blue priq; do M altq/$d c 125 $U 644 U=$(($U+1)) done ;; pf*) M pf c 59 0 600 ;; bpf*) M bpf$U c 105 $U 600 ;; openprom) M openprom c 70 0 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; wsmouse*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd*) M wskbd$U c 79 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 78 $(( 16#$U + $m )) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ttyFcfg ttyF0 ttyF1 R ttyF2 ttyF3 ttyF4 ttyF5 ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb R ttyEcfg ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 R ttyE8 ttyE9 ttyEa ttyEb ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 R ttyD4 ttyD5 ttyD6 ttyD7 ttyD8 ttyD9 ttyDa ttyDb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A tbl p q r s t u v w x y z P Q R S T name=${tbl[$U]} n=0 while [ $n -lt 16 ] do nam=$name$(hex $n) off=$(($U*16)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 128 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; ss*) M ss$U c 121 $(($U*16)) 640 operator M nss$U c 121 $(($(($U*16))+1)) 640 operator M enss$U c 121 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 120 $U 640 operator ;; ch*) M ch$U c 19 $U 660 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; local) test -s $T.local && sh $T.local ;; all) R cuaa cuab cuac cuad ttya ttyb ttyc ttyd ccd0 ccd1 ccd2 ccd3 R vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 cd0 cd1 rd0 xy0 xy1 R xy2 xy3 tun0 tun1 tun2 tun3 bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 R bpf6 bpf7 bpf8 bpf9 pty0 pty1 pty2 fd1 fd1B fd1C fd1D fd1E R fd1F fd1G fd1H fd0 fd0B fd0C fd0D fd0E fd0F fd0G fd0H xfs0 R ss0 ss1 ch0 ses0 wscons audio0 uk0 random lkm pf altq R systrace xd0 xd1 xd2 xd3 raid0 raid1 raid2 raid3 std st0 st1 R fd ;; xd*|xy*|sd*|raid*|ccd*) case $i in xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" if [ "$os" = "SunOS" ]; then eo=transform transform() { case $mode in 600) mask=077;; 640) mask=027;; 660) mask=007;; 644) mask=022;; 666) mask=0;; 440) mask=227;; esac echo `echo "$@"|sed \ 's/mknod -m \([0-9]*\) /umask '$mask';mknod /;s/-m [0-9]* //g;\ s/operator/5/g;s/root.kmem/root.2/g;s/root\./root:/g'` } fi list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" -o "$eo" = "transform" ]; then $eo "$list" else echo "$list" | sh fi  (=   @=׍{Y( @@=@@<@`dT U=@@?(0pLl @A =e=8ـ=8ـ EA=2='c='c o3A=3%=3%=3% jb=9=C=Ct!=$[܀=$[܀=$[܀!=% =% =% ܵn!='V='V='ViF\4!=) =) =) *!=*Q=*Q=*Q_w!=,=,=, !=-D=-D=-D8!=/q=/q=/qĕ+!=05=05=05!=2b=2b= ]Y!=3%=3%= iu!=5=5= z !=6=6=Np!=8ـ=8ـ=N aǘ!=9=9=NFIa===߀bTa=À=À=߀na===߀!=Ĵ=Ĵ=߀6!===߀6>]!===߀6<a= h= h=f=\!= = =Ca= X= X=fE`i!= = =Cr.a=I=I=fÄ!=I =I =CGW?a=z9=z9=fmi!=C=C=C^ۂea=u*=u*=fݝ!=>=>=C6a===CmwN!=9=9=CkF-a===Ca!=e=e=CAya===C[ != U= U=C0 a=!=!=CB=!=#F=#F=C]Sa=% =% =C 'S!=&6=&6=C h]a=(=(=C 䅢!=)'=)'=C ra=+=+=C =;{!=-L=-L=C ʁqa=.}=.}=C 6!=0G=0G=C \a=1xˀ=1xˀ=C !=3B=3B=C tLa=5 R=5 R=CG!=6==6==C9b΍a=8C=8C=C^*&!=9=9=Ciia=;3=;3= zA!=1-=1-=W a===  !=,=,=WUa=== u[!===Wp}a=р=р= F!-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho  xph@`@XPH@80-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostoposttablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s %s: %s %s %s%d-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.8 2002/07/04 04:26:40 deraadt Exp $Ffhns.%s%s: is a directory%s/%susage: %s [-fhns] file1 file2 ln [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.75 2002/06/09 08:13:05 todd Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOBootstrap doesn't leave room for disk label\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u: %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %uA# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffsetw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) No changes.re-edit the label? [y]: sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %ssector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d usage: disklabel [-nv] [-r|-cd] [-t] disk%s (read) disklabel [-nv] [-r|-cd] -e disk%s (edit) disklabel [-nv] [-r|-cd] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. partition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and sizepartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffsetpartition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk %s: [%s] %s: [%u] Rounding to nearest cylinder: %u AA? Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.failed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd+++(++,,,,, ,(, 0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: p [unit] - print label. M - show entire OpenBSD man page for disklabel. e - edit drive parameters. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. d [part] - delete partition. D - set label to default. g [d|b] - Use [d]isk or [b]ios geometry. m [part] - modify existing partition. n [part] - set the mount point for a partition. r - recalculate free space. u - undo last change. s [path] - save label to file. w - write label to disk. q - quit and save changes. x - exit without saving changes. X - toggle expert mode. z - zero out partition table. ? [cmnd] - this message or command specific help.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help./dev/%s%s%s%c %s %s rw 1 %d Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' Can't stat deviceioctl DIOCGDINFO[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Foward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again could not pipecould not fork-c-dccould not execCannot chdir to %sCan't fchdir to starting directoryUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%luTRAILER!!!Cpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sUnable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => %s%s %s %s: unknown option %c %s: %c argument missing ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578write_opt=nodirUnable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-I-rUnable to open file '%s' for readProblem with file '%s'-CTAPE/%sabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistantRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s .Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handlerUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to create temporary file for directory times: %sUnable to store mode and times for directory: %sUnable to store mode and times for created directory: %sUnable to set mode and times for created directoriesustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s/dev/ttywrFatal error, cannot open %s%s: <%s>socketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfromA??zG{A.ping: sendtoping: wrote %s %d chars, ret=%d packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%d%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host benstuvusage: %s [-benstuv] [-] [file ...] stdoutstdin-r%s%6d buffer@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.69 2002/07/08 00:48:54 deraadt Exp $`'X'H'l8'l0'(' ''&&&&h*+/00222&&xGp(`(P(@(8(0(() _`Pcc4RRRR7Rde@f$$&,'x'p 'h'`@'X'P8`@809@ 99$@'instinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0deletetunneltunnelgiftunnel-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangeeui64vltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-nwkeynwkeynwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupDXYT i@i'<'M`\L]T ixi'`'xMx_ i@i''pOal i@i'<'hRa i@i'<'`V0b0iti'@'isoipxnsatalkinet6inet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRsocketSIOCGIFFLAGSSIOCGIFMETRICgetifaddrs%s: no such interface error in parsing address string: %ssource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRSIOCDIFPHYADDRNote: trailers are no longer sent, but always received SIOCSIFFLAGSinvalid %s%s not allowed for the AFinterface index is already filledcould not determine link local address%s: invalid metricSIOCSIFMETRIC%s: invalid mtuSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xSIOCS80211NWIDpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYSIOCG80211POWERSIOCS80211POWER nwid nwkey %d: powersave on (%dms sleep) offSGIOCGIFMEDIA%s: no link type?SIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mediaopt' commandsonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s  @@`IEEE802.11FDDItokenTokenRingetherEtherneth`XP#H#8#0#($ $$$%%%%&&''(())x*h*`+P+H,8,0,(---..//0011CCDDxEhE`FPFHc8c0d de0eDS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect   @@@@@x@p```XPH@0ibss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sstrdupunknown %s media option: %s%s %s%smedia %smediaopt instance %d6 physical address inet%s %s --> %s  `@no networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu address: %s %s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime SIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%d ns %s ipx %s SNAPframe %s SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISO%s: bad value%s=%o%s=%x%s: %sAppleTalk does not use netmasks%u.%u%s: illegal address%hu-%hu%s: illegal net range: %u-%u12%s: illegal phase atalk %d.%d range %d-%d phase %d AppleTalk address is not in rangeAttempt to set XNS netmask will be ineffectual Attempt to set IPX netmask will be ineffectual negative NSEL length is absurdsetting NSEL length valid only for isousage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [ media media_type ] [ mediaopt media_option ] [ metric n ] [ mtu n ] [ nwid network_id ] [ nwkey network_key | -nwkey ] [ powersave | -powersave ] [ powersavesleep duration ] [ [af] tunnel srcaddress dstaddress ] [ deletetunnel ] [ vlan n vlandev interface ] [ arp | -arp ] [ anycast | -anycast ] [ deprecated | -deprecated ] [ tentative | -tentative ] [ pltime n ] [ vltime n ] [ eui64 ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] vlan: %d parent interface: %s SIOCGETVLANSIOCSETVLANmust specify both vlan tag and device%dd%dh%dm%ds%luCOLUMNS1ACFLRSTWacdfgiklmnopqrstux %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%qutotal %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd total %llu %s%s/%s ls: %s: %s -> usage: %s [-1ACFLRSTWacdfiklmnopqrstux] [file ...] more-E-m-GMORELESS--help-?--version-V--VISUALEDITORviLESSEDIT%E ?lm+%lm. %fNo filenames allowed with -t optionCannot allocate memory/dev/ttyWARNING: terminal cannot %sLINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwardsNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorWaiting for datach_ungetchar overrunFinishing logfileWarning: log file is incompleteCannot allocate %d buffersseek error to 08bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256invalid charset name*s<%X>LESSBINFMTLESSCHARSETLESSCHARDEF%cESC^%c?@*!/?!done|done[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]less version %sungetcc overflowPattern not found:%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabled.lessCannot use lesskey file "%s"-%s"%s" may be a binary file. See it anyway? Missing filename ("less -\?" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"%s/%sHOMELESSHELP/usr/share/misc/more.help%s*SHELL%s -c "%s"recho %sLESSOPEN-LESSCLOSE...skipping... Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of helpCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %dDetermining length of fileDon't know length of fileCannot seek to that file position%6d~ Calculating line numbers! /dev/ttySHELL%s -c "%s"shCannot seek to start positionwCannot create pipeInvalid mark letterCannot seek to end of fileMark not setMark not in current fileInput is not a pipeLog file is already in useNo log fileLog file "%s"Line number is required after -lCannot use lesskey file "%s"Tags file "%s"/%sUse "h" for helpThere is no %s flag ("less -\?" for help)There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag-%sString is required after %sNumber is required after %sScroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screen%s: %s%qd%d-No previous regular expressionInvalid patternNothing to searchLine numbers turned offtagsrNo tags fileNo such tag in tags fileTag not found/dev/ttyŰŠŘŐňŀxph` XPH@0( @ @noacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsport=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernel%sno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2/can't access %s: %susage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node,-o %s: option not supportedDEFRHLPXabce:f:hilnqsvwxzusage: %s [-E|-F] [-abchilnqsvwx] [-RXH[-L|-P]] {patt | -e patt | -f patt_file} [files] arg_patt("%s") adding pattern "", length %lu too many, exiting ... mallocreallocr%sfts_open%s: %s%s (standard input)%s:%d:%lu:%d aFfh:t:vonly one -t option may be specified.nfs/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCgetmntinfoempty type listusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]mkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrapnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x %s: devread: lseek%s: devread: readstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect blockroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. route: %s: %s nqdtv/dev/nullsocketmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done defaultinvalidiso %s(%d) %saf %d: %s0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 64128Internal Error%s: bad value %s: resolved to multiple values route: %s: bad value prefixlen is not supported with af %d *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%s*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sactual retrieval of interface tablegot message of size %d on %suwriting to routing socketroute: read from routing socket: %s RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %ld, seq %d, errno %d, flags: route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; $OpenBSD: show.c,v 1.21 2002/02/16 21:27:37 millert Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables %-*.*s %-*.*s %-6.6s DestinationGatewayFlags%-6.6s InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files Continue withmput%s: not foundr+wwusage: %s remote-file [ local-file ] local: %sRETRremote-filesusage: %s remote-files mgetonoffConnected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %susage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file SHELL/bin/shsh-c%sTry again laterusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. PWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEmodefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. filenameusage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmoreCan't allocate memory for $PAGER|%s?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. Extra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %sTrying %s... socketconnect%sRequesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpRequesting %s Can't allocate memory.80GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Sending request: %sWriting HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socketconnect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s: send aborted waiting for remote to finish abort. sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout receive aborted waiting for remote to finish abort. receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dacceptSTOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. Lost control connection for abort.%cABOR ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46Aadegimno:pP:r:tvV--r requires numeric argumentRetrying... ftp> sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. !$%sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-AVadegimnptv46] [-o output] [-P port] [-r ] [host [port]] %s host:[/path/]file[/] %s ftp://[user:password@]host[:port]/file[/] %s http://host[:port]/file macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %sstringlistAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initsorry, arguments too long. (%s) TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! %s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAA.%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d A.>?P       x p h ` X P  H@ @ 8 0 ( softdepforcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %susage: mount_ffs [-o options] special node ,-o %s: option not supported/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.pid-pbinding to user-specified port %d-d-D-cf-pf-lf-q-u-1specified_interfaceInsufficient memory to %s %srecord interface%s %s2.0pl5-OpenBSDdhcpcudpcan't open and lock %s: %mNBINo broadcast interfaces found - exiting.PREINITalias_%sUsage: %s [-c1u] [-p ] [-lf lease-file] [-pf pidfile] [interface]ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected due to bogus yiaddr of 0.0.0.0.%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK from %sDHCPNAK with no active lease. No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. FAILEXPIREDHCPREQUEST on %s to %s port %dDHCPDECLINE on %s to %s port %dDHCPRELEASE on %s to %s port %dwcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environment initializationPATH=/usr/bin:/usr/sbin:/bin:/sbinscript_init:n no memory for environment initializationinterfacemediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpiryREASON=NBIfork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignment%s%s=%sCan't fork daemon: %mCan't create %s: %mCan't fdopen %s: %m%ld Invalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xoption_as_string: bad code %d \%03odhcp option too largerno memory for client state.no memory for client config.Corrupt lease file - possible data loss!hardware address parameter %snot allowed here.nested interface declaration.expecting a statement.semicolon expected.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.Insufficient memory to record interface %sno memory for state on %s no memory for config for %s no memory for lease. unterminated lease declaration.expecting lease declaration.expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.Expecting media options.parse tmpno memory for string list entry.expecting IP address.no memory for reject list!No memory for %s.dfree %s: free on null pointer.unable to allocate tree cache for %s.Can't create addrlist socketgetifaddrs faileddiscover_interfacesInsufficient memory to %s %srecord interfaceno space to remember ifp.Multiple %s %s: %s %sinterfaces match thesame subnetInterface %s matches %smultiple shared networkssame shared network%s: not foundNo subnet declaration for %s (%s).Please write a subnet declaration in your %sdhcpd.conf file for thenetwork segment to which interface %s %sis attached.Insufficient memory to record fallback interface.fallbackparse_statementNo memory for shared subnetfallback-netCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s appears to no longer be validioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %mCan't allocate timeout structure!can't allocate protocol struct for %snew_hashadd_hashCan't add %s to hash table.delete_hash_entryNo shared network for network %s (%s)Address range %s to %s, netmask %s spans %s!multiple subnetsAddress range %s to %s not on net %s/%s!new_address_rangeNo memory for address range %s-%s.No hostname for %sno memory for hostname %s.%ssubnet %s/%d conflicts with subnet %s/%dWarning: enter_leaseNo memory for lease %s Lease conflict at %scorrupt lease uid.Released lease for IP address %sAbandoning IP address %s for %d seconds: %sadd_class%s: can't allocate new groupCan't rewrite lease databaseCan't commit leases to new database: %mSubnets: Subnet %s netmask %sShared networks: %s Last Lease:%02x Lease %s%Y/%m/%d %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s packet length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02x:%02x:%02x:%02x:%02x:%02xfilename = %sserver_name = %s %s = %s%s%03x: %02xhash bucket %d:/dev/bpf%dNo bpf devices.%s%s%s Please read the README section for your operating system.Can't find free bpf: %mCan't attach interface %s to bpf device %s: %mSending on BPF/%s/%s%s%s/Can't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mListening on BPF/%s/%s%s%sfallbacksend_packet: %mattempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %mattempt to use ICMP protocol before initialization.icmp_echorequest %s: %micmp_echoreply: %mcScoption %s (%d) %s.larger than bufferMany bogus options seen in offers.Taking this offer in spite of bogusoptions - hope for the best!rejecting bogus offer.parse_option_bufferCan't allocate storage for option %s.Can't expand storage for option %s.pretty_print_option: bad code %d %s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largeDiscarding packet with invalid hlen.do_packetconsno memory for cons.tree_cachetree_host_lookupNo memory for host lookup tree node.enter_dns_hostCan't allocate space for new host.tree_constNo memory for constant data tree node.tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.tree_limittree_evaluateBad node id in tree: %d.%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookupeof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal bufferlways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class%s exiting.exiting. %s line %d: %s%s^^ %d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetsCan't create dhcp socket: %mCan't set SO_REUSEADDR option on dhcp socket: %mCan't set SO_REUSEPORT option on dhcp socket: %mCan't set SO_BROADCAST option on dhcp socket: %mCan't bind to dhcp address: %mCan't bypass auth IPsec on dhcp socket: %mCan't bypass ESP transport on dhcp socket: %mCan't bypass ESP network on dhcp socket: %mSending on Socket/%s%s%s/send_fallback: %msend_fallback: please consult README file %sregarding broadcast address.fallback_discard: %meoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-nametmerit-dumpSboot-sizeXhost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadunknown-255unknown-254unknown-253unknown-252unknown-251unknown-250unknown-249unknown-248unknown-247unknown-246unknown-245unknown-244unknown-243unknown-242unknown-241unknown-240unknown-239unknown-238unknown-237unknown-236unknown-235unknown-234unknown-233unknown-232unknown-231unknown-230unknown-229unknown-228unknown-227unknown-226unknown-225unknown-224unknown-223unknown-222unknown-221unknown-220unknown-219unknown-218unknown-217unknown-216unknown-215unknown-214unknown-213unknown-212unknown-211unknown-210unknown-209unknown-208unknown-207unknown-206unknown-205unknown-204unknown-203unknown-202unknown-201unknown-200unknown-199unknown-198unknown-197unknown-196unknown-195unknown-194unknown-193unknown-192unknown-191unknown-190unknown-189unknown-188unknown-187unknown-186unknown-185unknown-184unknown-183unknown-182unknown-181unknown-180unknown-179unknown-178unknown-177unknown-176unknown-175unknown-174unknown-173unknown-172unknown-171unknown-170unknown-169unknown-168unknown-167unknown-166unknown-165unknown-164unknown-163unknown-162unknown-161unknown-160unknown-159unknown-158unknown-157unknown-156unknown-155unknown-154unknown-153unknown-152unknown-151unknown-150unknown-149unknown-148unknown-147unknown-146unknown-145unknown-144unknown-143unknown-142unknown-141unknown-140unknown-139unknown-138unknown-137unknown-136unknown-135unknown-134unknown-133unknown-132unknown-131unknown-130unknown-129unknown-128unknown-127unknown-126unknown-125unknown-124unknown-123unknown-122unknown-121unknown-120unknown-119unknown-118unknown-117unknown-116unknown-115unknown-114unknown-113unknown-112unknown-111unknown-110unknown-109unknown-108unknown-107unknown-106unknown-105unknown-104unknown-103unknown-102unknown-101unknown-100unknown-99unknown-98unknown-97unknown-96unknown-95unknown-94unknown-93unknown-92unknown-91unknown-90unknown-89unknown-88unknown-87unknown-86unknown-85unknown-84unknown-83unknown-82unknown-81unknown-80unknown-79unknown-78unknown-77unknown-76unknown-75unknown-74unknown-73unknown-72unknown-71unknown-70unknown-69unknown-68unknown-67unknown-66unknown-65unknown-64unknown-63unknown-62unknown-61unknown-60unknown-59unknown-58unknown-57unknown-56unknown-55unknown-54unknown-53unknown-52unknown-51unknown-50unknown-49unknown-48unknown-47unknown-46unknown-45unknown-44unknown-43unknown-42unknown-41unknown-40unknown-39unknown-38unknown-37unknown-36unknown-35unknown-34unknown-33unknown-32unknown-31unknown-30unknown-29unknown-28unknown-27unknown-26unknown-25unknown-24unknown-23unknown-22unknown-21unknown-20unknown-19unknown-18unknown-17unknown-16unknown-15unknown-14unknown-13unknown-12unknown-11unknown-10unknown-9fddiunknown-7token-ringunknown-5unknown-4unknown-3unknown-2ethernetunknown-0dhcpCan't allocate dhcp option hash table.semicolon expected.filename must be a stringno memory for string %s.expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.expecting a network hardware typehardware address too longexpecting semicolon.Expecting numeric lease timecan't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.Bogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dnumeric day of week expected.numeric year expected.expected slash seperating year from month.numeric month expected.expected slash seperating month from day.numeric day of month expected.numeric hour expected.expected colon seperating hour from minute.numeric minute expected.haltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): usage: %s [-dlnpq] cannot seek temp fileout of memorycannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiter p unexpected end-of-file& no previous commandout of memoryrcannot open input filecannot close input file%lu newline inserted newline appended out of memorycannot read input filewcannot open output filecannot close output filecannot write fileunexpected end-of-filestdincannot read stdin%d \  \abfnrtv\@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid addressinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown commandno matchfilename too longout of memoryshell access restrictedno previous command invalid mark charactered.hup/ed.hup..invalid pattern delimiterno previous patternout of memoryunbalanced brackets ([])trailing backslash (\)number out of rangeno previous substitutionout of memoryno matchinfinite substitution loop out of memorynothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)utimes: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read%soverwrite %s? readlink: %sunlink: %ssymlink: %smkfifo: %smknod: %sutimes: %schown: %schflags: %slchown: %susage: %s [-R [-H | -L | -P]] [-fip] src target %s [-R [-H | -L | -P]] [-fip] src1 ... srcN directory Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. along with this program; if not, write to the Free Software You should have received a copy of the GNU General Public License GNU General Public License for more details. MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the but WITHOUT ANY WARRANTY; without even the implied warranty of This program is distributed in the hope that it will be useful, any later version. the Free Software Foundation; either version 2, or (at your option) it under the terms of the GNU General Public License as published by This program is free software; you can redistribute it and/or modify Copyright (C) 1992-1993 Jean-loup Gaillybitslzwbestfastversionverboseno-timetestsuffixrecursivesilentquietnameno-namelicenselisthelpforceuncompressdecompressstdoutto-stdoutasciiusage: %s [-%scdfhlLnN%stvV19] [-S suffix] [file ...] r file... files to (de)compress. If none given, use standard input. -9 --best compress better -1 --fast compress faster -V --version display version number -v --verbose verbose mode -t --test test compressed file integrity -S .suf --suffix .suf use suffix .suf on compressed files -r --recursive operate recursively on directories -q --quiet suppress all warnings -N --name save or restore the original name and time stamp -n --no-name do not save or restore the original name and time stamp -L --license display software license -l --list list compressed file contents -h --help give this help -f --force force overwrite of output file and compress links -d --decompress decompress -c --stdout write on standard output, keep original files unchanged%s %s (%s) 1.2.418 Aug 93%s Compilation options: %s %s DIRENTUTIMESTDC_HEADERS HAVE_UNISTD_H DYN_ALLOC .exeGZIPunguncatgzcat.gzab:cdfhH?lLmMnNqrS:tvVZ123456789%s: -S suffix too long %s: -Z not supported in this version %s: option --ascii ignored on this system %s: incorrect suffix '%s' insufficient memory%s: compressed data not %s a terminal. Use -f to force %scompression. read fromwritten todeFor help, type: %s -h stdinfstat(stdin) OK -%s: %s is a directory -- ignored %s: %s is not a directory or a regular file - ignored %s: %s has %d other link%c -- unchanged %s: %s: %s compressed to %s %s: %s OK -- replaced with %s%s: %s: warning, name truncated _z-z-gz.tgz.taz.zz.Z%s: %s: unknown suffix -- ignored .tar%s: %s already has %s suffix -- unchanged %s: %s: unknown method %d -- get newer version of gzip %s: %s is encrypted -- get newer version of gzip %s: %s is a a multi-part gzip file -- get newer version of gzip %s: %s has flags 0x%x -- get newer version of gzip %s: %s: part number %u %s: %s: extra field of %u bytes ignored corrupted input -- file name too largePK %s: %s: not in gzip format %s: %s: decompression OK, trailing garbage ignored deflalzh pack comprstoremethod crc date time compressed uncompr. ratio uncompressed_name %9lu %9lu %9ld %9ld (totals) %5s %08lx %11s %s name too shortcan't recover suffix .internal error in shorten_name%s: %s: cannot %scompress onto itself %s: %s and %s are the same file n%s: %s already exists; do you wish to overwrite (y or n)? not overwritten %s: time stamp restored %s: %s unreadable ..%s: %s/%s: pathname too long bad pack levelblock vanished-l used on binary file %s: %s: not a valid zip file %s: %s: first entry not deflated or stored -- use unzip %s: %s: encrypted file -- use unzip out of memoryinvalid compressed data--format violatedlen %ld, siz %ld invalid compressed data--length mismatchinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error%s: %s has more than one entry--rest ignored %s: %s has more than one entry -- unchanged incomplete literal tree incomplete distance tree out of memoryargc<=0 %s: %s: %s %s: %s: warning: %s%s %s: %s: unexpected end of file %2ld.%1ld%%output in compress .Z format not supported %s: %s: warning, unknown flags 0x%x %s: %s: compressed with %d bits, can only handle %d bits corrupt input.corrupt input. Use zcat to recover some data.Bad table invalid compressed data -- Huffman code > 32 bitstoo many leaves in Huffman treeinvalid compressed data--length errorPOSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_read%s: invalid user name%s: invalid group nameusage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... [owner][:group]group$OpenBSD: dir.c,v 1.13 2002/08/23 09:09:04 gluk Exp $lost+foundwrong type to dirscan %d DIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILEUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTUNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u NO SPACE LEFT IN %s (EXPANDED) EXPAND$OpenBSD: inode.c,v 1.21 2002/08/23 09:09:04 gluk Exp $DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS PARTIALLY TRUNCATED INODE I=%ublk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cachecannot increase directory listcannot find inode %d %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%u BAD STATE %d TO BLKERRCG %d: BAD MAGIC NUMBER @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.24 2002/08/23 09:09:04 gluk Exp $dfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... -%c flag requires a %s ufsffsrwrostarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** $OpenBSD: pass1.c,v 1.12 2002/08/23 09:09:04 gluk Exp $phase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %llu bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%uBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.$OpenBSD: pass1b.c,v 1.7 2002/08/23 09:09:04 gluk Exp $phase 1b, inode %d/%dDUP$OpenBSD: pass2.c,v 1.14 2002/08/23 09:09:04 gluk Exp $phase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d$OpenBSD: pass3.c,v 1.7 2002/08/23 09:09:04 gluk Exp $phase 3, directory %d/%ld$OpenBSD: pass4.c,v 1.7 2002/08/23 09:09:04 gluk Exp $phase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d$OpenBSD: pass5.c,v 1.15 2002/08/23 09:09:04 gluk Exp $phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPS%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failedRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead MAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label $OpenBSD: utilities.c,v 1.17 2002/08/23 09:09:04 gluk Exp $bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] cannot allocate buffer pool deadlocked buffer pool WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY CANNOT %s: BLK %dProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check %s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: ffs_isblockffs_clrblockffs_setblockffs_isfreeblockinit: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootsession database close: %ssession database open: %sinsert %d: %sdelete %d: %s %s%s/dev/%s %scan't parse getty for port %scan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,-o %s: option not supportedupdateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelmfs:%ldioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk label-z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s buffer malloc failed mfspreposterous size %d preposterous ntrak %d preposterous nsect %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %ld %s %ld minimum bytes per inode isMinimum bytes per inode is %ld With %d bytes per inode, minimum cylinders per group is %ld With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %ld cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %s/>Panic: cylinder group too big cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 fsinit: inode value out of range (%d). getrlimitsetrlimitseek error: %lld rdfsread error: %lld wtfswrite error: %lld isblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d COLUMNSdfiPRrW%s: %s%sfts_read%s: is a directorymallocremove %s? override %s%s%s/%s for %s? "." and ".." may not be removedusage: %s [-dfiPRrW] file ... weofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:t:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGET76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %s=%o%s=%xusage: %s [-f] device usage: %s [-f device] command [ count ] Lost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sO%s %d closeC statusS I%d %d ioctl%s: %sProtocol to remote tape server botched (code "%s").Protocol to remote tape server botched.(rmtgets got "%s").m:pinvalid file mode: %s%s/%s: %susage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.13 2002/07/09 21:31:03 deraadt Exp $unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %s123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.6 2002/02/16 21:27:52 millert Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %sr%s: %s"%s" ..."stdin$OpenBSD: misc.c,v 1.4 2002/02/19 19:39:39 millert Exp $%ssed: %lu: %s: $OpenBSD: process.c,v 1.9 2002/06/11 06:16:36 jsyn Exp $%s %s: %s%lu \%d not defined in the RErstdout: %sCOLUMNS\ \ \abfnrtv%03ofirst RE may not be emptyRE error: %sLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %sRnprsu,ne-p: %s-u: %s: %spvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=dprtUx`X-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm  `    4θ lΰ Ψ Π Θ ΐ ΀ p ` X \P H @ $bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+alias%s: bad numbernothing to shiftSugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad mask%s: %snot foundprsu,-p: %s-u: %s: %sREPLY%s%s is read onlytrap -- %s bad signal %s%s: bad value%s: cannot %s%s: can only %s %d level(s)h`-setfvShell: %8ss user %8ss system Kids: %8ss user real %8s %8ss real user %8s %8ss user sys %8s :ptime: -%s unknown optiontime: -%s requires an argument  Ҹ Ұ Ҡ TҐ ҈ Ҁ °x p ` X P H @ 8 0 (     *=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator( )(!-a-o1%s: %s%stf֨c֘dֈspl`mHn8pprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %sCOLUMNSLINESfileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'\ @ (    l  ݨ ݐ ݀ |x h ` X H `@ h0   L  @  0  ܸ ܨ Lܘ ܈ `p ` DP @ 0 ( @ |   H 8۸ ۘ ۈ (p h tX H @ (  H `     commentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionsubstituteexpand(NULL)%S%s: bad substitution%s: %sparameter null or not set%s: parameter not setfunny $() command: %s%R%s: cannot open $() input.*+?@! HOMEPWDOLDPWD%sPS4%s%scoprocess already exists%s: %s_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundEXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sH@8REPLY-rreadPS3%*d) %sdbteste_error: %s (offset %d)++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %smissing )zero divisormissing :missing ]e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %ssubstitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%d%s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX$HHhargument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumeYou have %s%s%s jobs stopped and runningjobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sremove_job: job not found (%s)no closing quote here document `%s' unclosed PS1%dPS2missing ] MAIL_%s you have mail in $_IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSIONxp`P@( whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.RANDOM$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVinclude: %dshell: %dUse `exit' to leave ksh alloc: %s0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF@a0(c eiklXmCnfbuxp`pPrH@s0h(v xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacsbgnicebraceexpandallexport%-*s %sonoffCurrent option settings set -o %so:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifier%s: bad number*+?@! %s%s-%c: unknown option: %s%s-`%c' requires argument%s'\''%-*s%*sshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: flags %xshf_read: bsize %dshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: flags %xshf_putchar: no fdshf_write: flags %xshf_write: nbytes %dshf_snprintf: buf %lx, bsize %d0123456789ABCDEF0123456789abcdef(null %s)too many <<'s too many redirections let%s: bad identifier forselect%s: invalid function name xph`X P   H @80({} newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifunexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s aliasexportreadonlytypeset||&&!() (08@]]<>Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s< <<- << >> >| > <> <&>&%s wdscan: unknown char 0x%x (carrying on)/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s$HH(      LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript out of rangebad substitution0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds if%s: destination pathname too long%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %s: %scannot rename a mount pointcan't remove %s%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times/bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fi] source target %s [-fi] source ... directory %d|&=<>+-*/%:()syntax error%snon-numeric argumentdivision by zero%d %s _msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: dmesg [-M core] [-N system] ssethostnamegethostname%s usage: %s [-s] [name-of-host] $Id: logout.c,v 1.5 2002/06/09 22:18:43 fgsch Exp $/var/run/utmpRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in label$Id: login_tty.c,v 1.4 2002/06/09 22:18:43 fgsch Exp $r%s%s%s%c/dev/%s%s%s$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $/etc/fbtabr /dev/%o%s: bad entry: %s(null):%s: %s: %m/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...$Id: logwtmp.c,v 1.5 2002/06/09 22:18:43 fgsch Exp $/var/log/wtmp$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $TERMCAP/usr/share/misc/termcapTERMPATHHOME%s/%s.termcap /usr/share/misc/termcapOOPS=A@A : xxswufsswap ,rwrqro/etc/fstabrfstab: : $OpenBSD: strtok.c,v 1.3 1999/11/09 11:19:46 art Exp $$OpenBSD: sigcompat.c,v 1.2 1996/08/19 08:19:39 tholo Exp $$OpenBSD: auth_unix.c,v 1.15 2002/01/02 23:00:10 deraadt Exp $authunix_create: out of memory auth_none.c - Fatal marshalling problem$OpenBSD: getopt.c,v 1.2 1996/08/19 08:33:32 tholo Exp $%s: illegal option -- %c %s: option requires an argument -- %c %s: $OpenBSD: bsearch.c,v 1.3 2002/02/16 21:27:24 millert Exp $$OpenBSD: readpassphrase.c,v 1.14 2002/06/28 01:43:58 millert Exp $/dev/tty ./%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrethers.byname longjmp botch. bf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpa/etc/networksr $OpenBSD: strtofflags.c,v 1.1 2000/07/19 19:26:04 mickey Exp $hXP@8(noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,$OpenBSD: swab.c,v 1.3 1998/02/10 02:19:48 deraadt Exp $$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: xdr_array.c,v 1.6 2002/08/01 01:05:24 deraadt Exp $xdr_array: out of memory $OpenBSD: rpc_commondata.c,v 1.3 1996/08/19 08:31:47 tholo Exp $$OpenBSD: strmode.c,v 1.3 1997/06/13 13:57:20 deraadt Exp $$OpenBSD: heapsort.c,v 1.3 2002/02/16 21:27:24 millert Exp $$OpenBSD: rcmd.c,v 1.44 2002/09/06 18:35:12 deraadt Exp $RSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0/etc/hosts.equivr%s/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerrcmd: address %s not listed for host %sudptcp%u$OpenBSD: rcmdsh.c,v 1.7 2002/03/12 00:05:44 millert Exp $/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver error$OpenBSD: rresvport.c,v 1.5 2000/01/26 03:43:20 deraadt Exp $$OpenBSD: setenv.c,v 1.4 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: strspn.c,v 1.2 1996/08/19 08:34:26 tholo Exp $ *** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x0%d$OpenBSD: system.c,v 1.5 2002/05/26 09:29:02 deraadt Exp $sh-c/bin/shno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error$OpenBSD: realpath.c,v 1.7 2002/05/24 21:22:37 deraadt Exp $.//...$OpenBSD: rand.c,v 1.6 1998/12/07 21:47:22 millert Exp $0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL[:<:]][:>:]]%x.0.%x%02x%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%uHOME.%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3d$OpenBSD: strtoll.c,v 1.1 2002/06/29 00:20:11 millert Exp $%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx$OpenBSD: getcap.c,v 1.20 2002/02/16 21:27:22 millert Exp $%s.dbtcr|:$OpenBSD: strcspn.c,v 1.2 1996/08/19 08:34:15 tholo Exp $$OpenBSD: random.c,v 1.9 2000/04/04 14:27:00 millert Exp $/dev/arandom$OpenBSD: ldiv.c,v 1.2 1996/08/19 08:33:35 tholo Exp $/bin/shsh-cPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shLC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/locale%s/%s/%s/%s/%s/%sCPOSIX%s/%s/%sLANGgethostby*.getanswer: asked for "%s", got "%s"-_/gethostby*.getanswer: asked for "%s %s %s", got type "%s"bf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpaip6.int/etc/hostsr %u.%u.%u.%uhosts.byaddrhosts.byname$OpenBSD: bcmp.c,v 1.4 1996/08/19 08:33:57 tholo Exp $$OpenBSD: strsignal.c,v 1.3 2002/02/16 21:27:24 millert Exp $$OpenBSD: __strsignal.c,v 1.6 2001/06/27 00:58:56 lebel Exp $libcUnknown signal: 7(7 7766666666p6`6P6@60665555555x5`5H505544User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0$OpenBSD: strcoll.c,v 1.2 1996/08/19 08:34:13 tholo Exp $$OpenBSD: strncpy.c,v 1.2 1996/08/19 08:34:22 tholo Exp $offonsecurelocalrtsctssoftcarmdmbufwindow/etc/ttysr$OpenBSD: rindex.c,v 1.3 2002/07/24 04:16:01 millert Exp $union$OpenBSD: qsort.c,v 1.7 2002/02/17 19:42:24 millert Exp $BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks%u/etc/grouprgroup.byname%ugroup.bygid: : master.passwd.bynamepasswd.byname__YP!+%umaster.passwd.byuidpasswd.byuid/etc/pwd.db/etc/spwd.db%s: %m$OpenBSD: getnetgrent.c,v 1.13 2002/07/06 03:07:41 deraadt Exp $*netgroup: %mnetgroup: db getnetgroupnetgroup.byusernetgroup.byhostnetgroup: Syntax error `%s'netgroup: Cycle in group `%s'%s.%s(%s,%s,%s) ,/etc/netgroup.db+%s: : %s %s: : %s %s: $OpenBSD: strsep.c,v 1.3 1997/08/20 04:28:14 millert Exp $$OpenBSD: yp_first.c,v 1.6 2002/07/20 01:35:34 deraadt Exp $yp_first: clnt_call$OpenBSD: xdr_ypreq_nokey.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $/etc/protocolsr $OpenBSD: killpg.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: creat.c,v 1.4 2002/02/19 19:39:36 millert Exp $?????????`?X?H?0? ??>>>>>>>x>`>P>8> >=====User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0?????????`?X?H?0? ??>>>>>>>x>`>P>8> >===== error: warning: /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits. allocation failed. malloc() has never been called. junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. page is already free. freelist is destroyed. in malloc():recursive call. out of memory. in free(): in realloc():$OpenBSD: clnt_udp.c,v 1.19 2002/09/06 18:35:12 deraadt Exp $clntudp_create: out of memory BCBCD@D8D@D8D@D8tcpudpfbfgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"/etc/hostsr# hosts.bynameipnodes.byname%s.%s%.*s.%.*sHOSTALIASESr rjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%dicmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp%s;; res options: %s;; ->>HEADER<<- opcode: %s, status: %s, id: %u; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %u, Ans: %u, Auth: %u, Addit: %u;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed . %lu %s %s ; proto %u, port %u " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %u %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) K0K(K KKANYHESIODHSCHAOSINR0R(R RRQQQQQQQQQxQpQX QPQ@ Q8Q0 Q(Q QP PPPPPPPPPxP`PXP@P8P(P PPPOOOPOOOOOOOO`OXOHO@O0O(OON NN!NN"NNhN`N@N8N(N MMMdMMeMMfMMp#MhMPKMH"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressAinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2inet6edns0?0x%lx?0 secs%d day%ss%d hour%s%d min%s%d sec%s%ld.%.2ld?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERROR  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%u.%u.%u.%u%u.%u.%u.%u%x/&fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserver%usortlistoptionsconfRES_OPTIONSenvndots:debuginet6insecure1insecure2edns0$OpenBSD: atoi.c,v 1.2 1996/08/19 08:33:24 tholo Exp $01234567890123456789abcdef0123456789ABCDEF$OpenBSD: strcasecmp.c,v 1.3 1997/08/20 04:13:57 millert Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$OpenBSD: _yp_check.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: yp_get_default_domain.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $/etc/servicesr ,/$OpenBSD: fgetln.c,v 1.3 2002/06/14 21:34:58 todd Exp $$OpenBSD: strpbrk.c,v 1.2 1996/08/19 08:34:23 tholo Exp $$OpenBSD: strtol.c,v 1.4 1996/08/19 08:33:51 tholo Exp $$OpenBSD: strtoul.c,v 1.4 1996/08/19 08:33:52 tholo Exp $syslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%ld]Error %d /dev/console /dev/log$OpenBSD: strftime.c,v 1.11 2002/06/19 14:56:28 millert Exp $aaaa`````````````````p`h`X`H`@`8`0`(` ````___________h%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%Y-+GMT../etc/localtime/usr/share/zoneinfo/mnposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d $OpenBSD: strcat.c,v 1.4 1996/08/19 08:34:10 tholo Exp $$OpenBSD: strcpy.c,v 1.4 1996/08/19 08:34:14 tholo Exp $$OpenBSD: strstr.c,v 1.2 1996/08/19 08:34:27 tholo Exp $$OpenBSD: strncmp.c,v 1.3 1996/08/19 08:34:21 tholo Exp $$OpenBSD: ypmatch_cache.c,v 1.9 2002/07/31 22:28:32 deraadt Exp $yp_match: clnt_callyp_next: clnt_call$OpenBSD: yp_bind.c,v 1.13 2002/07/20 01:35:34 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFD$OpenBSD: clnt_perror.c,v 1.15 2002/09/10 05:39:07 deraadt Exp $%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... %shhphPh8h hggggghg@g gffffRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s iiiipiPi0ihFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK$OpenBSD: strerror.c,v 1.3 2002/02/16 21:27:24 millert Exp $$OpenBSD: strlcat.c,v 1.8 2001/05/13 15:40:15 deraadt Exp $$OpenBSD: clnt_tcp.c,v 1.18 2001/09/15 13:51:00 deraadt Exp $clnttcp_create: out of memory $OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: rpc_prot.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $$OpenBSD: xdr_mem.c,v 1.8 2001/09/17 18:34:51 jason Exp $$OpenBSD: bindresvport.c,v 1.14 2002/09/06 18:35:12 deraadt Exp $$OpenBSD: pmap_getport.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $$OpenBSD: pmap_prot.c,v 1.4 2002/02/13 22:36:52 deraadt Exp $$OpenBSD: xdr_rec.c,v 1.9 2002/02/16 21:27:24 millert Exp $xdrrec_create: out of memory : $OpenBSD: __strerror.c,v 1.8 2001/12/08 20:37:32 deraadt Exp $libcUnknown error: NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC$OpenBSD: index.c,v 1.3 2002/07/24 04:16:01 millert Exp $$OpenBSD: errlist.c,v 1.6 2002/07/01 07:51:33 pjanzen Exp $wwwwwpwXw@w(wvvvvvvvhvXvHv0vuuuuuuxuhuXu@u0uutttttptPt0tsssssspsPs srrrrrprPr0rqqqqqxqPq8q(qppppppxp`pHp0poooooohoHo0Attribute not foundIPsec processing failureNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisk quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: strlcpy.c,v 1.5 2001/05/13 15:40:16 deraadt Exp $$OpenBSD: strncat.c,v 1.2 1996/08/19 08:34:21 tholo Exp $$OpenBSD: strcmp.c,v 1.3 1996/08/19 08:34:12 tholo Exp $$OpenBSD: xdr_ypbind_resp.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_ypbind_binding.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_ypbind_resptype.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: strdup.c,v 1.3 1997/08/20 04:18:52 millert Exp $$OpenBSD: xdr_ypreq_key.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_domainname.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_mapname.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_ypresp_key_val.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_keydat.c,v 1.5 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_ypresp_val.c,v 1.4 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_valdat.c,v 1.5 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr_ypstat.c,v 1.5 2002/07/20 01:35:34 deraadt Exp $$OpenBSD: xdr.c,v 1.6 2001/09/15 13:51:01 deraadt Exp $xdr_bytes: out of memory xdr_string: out of memory $OpenBSD: ypprot_err.c,v 1.5 2002/07/20 01:35:35 deraadt Exp $rTMPDIR%s/bt.XXXXXX/tmpmpool_new: page allocation overflow. $OpenBSD: getenv.c,v 1.4 1998/07/16 18:02:33 deraadt Exp $/dev/arandom$OpenBSD: vfprintf.c,v 1.17 2002/02/19 19:39:37 millert Exp $InfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.$OpenBSD: strtod.c,v 1.15 2002/02/19 19:39:37 millert Exp $?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5InfinityNaN0A??҇coCa?Ɗ(`ȳ?DPy?@$@@? ((((( AAAAAABBBBBB ((((( $OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $.$OpenBSD: getdtablesize.c,v 1.2 1996/08/19 08:19:20 tholo Exp $$OpenBSD: memchr.c,v 1.4 2001/09/07 08:09:31 espie Exp $$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $$OpenBSD: multibyte.c,v 1.3 2002/02/19 19:39:37 millert Exp $%$sniglet^&$OpenBSD: abort.c,v 1.8 2002/09/14 22:03:14 dhartmei Exp $$OpenBSD: exit.c,v 1.8 2002/09/14 22:03:14 dhartmei Exp $$OpenBSD: atexit.c,v 1.7 2002/09/14 22:03:14 dhartmei Exp $/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin$OpenBSD: bcopy.c,v 1.2 1996/08/19 08:33:58 tholo Exp $$OpenBSD: calloc.c,v 1.7 2002/07/31 09:19:04 deraadt Exp $$OpenBSD: memset.c,v 1.2 1996/08/19 08:34:07 tholo Exp $$OpenBSD: memcmp.c,v 1.2 1996/08/19 08:34:05 tholo Exp $$OpenBSD: strtoull.c,v 1.1 2002/06/29 00:20:11 millert Exp $HASH: Out of overflow pages. Increase page size TMPDIR%s/_hash.XXXXXX/tmpظ($( ' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The edi- tor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sectors/cylin- der, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. d [part] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the `c' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). D Sets the disk label to the default values as reported by the kernel. This simulates the case where there is no disk label. m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. X Toggle ``expert mode''. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). z Zeroes out the existing partition table, leaving only the ``c'' partition. The drive parameters are not changed. In the restore form of the command, the prototype file used to create the label should be in the same format as that produced when reading or edit- ing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. When installing bootstrap code with the --BB flag, if the names are not ex- plicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. Note that when a disk has no real BSD disklabel the kernel creates a de- fault label so that the disk can be used. This default label will in- clude other partitions found on the disk if they are supported on your architechture. For example, on systems that support fdisk(8) partitions the default label will also include DOS and Linux partitions. However, these entries are not dynamic, they are fixed at the time ddiisskkllaabbeell is run. That means that subsequent changes that affect non-OpenBSD parti- tions will not be present in the default label, though you may update them by hand. To see the default label, run ddiisskkllaabbeell with the --dd flag. You can then run ddiisskkllaabbeell with the --ee flag and paste any entries you want from the default label into the real one. EEXXAAMMPPLLEESS disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x SSEEEE AALLSSOO disklabel(5), disktab(5), scan_ffs(8) DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. On some machines, such as the sparc and amiga, partition tables may not exhibit the full functionality that is described above. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 3.2 October 27, 1997 5 $OpenBSD: ar_io.c,v 1.26 2002/02/19 19:39:35 millert Exp $$OpenBSD: ar_subs.c,v 1.18 2002/02/19 19:39:35 millert Exp $$OpenBSD: buf_subs.c,v 1.11 2002/02/19 19:39:35 millert Exp $ $OpenBSD: cache.c,v 1.10 2002/02/19 19:39:35 millert Exp $$OpenBSD: cpio.c,v 1.10 2002/06/09 02:35:27 itojun Exp $$OpenBSD: file_subs.c,v 1.17 2002/02/19 19:39:35 millert Exp $$OpenBSD: ftree.c,v 1.18 2002/02/19 19:39:35 millert Exp $$OpenBSD: gen_subs.c,v 1.13 2002/02/19 19:39:35 millert Exp $$OpenBSD: getoldopt.c,v 1.4 2000/01/22 20:24:51 deraadt Exp $$OpenBSD: options.c,v 1.51 2002/09/06 18:17:30 deraadt Exp $abcdfiklnoprstuvwxBDEGHLPTUXYZh`Qh@QVEVA@0\.hXLC@CEEEA@0\.hPnI@ILELA@0\.hHnITIILLLA@0\.h@(հ٠(0\.(h8(h0(0\.$OpenBSD: pat_rep.c,v 1.20 2002/07/17 18:33:27 naddy Exp $@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.20 2002/02/19 19:39:35 millert Exp $$x$OpenBSD: sel_subs.c,v 1.10 2002/02/19 19:39:35 millert Exp $$OpenBSD: tables.c,v 1.15 2002/02/19 19:39:35 millert Exp $$OpenBSD: tar.c,v 1.25 2002/02/19 19:39:35 millert Exp $$OpenBSD: tty_subs.c,v 1.8 2002/02/19 19:39:35 millert Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.57 2002/09/06 21:17:39 deraadt Exp $8%.? ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.14 2002/07/04 04:26:39 deraadt Exp $7'L''''p''''L'' ''L'' ''P'''$OpenBSD: cmp.c,v 1.3 1997/01/03 22:36:07 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.17 2002/03/12 01:05:15 millert Exp $P.#0$OpenBSD: print.c,v 1.17 2002/08/01 21:49:57 deraadt Exp $$OpenBSD: util.c,v 1.7 2001/09/06 13:29:08 mpech Exp $x`#(#(#(#(#<#<#<#<#P#P#P#P e j   ky JKYdu f   bvz!w"F2R r u'g<<p%{{}}{}(())()[[]][]#$G>>P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:p:x&-/:ttso_|%v !+ HhVq:q:QZZ  lhbwixX  0 $ k j  is a directory is not a regular file#H#Ha'+H b '+(-pB'+c'+X8d'+0e'*f'+,hHg'+$(h'+xHA'+`@i'*- j'*kH*lH*m'+ xn"'+ `H(o)O*dpH,`P,q'*r!'+<`8s!'+ S!'+4t+0T+u"'+Lx`V-w!'+0x$'+PXA'+Dy'+xPz'+@8?.' h (press RETURN)... (interrupt to abort)?n?f%f .?m(file %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(file %i of %m) .?e(END) ?x- Next\: %x.:(?pB%pB\%:byte %bB?s/%s..).%t?f%f .?n?m(file %i of %m) ..?ltline %lt?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(file %i of %m) .?ltline %lt?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t#(290@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ @(#)getmntopts.c 8.3 (Berkeley) 3/29/95$OpenBSD: grep.c,v 1.1 2001/09/21 23:12:00 deraadt Exp $@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.14 2002/07/03 22:32:34 deraadt Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.12 2002/07/03 22:32:33 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.50 2002/06/10 21:19:24 itojun Exp $0123456789abcdefHרxH ֘h8 pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1UPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRDژ0      ݸݨݠݘݐ݈݀xph`PH@80( !"#$%&'(ܰ)ܨ*ܘ+ܐ,܈-܀.p/$OpenBSD: cmds.c,v 1.41 2002/07/12 00:25:30 deraadt Exp $8ހxph`hXPH@'P@8$OpenBSD: cmdtab.c,v 1.15 2001/10/04 22:49:55 pjanzen Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagertoggle passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress metertoggle interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode#X#1#,### #@x#t#` 4# P#)###( d#X#x \#8p#h#(`#tX#$P#H# @#(8#`0#(# ##@x# P#p/#8#X8#*# ##$#p##H#`.#p/###/#8#!#8 x#p#p/h#(X#H#0l@#P8#0#H(# #t#(# #0#h##*#`0#L#/x# )X#H#<#p#-#$X$0)($X*$px$`p$h$`$X$ P#S$OpenBSD: domacro.c,v 1.7 1997/07/25 21:56:19 millert Exp $$OpenBSD: fetch.c,v 1.39 2002/05/30 06:51:46 deraadt Exp $$OpenBSD: ftp.c,v 1.49 2002/07/04 10:08:00 jakob Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.50 2002/06/04 10:13:23 mpech Exp $$OpenBSD: ruserpass.c,v 1.13 2002/02/16 21:27:46 millert Exp $XP@80(  $OpenBSD: util.c,v 1.30 2002/07/12 00:25:30 deraadt Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.13 2002/04/23 18:54:12 espie Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $Q   Copyright 1995, 1996, 1997, 1998, 1999 The Internet Software Consortium.All rights reserved.Internet Software Consortium DHCP ClientPlease contribute if you find this software useful.For info, please visit http://www.isc.org/dhcp-contrib.htmlPATH=/usr/bin:/usr/sbin:/bin:/sbin/sbin/dhclient-script( 0(EHC  HHH@(DH0H((DHH(DHH(DGH(DGH(DGH(DGH(DGH(DGH(D GH(D G`H(D GPGH(D G8G0(D G G(DGG(DFH((DFG(DFG(DFF(DFF(DFF(DFpG0(DF`FX(DF@F8(DF F(DFG0(DEF(DEH((DEF(DEF(DEF(DExH((D EhF(D!EPF(D"E8F8(D#E F(D$EFX(D%DF8(D&DF(D'DG(D(DH(D)DH(D*DGH(D+DxH(D,D`H(D-DHFX(D.D8G(D/D(H(D0DH(D1CH((D2CF8(D3CFX(D4CFX(D5CH((D6CCx(D7ChG(D8CPG0(D9C8F8(D:C F8(D;CG(D<BGH(D=BGH(D>BGH(D?BG(D@BH(DABG(DBBG(DCBpH(DDB`H(DEBPH(DFB@H(DGB0H(DHB H(DIBH(DJAH(DKAH(DLAG(DMAGH(DNAGH(DOAGH(DPAGH(DQApGH(DRA`GH(DSAPGH(DTA@H(DUA0GH(DVA GH(DWAGH(DXAGH(DY@GH(DZ@GH(D[@GH(D\@GH(D]@GH(D^@GH(D_@GH(D`@GH(Da@pGH(Db@`GH(Dc@PGH(Dd@@GH(De@0GH(Df@ GH(Dg@GH(Dh@GH(Di?GH(Dj?GH(Dk?GH(Dl?GH(Dm?GH(Dn?GH(Do?GH(Dp?GH(Dq?pGH(Dr?`GH(Ds?PGH(Dt?@GH(Du?0GH(Dv? GH(Dw?GH(Dx?GH(Dy>GH(Dz>GH(D{>GH(D|>GH(D}>GH(D~>GH(D>GH(D>GH(D>pGH(D>`GH(D>PGH(D>@GH(D>0GH(D> GH(D>GH(D>GH(D=GH(D=GH(D=GH(D=GH(D=GH(D=GH(D=GH(D=GH(D=pGH(D=`GH(D=PGH(D=@GH(D=0GH(D= GH(D=GH(D=GH(D<GH(D<GH(D<GH(D<GH(D<GH(D<GH(D<GH(D<GH(D?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~X8X(XXWWWWWWWWWWpW`WPW@W0W WWVVVVVVVVVpV`VPV@V0V VVUUUUUUUUUpU`UPU@U0U UUTTTTTTTTTpT`TPT@T0T TTSSSSSSSSSpS`SPS@S0S SSRRRRRRRRRpR`RPR@R0R RRQQQQQQQQQpQ`QPQ@Q0Q QQPPPPPPPPPpP`PPP@P0P PPOOOOOOOOOpO`OPO@O0O OONNNNNNNNNpN`NPN@N0N NNMMMMMMMMMpM`MPM@M0M MMLLLLLLLLLpL`LPL@L0L LLKKKKKKKKKpK`KPK@K0K KKJJJJJJJJJpJ`JPJ@J0J JJIIIIIIIIIpI`IPI@I0I IIHHHHHHHHHpH`HP;Zx0N@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.24 2002/07/03 22:32:33 deraadt Exp $$OpenBSD: buf.c,v 1.13 2002/06/09 05:47:27 todd Exp $(X$OpenBSD: cbc.c,v 1.8 2002/09/06 18:17:53 deraadt Exp $@ $OpenBSD: glbl.c,v 1.9 2002/03/24 22:17:04 millert Exp $$OpenBSD: io.c,v 1.10 2002/03/24 22:17:04 millert Exp $a$OpenBSD: main.c,v 1.27 2002/06/09 05:47:27 todd Exp $aaH$OpenBSD: re.c,v 1.9 2002/06/09 05:47:27 todd Exp $$OpenBSD: sub.c,v 1.9 2002/06/09 05:47:27 todd Exp $$OpenBSD: undo.c,v 1.6 2002/03/24 22:17:04 millert Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.20 2002/07/04 04:26:39 deraadt Exp $$'Xe$OpenBSD: utils.c,v 1.20 2002/07/04 04:26:39 deraadt Exp $khk jjjxjpj(iiihjpi hhlhalXclPcl@dl0dl(fl hlllLlnlNkqkqkrkSktkTkvkVk1k9kZkbpooopo@onnxnPnmmmmPm(ml*@qssssss*@qsssv`vXvPvHjpjpjpjpv@      ))$.))`$/$)$/           #+3;CScscc !1Aa  0@` ?? w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.14 2002/07/04 04:26:39 deraadt Exp $ ... ...$NetBSD: fsutil.c,v 1.2 1996/10/03 20:06:31 christos Exp $$OpenBSD: setup.c,v 1.17 2002/08/23 09:09:04 gluk Exp $xph`XPH@PH8( X@xph`X?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@$8$8$8$9@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.28 2002/07/03 22:32:32 deraadt Exp $|$OpenBSD: dkcksum.c,v 1.3 2001/11/05 07:39:16 mpech Exp $$OpenBSD: getmntopts.c,v 1.2 1996/06/23 14:31:10 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.35 2002/05/26 09:24:35 deraadt Exp $xp h@`@@ @%s: can't read disk label; disk type must be specifiedh8`@pX8 $OpenBSD: mkfs.c,v 1.22 2002/06/09 08:13:08 todd Exp $... . ..chownXdmesgXfsck_ffs0BfsckXrebootXhaltXifconfig0Bdhclient0BinitXmknodXmountX mount_cd9660 mount_ffsB mount_nfsBnewfsX mount_mfsBpingXrouteXumountXdhclient-script disklabel#!/bin/sh # # $OpenBSD: dhclient-script,v 1.11 2000/10/18 23:42:56 todd Exp $ # if [ "x$new_network_number" != "x" ]; then echo "New Network Number: $new_network_number" fi if [ "x$new_broadcast_address" != "x" ]; then echo "New Broadcast Address: $new_broadcast_address" fi if [ "x$reason" = "xMEDIUM" ]; then ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 exit 0 fi if [ "x$reason" = "xPREINIT" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 \ broadcast 255.255.255.255 up exit 0 fi if [ "x$reason" = "xARPCHECK" ] || [ "x$reason" = "xARPSEND" ]; then exit 0; fi if [ "x$reason" = "xBOUND" ] || [ "x$reason" = "xRENEW" ] || \ [ "x$reason" = "xREBIND" ] || [ "x$reason" = "xREBOOT" ]; then if [ "x$old_ip_address" != "x" ] && [ "x$alias_ip_address" != "x" ] && \ [ "x$alias_ip_address" != "x$old_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi if [ "x$old_ip_address" != "x" ] && [ "x$old_ip_address" != "x$new_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.1 >/dev/null 2>&1 for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' |sh fi if [ "x$old_ip_address" = "x" ] || \ [ "x$old_ip_address" != "x$new_ip_address" ] || \ [ "x$reason" = "xBOUND" ] || [ "x$reason" = "xREBOOT" ]; then ifconfig $interface inet $new_ip_address netmask $new_subnet_mask \ broadcast $new_broadcast_address $medium route add $new_ip_address 127.1 >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 done if [ "$new_static_routes" != "" ]; then set "$new_static_routes" while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi fi if [ "x$new_ip_address" != "x$alias_ip_address" ] && [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi if [ "x$new_domain_name" != "x" ]; then if [ -n "$new_domain_name_servers" ]; then echo "search $new_domain_name" >/etc/resolv.conf for nameserver in $new_domain_name_servers; do echo nameserver $nameserver >>/etc/resolv.conf done if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf fi exit 0 fi fi fi if [ "x$reason" = "xEXPIRE" ] || [ "x$reason" = "xFAIL" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi if [ "x$old_ip_address" != "x" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete $old_ip_address 127.1 >/dev/null 2>&1 for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set "$old_static_routes" while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' \ |sh >/dev/null 2>&1 fi if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi exit 0 fi if [ "x$reason" = "xTIMEOUT" ]; then if [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi ifconfig $interface inet $new_ip_address netmask $new_subnet_mask \ broadcast $new_broadcast_address $medium sleep 1 if [ "$new_routers" != "" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "x$new_ip_address" != "x$alias_ip_address" ] && \ [ "x$alias_ip_address" != "x" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi route add $new_ip_address 127.1 >/dev/null 2>&1 for router in $new_routers; do route add default $router >/dev/null 2>&1 done if [ "$new_static_routes" != "" ]; then set "$new_static_routes" while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi if [ "$new_domain_name" != "" ]; then if [ -n "$new_domain_name_servers" ]; then echo "search $new_domain_name" >/etc/resolv.conf.std for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then rm -f /etc/resolv.conf fi mv /etc/resolv.conf.std /etc/resolv.conf exit 0 fi fi fi fi ifconfig $interface inet -alias $new_ip_address $medium for router in $old_routers; do route delete default $router >/dev/null 2>&1 done if [ "$old_static_routes" != "" ]; then set "$old_static_routes" while [ $# -gt 1 ]; do route delete $1 $2 shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' \ |sh >/dev/null 2>&1 exit 1 fi exit 0 cmp_ureminflate_codes_newxdr_inaddr_encodeinflate_trees_bitsinflateSyncinflate_codesfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpcd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodesprintfgetdevtypedomainnamelenprom_open.urem.remrpc_pmap_numinflate_blocksxdr_inaddr_decodeobp_recvinflate_blocks_resetdvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysinflate_blocks_sync_pointin_cksumgetpropinflate_trees_dynamicinflate_set_dictionaryprom0_xmitinflate_codes_freeexit_divesymufs_writegetpropstringstartfile_system_nfsbceaarpwhohasufs_statnetif_closeinflateSetDictionarystrlenopenreadether.umulnfs_lookupfhinflate_blocks_newinflateEnddevswprom0_iopenobp_closenfs_readlinkinflateInit2_dvma_freecloseprom_bootfileget_crc_tablefbuffreelistrpc_pmap_putcachefree (=   @=׍{Y( @@=@@<@`dT U=@@?(0pLl A=,=0G=0GZm=-L=-D=-D != = =W!#a= X= X= %!= = =W6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ 0$OpenBSD: getservbyport.c,v 1.3 1997/07/09 01:08:35 millert Exp $($OpenBSD: herror.c,v 1.4 1997/03/13 19:07:28 downsj Exp $h$OpenBSD: wait.c,v 1.2 1996/08/19 08:27:41 tholo Exp $0$OpenBSD: sleep.c,v 1.7 1997/04/25 04:20:41 tholo Exp $p$OpenBSD: getlogin.c,v 1.7 2002/02/16 21:27:22 millert Exp $$OpenBSD: puts.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: regerror.c,v 1.9 2002/05/25 09:11:02 deraadt Exp $!!!!!!x!h!P!@!(!       p  ` @  0    `P( "($$OpenBSD: getcwd.c,v 1.6 2000/07/19 15:25:13 deraadt Exp $$OpenBSD: fts.c,v 1.32 2002/07/12 01:47:41 millert Exp $$OpenBSD: vprintf.c,v 1.3 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: raise.c,v 1.2 1996/08/19 08:25:33 tholo Exp $%$OpenBSD: tcsetpgrp.c,v 1.4 2002/02/19 19:39:37 millert Exp $$OpenBSD: regexec.c,v 1.7 1997/04/30 05:51:10 tholo Exp $$OpenBSD: engine.c,v 1.6 2002/05/25 09:11:02 deraadt Exp $$OpenBSD: setbuffer.c,v 1.2 1996/08/19 08:33:05 tholo Exp $$OpenBSD: fputc.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: regcomp.c,v 1.8 2002/02/16 21:27:24 millert Exp $''h'`'X' '`'''`'&'`&&'`&&`'`&X&8'`&0%'`%%'`%%'`%%h'`%`%H'`'`,,++++++++++ + + + + +x +p +` +X +H +@+8+0+(+ ++++*************% *!*p"*`#*P$*@%*0&* '*()))*)+),)-)-).).)/)/)0)x1)p2)h3)`4)X5)P6)H7)@8)89)0:) ;)<)=(>(?(@([(\(\(x](h^(P^(@_(0_( `({'{'|'}'}'~'$OpenBSD: regfree.c,v 1.3 1997/04/28 20:45:01 millert Exp $$OpenBSD: ns_ntoa.c,v 1.10 2002/07/25 21:12:47 deraadt Exp $$OpenBSD: ipx_ntoa.c,v 1.3 2002/05/24 21:22:37 deraadt Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: glob.c,v 1.20 2002/06/14 21:34:58 todd Exp $$OpenBSD: tcgetpgrp.c,v 1.2 1996/08/19 08:34:40 tholo Exp $$OpenBSD: cfmakeraw.c,v 1.3 1998/08/20 19:45:57 deraadt Exp $$OpenBSD: ns_addr.c,v 1.7 2002/02/16 21:27:23 millert Exp $$OpenBSD: ipx_addr.c,v 1.5 2001/06/27 00:58:55 lebel Exp $$OpenBSD: sscanf.c,v 1.5 2002/02/19 19:39:37 millert Exp $$OpenBSD: vfscanf.c,v 1.8 2002/02/19 19:39:37 millert Exp $  $OpenBSD: fread.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: ungetc.c,v 1.4 2002/02/16 21:27:24 millert Exp $$OpenBSD: disklabel.c,v 1.7 2002/05/24 21:22:37 deraadt Exp $---------------....p.h.`.P.H.@.8-.0.(. ....--....................0(0h?9gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA$j|$jp$jp$j0$OpenBSD: popen.c,v 1.12 2002/01/16 01:28:54 millert Exp $$OpenBSD: exec.c,v 1.13 2002/07/30 00:15:13 deraadt Exp $$OpenBSD: waitpid.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: printf.c,v 1.4 2002/02/19 19:39:37 millert Exp $$OpenBSD: utime.c,v 1.2 1996/08/19 08:27:24 tholo Exp $$OpenBSD: setlocale.c,v 1.10 2002/09/17 07:45:35 itojun Exp $1111111CCCCCCC$OpenBSD: gethostnamadr.c,v 1.53 2002/08/27 08:53:13 itojun Exp $3x$OpenBSD: sprintf.c,v 1.5 2002/02/19 19:39:37 millert Exp $$OpenBSD: ftell.c,v 1.3 2000/02/21 22:11:22 millert Exp $33$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $78$OpenBSD: setmode.c,v 1.11 2002/02/19 19:39:36 millert Exp $$OpenBSD: inet_lnaof.c,v 1.3 1997/04/05 21:13:11 millert Exp $7x$OpenBSD: getttyent.c,v 1.5 2002/02/16 21:27:22 millert Exp $8$OpenBSD: closedir.c,v 1.3 1998/11/20 11:18:37 d Exp $$OpenBSD: seekdir.c,v 1.4 2002/02/16 21:27:23 millert Exp $$OpenBSD: opendir.c,v 1.8 2002/07/30 22:47:22 millert Exp $8X$OpenBSD: telldir.c,v 1.2 1996/08/19 08:26:35 tholo Exp $$OpenBSD: readdir.c,v 1.5 2001/05/17 20:20:36 rees Exp $$OpenBSD: getbsize.c,v 1.7 2001/08/18 22:56:22 deraadt Exp $$OpenBSD: nlist.c,v 1.42 2002/06/11 06:39:47 art Exp $ 8 ($OpenBSD: fgetc.c,v 1.2 1996/08/19 08:32:27 tholo Exp $$OpenBSD: pwcache.c,v 1.5 2001/06/27 00:58:54 lebel Exp $$OpenBSD: getgrent.c,v 1.17 2002/07/06 03:08:13 deraadt Exp $$OpenBSD: getpwent.c,v 1.27 2002/07/06 03:10:23 deraadt Exp $: $OpenBSD: err.c,v 1.7 2002/06/12 03:16:20 fgsch Exp $$OpenBSD: verr.c,v 1.5 2002/06/12 03:16:20 fgsch Exp $$OpenBSD: warn.c,v 1.6 2002/06/12 03:16:20 fgsch Exp $$OpenBSD: vwarn.c,v 1.5 2002/06/12 03:16:20 fgsch Exp $$OpenBSD: warnx.c,v 1.5 2002/06/12 03:16:20 fgsch Exp $$OpenBSD: vwarnx.c,v 1.5 2002/06/12 03:16:20 fgsch Exp $;;<($OpenBSD: getproto.c,v 1.3 1997/07/09 01:08:31 millert Exp $$OpenBSD: getprotoent.c,v 1.4 1999/09/03 16:23:18 millert Exp $<$OpenBSD: cfsetospeed.c,v 1.2 1996/08/19 08:34:37 tholo Exp $<$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: siglist.c,v 1.2 1996/08/19 08:26:05 tholo Exp $$OpenBSD: malloc.c,v 1.48 2002/05/27 03:13:23 deraadt Exp $,(p,(pBQ<W\WW8XWd$OpenBSD: res_query.c,v 1.19 2002/06/27 09:55:49 itojun Exp $$OpenBSD: res_mkquery.c,v 1.12 2002/08/28 03:19:38 itojun Exp $$OpenBSD: res_send.c,v 1.12 2002/09/06 18:35:12 deraadt Exp $$OpenBSD: setbuf.c,v 1.2 1996/08/19 08:33:04 tholo Exp $$OpenBSD: setvbuf.c,v 1.4 2002/09/14 22:03:14 dhartmei Exp $$OpenBSD: res_debug.c,v 1.14 2002/07/25 21:55:30 deraadt Exp $ d'B@;S8$OpenBSD: res_comp.c,v 1.10 2002/02/19 19:39:36 millert Exp $$OpenBSD: tolower_.c,v 1.3 2001/06/27 07:17:08 pjanzen Exp $T$OpenBSD: wbuf.c,v 1.5 2001/07/09 06:57:45 deraadt Exp $$OpenBSD: res_data.c,v 1.1 1997/03/13 19:07:36 downsj Exp $VVVVVVxVpVhV`VXVPV@V8V(VVW WWVVVVpVhV`VVVVVVV$OpenBSD: fputs.c,v 1.3 1999/08/07 17:35:58 millert Exp $$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: toupper_.c,v 1.3 2001/06/27 07:17:09 pjanzen Exp $W($OpenBSD: inet_ntoa.c,v 1.3 2002/06/27 10:14:01 itojun Exp $$OpenBSD: inet_ntop.c,v 1.5 2002/08/23 16:27:31 itojun Exp $$OpenBSD: res_init.c,v 1.27 2002/07/25 21:13:45 deraadt Exp $ZX$OpenBSD: gethostname.c,v 1.3 1998/05/13 08:50:58 deraadt Exp $$OpenBSD: inet_addr.c,v 1.6 1999/05/03 22:31:14 yanick Exp $$OpenBSD: inet_pton.c,v 1.4 2002/02/16 21:27:23 millert Exp $Z\\P$OpenBSD: getdomainname.c,v 1.3 1998/05/13 08:50:55 deraadt Exp $$OpenBSD: fgets.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: getservbyname.c,v 1.5 2000/01/06 08:24:17 d Exp $$OpenBSD: getservent.c,v 1.5 1999/09/03 16:23:19 millert Exp $\$OpenBSD: fopen.c,v 1.2 1996/08/19 08:32:41 tholo Exp $$OpenBSD: rewind.c,v 1.2 1996/08/19 08:33:02 tholo Exp $$OpenBSD: fseek.c,v 1.4 2002/02/16 21:27:24 millert Exp $]]@]$OpenBSD: syslog.c,v 1.19 2002/06/20 23:01:10 jjbg Exp $$OpenBSD: send.c,v 1.2 1996/08/19 08:29:52 tholo Exp $@(#)strftime.c 7.64^x@(#)localtime.c 7.75$OpenBSD: localtime.c,v 1.21 2002/04/04 19:12:09 millert Exp $WILDABBR$~$~@(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $bc8cxc$OpenBSD: usleep.c,v 1.7 1998/02/08 22:44:09 tholo Exp $$OpenBSD: vsnprintf.c,v 1.5 1998/07/27 02:28:28 millert Exp $cdp ePij j`gjDjj jjLjo$no,o4o<kopPk@ssu uXuuusttu uXuuvskk<llPz{{|| |}}~T$OpenBSD: perror.c,v 1.4 2002/02/16 21:27:24 millert Exp $l$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catopen.c,v 1.10 2002/02/16 21:27:23 millert Exp $m`mTwx(xhxxy8y$OpenBSD: time.c,v 1.2 1996/08/19 08:26:39 tholo Exp $yzzPzz{{`{{|X$OpenBSD: db.c,v 1.5 2002/02/25 23:45:15 millert Exp $$OpenBSD: rec_open.c,v 1.7 2002/01/31 17:19:11 millert Exp $$OpenBSD: bt_open.c,v 1.9 2002/02/25 23:45:14 millert Exp $$OpenBSD: bt_get.c,v 1.4 1999/02/15 05:11:22 millert Exp $$OpenBSD: bt_conv.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_put.c,v 1.7 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_delete.c,v 1.6 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_seq.c,v 1.6 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_search.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: bt_utils.c,v 1.4 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_close.c,v 1.7 2002/02/25 23:45:15 millert Exp $$OpenBSD: bt_close.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: fclose.c,v 1.2 1996/08/19 08:32:19 tholo Exp $$OpenBSD: ftruncate.c,v 1.9 2002/09/17 21:16:01 deraadt Exp $$OpenBSD: rec_get.c,v 1.6 2000/11/21 02:11:02 deraadt Exp $$OpenBSD: rec_put.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_delete.c,v 1.5 2002/02/16 21:27:22 millert Exp $$OpenBSD: rget.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: refill.c,v 1.5 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: rec_seq.c,v 1.4 1999/02/15 05:11:25 millert Exp $$OpenBSD: rec_utils.c,v 1.3 1996/08/19 08:21:12 tholo Exp $$OpenBSD: bt_overflow.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: bt_page.c,v 1.5 1999/02/15 05:11:23 millert Exp $$OpenBSD: rec_search.c,v 1.5 1999/02/15 05:11:25 millert Exp $$OpenBSD: mpool.c,v 1.10 2002/02/25 23:45:15 millert Exp $$OpenBSD: fprintf.c,v 1.4 2002/02/19 19:39:36 millert Exp $$OpenBSD: fdopen.c,v 1.2 1996/08/19 08:32:20 tholo Exp $$OpenBSD: flags.c,v 1.3 1996/08/19 08:32:37 tholo Exp $|$OpenBSD: mktemp.c,v 1.16 2002/05/27 18:20:45 millert Exp $$OpenBSD: pread.c,v 1.4 2002/09/17 21:16:01 deraadt Exp $$OpenBSD: snprintf.c,v 1.7 2002/02/19 19:39:37 millert Exp $}8 0000000000000000~}$OpenBSD: flt_rounds.c,v 1.3 1997/08/01 21:36:33 deraadt Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: ctype_.c,v 1.5 2001/01/06 20:34:48 naddy Exp $ $OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $`$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $$OpenBSD: fvwrite.c,v 1.11 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: wsetup.c,v 1.4 2002/04/29 06:36:12 espie Exp $$OpenBSD: makebuf.c,v 1.4 2002/09/14 22:03:14 dhartmei Exp $$OpenBSD: findfp.c,v 1.3 2002/09/14 22:03:14 dhartmei Exp $,$gfgtg($ gfgtg( $xgfgtg($$$OpenBSD: stdio.c,v 1.4 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: lseek.c,v 1.8 2002/09/17 21:16:01 deraadt Exp $$OpenBSD: fflush.c,v 1.2 1996/08/19 08:32:26 tholo Exp $$OpenBSD: fwalk.c,v 1.3 2001/07/09 06:57:44 deraadt Exp $$OpenBSD: sysconf.c,v 1.4 1998/06/02 06:10:26 deraadt Exp $$OpenBSD: isatty.c,v 1.3 1998/11/20 11:18:39 d Exp $$OpenBSD: tcgetattr.c,v 1.2 1996/08/19 08:34:39 tholo Exp $0$OpenBSD: umoddi3.c,v 1.2 1996/08/19 08:30:48 tholo Exp $$OpenBSD: qdivrem.c,v 1.3 2002/02/16 21:27:23 millert Exp $h$OpenBSD: isinf.c,v 1.4 2001/09/10 22:38:11 millert Exp $$OpenBSD: isnan.c,v 1.4 2001/09/10 22:38:11 millert Exp $$OpenBSD: hash.c,v 1.14 2002/03/25 19:08:48 millert Exp $$OpenBSD: hash_buf.c,v 1.10 2002/02/25 23:45:15 millert Exp $$OpenBSD: hash_func.c,v 1.6 2002/02/16 21:27:22 millert Exp $$OpenBSD: hash_log2.c,v 1.4 1999/02/15 05:11:24 millert Exp $0p$OpenBSD: getpagesize.c,v 1.2 1996/08/19 08:23:54 tholo Exp $$OpenBSD: sysctl.c,v 1.4 2002/02/16 21:27:23 millert Exp $$OpenBSD: mmap.c,v 1.10 2002/09/17 21:16:01 deraadt Exp $$OpenBSD: signal.c,v 1.4 1998/06/26 02:12:49 deraadt Exp $(h$OpenBSD: pwrite.c,v 1.4 2002/09/17 21:16:01 deraadt Exp $$OpenBSD: bt_split.c,v 1.9 2002/02/25 23:45:14 millert Exp $$OpenBSD: hash_page.c,v 1.12 2002/02/25 23:45:15 millert Exp $$OpenBSD: ashldi3.c,v 1.2 1996/08/19 08:30:16 tholo Exp $$OpenBSD: hash_bigkey.c,v 1.10 2002/02/25 23:45:15 millert Exp $GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease).symtab.strtab.shstrtab.init.text.fini.rodata.data.ctors.dtors.sbss.bss.comment.note.openbsd.ident8!׺'ؠؠ-ظظ5#;$88B$@@I$HHO$HH(TH]]"qP L8`@#`5!" $@``T@3"5a@"@H*/+.4"b  0  ""."" *.""!`.""@㿐@p.#*@"H4"`*L@ 3**"`3*14%4/*+4)4-*'47*9. ;4"@*b@ $ b@h @ M ؀ 2%b@xX@ vLX 2@i ܐ␒@}@ΐ"`b4bb1   @*.? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1?*@B"1?㿘 #@(1*@3"1㿘@ " ܒ㿘 @̒㿘3"` @h. "c4 "@ " $"㿘3b ? "b.@fc㿐'.@?75 @!*'"@@@  )4*5"@ܒ`H/ H*15c <@  24 `,Ѐ 9+`!h+!p+!x@B     @ "@ @n@Ȁ V`̐ Ȩ Ȁ "@@!Ȓ @̐"  @"  `,`@&`% `   ? 4""   @ ?  42`04b!+)!`0* , @'@"4b!+!b!+!8b!+!84b!+ !b!+!4b!+"@ S @ɐ0g`0`7  @ " `("J @ 4 %+ ? (`+!+!x @      @x ?2 4 @ɐ @` ?$  `0`@Ҡ (`2+@w"☒ 4&` &`6`*6`,@ 4? 4"b+&@c"  㿐``@ 0@ `@`@r @В * @j   @@ x ` *  d,  0 2 0 0@" x @*  @Ґ`?``"? 6"?%` 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @W0$@     d ,  0 2 0 2 %@` ,`@f@,`& 㿐   e<`P @@ 4`0*:  8  2`0 @8e<`0e<eD `L  Ȁ)n 2; @`0$  " @3  `d  *  0 @,$ $  $&@&    b 8   @   " & 㿐`@  <@`@-5 2& :@ "   2  @  " *@B<@@` ڐ2 ``@Ӑ 㻀@v Ц @Ŕ &`@o@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  '` L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@+ W(  2LL@@ $H  E;@%( 8@"@  0 K䰒 *@`  d*  0` @ O / ' 'ܒ L@  @   0@ ֐ @ @ ͒ Ё㿘 &     . @ "  @ 0  .  "  @ 0 @ @  а 㿐 @ @&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  p k5 @1a"'А $  $ $ ''X@ג 2W?/` ??"` 4` $@!#`"#@ #\ @  !4+@""(<?#4"b@ِ"*`4b' @2 6`+@ "P#?5'ܢ ܔ 4" 45`H@ ?5"`4c`@w  ?5@aH ? ? , P5 45`H''@H 2C?@L@? 2:?/` 4?"` 6 "&#`a#@b#\ @    4 H"b''@( 2?@J 2?#'@ ? ?㿘`&"@  &@ 0 㿘`&@   ? & @ .@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ U( ( @ `  -``( ( +"x@     2` * @h * *` * +  *+`  h  @ <(g 8@ @ O`-`  ` ΀ǰ    *` *   *  M `N JL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ת``  `-`( U(  gh 8  *   *` * Ȓ  @ @@ ˀg@+ @ W   >>>&`>  * *`   * & +` * +   :>@ _0  @ Y @ V㿘  @ O&  㷐 R@ N`@4 @H``@C@2 *@ `  @ A,  ( )􀢨$ 2@` ' 8'" w@ '@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0   㿘c  ,  ". /.".+."&  "!".. 0  ? 0 @͠L *L0 0 0pؒ  @ @ E 8 'pt@ n ,  $ #`a#\b` @ ? 4 H "b؀`4@ O  ""?㽠P  x@ a  'P $` $` $`  $$` ($` ,$`@ $` 8 t@ ( $`   h #`ab`$#\ @ ? 4" x 0  &,& &&& D& &(&$@㺈 ` ($a b ????#\#`  @ ? 4" `  dh@Аd .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @K ,? L `" H4""?@T@0 +"@ ݔ4 H"b?㿘@ /4 "b 4" 6 & 2 ?  " $?!$ "  ?㷈4""` +@ " N  m `/2N N /" N a  0 ] @ x  <$N O  N  /  .۔ A.0 0Ⱒ# 2;@ @ ݐ $+  (@;@O`/ Ⰰ@ x@ x  @ x N  &`  @В x@˒ x㿘  "& @ x&  㿘' #4!4%+@    ? b2   Ԁ @  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  /0( 4 2`:2` <"` @"`D :`0 㿐\@?<6   '?'?@j?4㨐 '?` '?`@"㨢"?'?Đ #`#` #`#`#\ #`aL$ "p@ǚ? 4` @``2+"@k"4 H"b?㿘!4$"@ 4#@ 2?`2 ?`+` $"#@G ??"@?244(( 2  2 2 *?4# ###4(("##" " " 㾐a"@3 o'Ô?(' "p #\#` ""   C   p'–0 #4!+b@c#(@ِ H$b?8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8F8FD8FP8F\8Fh8Ft8F㿘`X1 *` €1+0#81+-#P1+*#h1+'#1+$#1+!#1+#1+#1+#1, 1, 1, H1,  `1,  x14 @,` @/ ,@3 J?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 ``h4 `4 #\  .@V ,@ ? 52`@ `@2  `@ @ 0/ ? @ /??"`@ $`㿘/ @@m 5㿐@4!""  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` / Ȁ    5`'!H'ܐ@)ܖ@ܘ( @?, @<x@ް zހ( (  t?@o?2m?<@ 2f? 2b?6` <`\@l 2X? &T?``  2L?` &@  "@4  ` 2=?` 5` %,@!0? ,  $ $ ' '`'''4 @/  ?$$ $ $ $ $$ $ $ $ ` ??㿘\y   )4 <+,`%"(?@ @a(@,`4 2 "   I$$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘4 ,@  .  @} 0,@@ "@r  0,@@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "= N -N`$* `.! גN*`? @ . Ȓ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` +` ??㿘ג  @,   /`@@%  "` ?` ?74/( :  0 *@ `  *@`*@`4* " @ ` ?  2  㿘4`'H'L'P'T 'X @"`@H,@!P㿘,!X㿘5!h , @` @ , 㿘@@T㿘@| 㿘 < " ? 2  @14 D&"@V  $ " `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘/ Р  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 8㿘@Y?.`,@ P4 . `"  P @Ԑ,`?@ 8 `@v &`D&@c&`@0 @`@ P@Ð?㿘 4 "b?5!h. @ 4.   @֐ D@y@v P@㿘4 .  8?? ?2$  ?$8$ L "88 @P  "@"$ $$$$ @$ 44"`$<" $& @$$$<S < D!4$"@ $" $<D$@Ӓ #$8 H@" $H H ?$88 @+$$  @m $H8 2  < 2  2L H@[" $H&㾘 4 5!h- @4@9 -  `L @?2+$`)'$`" ` 4f c4b @F ` 42$`@   @ ?L @Ԑ`D P @,`?@ 8$@$`D$`@0` 4@ 1@ /@ f )`' a !ڒ: @4  Zd 4 `0 Z"b??/ؔؖ ? * `:```? /`ܔ "`"    /ؐ?"  ؀@ @   @ *0   @ *`(㿘5. !h @  @  4 $"b2  " @      @ $4""`4 ""?㿘5. !h@ @  4 "  4  Z :@B: Z"b? ?   ` 㿐5!h @  `  ` 4 D"b$@$`$` '͔ 84@`` / "`J .`)$@&$` #@  4! € ` `# `" ` @4""$@?㿐5. !h @@  4 ,"b" @ * 2`      4 "b B< ' 4 "b&?8d8e|8e8f8f8f8f8f8f8f8d8f8f8f8fH8f8f8e8f8f$8f8f8f\4( ȝ㿘!4#'L'P'T'X$ Ȓ@L *㿘'H'L'P'T'X"Ԓ@ H㿘"Ԓ@8N@`N@`%` N@`|`#H*` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈,!h@ @,@ΐ  ?L?㿘/ ` 4 , aJ@ #  /!D@ / 䀢@  'h@@C`@ ` D  ,$D!ƒ  .ܐ 7Ɛ(  , 4 , 4  ~4   44  4  4  4 h`4 j4 h $@#\ .3? h!,'l!l֐ ` `4` D4`  $D4`㿘/@U(㿐k4-""(2*?@ 2&?`(2"?`&2?`  @??/!D/*@ *`@ `y  ??㿘@ /`(+`&'` # `]   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  8zD8z8{`8{8|8|T8|8|8}T8}8}8~H8~8~ԝ㿘 ?`2"`0"`"`   "` @ 㿘 ? ` $ 2`0 " $@< $  (€ $ 㿘"M?N 12I?8 D?2 @? &  & & ( $ 2  & $   (  )& "  `"   "`  ( ?"  `     *@n  "` ?㿘 㿘 "@?  "<? 7` ?? ` .#t*` € %  $ $  @  " `$  ",a 2    ",a " `  $ $    $`*   &@,ݒb`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" ",b $ " @͒?   " F"" s @\ `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  ",b( $  " " ??㿘    "#? ? @r 0  ? & 06 * ?$@ @  "@ 㿘 A?`2@0;  "@"` 20?  ,"@  @`#@  ?( "$$$ "`̰ $$ "@?㿘 " ?   ?  @9㿘?6  ` W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@Ғ#Β#񀦠,`888|8\8L888888p㿘" <&? 8`$`(€  2 ( @ (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€h 0 4@`  "? ,"` + "p*` €Ш?  *`` 4  `&  `-`0  `4 $@&إ4@@9耢 & & & @&``$  &`&@& 4?  &4,&"&`4& & @&``$  &`&@& 4ڔ??  *`` ?#4* @, &"&`& & @&``$  &`&@& 4?`&  m p  `& & @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@ 0 4 "@ ,? ," ` 0 ( @ "?"`2 & & @&``$  &`&@& 4Y 8 "@`%%@ &     &?  *``  ?, & 4   ! ,&"&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @, "H?  *``   *@ *`"  & 2  4    ,"H* *`"  &  &   $ @ ?2 & `(`$€  && & @&``$  &`&@& 4 &&  4   ! @  /,!Hb @,  a?  *`@ ,   *`    $@ * "  & T4    @  E?  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4+?  ( ? + "@ &  4   ! @     $4  `#\#`&    !`''#d@sܠ ?2& `$`(€ && & @&``$  &`&@& 4@؀ 2& & & @&``$  &`&@& 4Δ?`$`(€ && & @&``$  &`&@& 4@  @/ 0 4@`  "? ,"   c&&& 4@1 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘S `( `$€ (`(`$€ $`(`$€㿘 (H (@& 0& 4`?88X8l888P888`8㿘 (    * * " " "㿘 0 4 @`  "? ,"@` $!Г*` €)` '& & @&``%@&@&`& 4 ` ``@` 0 4@ `  "@? ,": $@ ` `$` $`$@` /`  *   /aH+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@,$@#&`& & @&``%  &`&@& 4?` /`b  *   /!H+`  ` ` `$`$ $` $`$@4 ` /`Q  *   /aH+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`,$@#8&`& & @&``%  &`&@& 4O?` /`   *   /!H+`  `  $` $ $@4 `  (  ` ,"  *"$@27  ,  0 ( @ "?"2% & 4@* 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,  (`? $`$@2D `  ,  0 ( @ "?"22 ` & 4@ 0 4 "@ ,? ,"  0 ( @ "?"2 ` & & @&``%  &`&@& 4 (i$@ & 4?`?@ 4 0 0 4@& & @&``%  &`&@& 4r $@& & @&``%  &`&@& 4b & & @&``%  &`&@& 4T?& & @&``%  &`&@& 4F& & @&``%  &`&@& 48& & @&``%  &`&@& 4*& & @&``%  &`&@& 4& @&``%  &`&@& 4& & @&``%  &`&@& 4?@㿘`(`$€㿘04@`  , /H. ((```(@( @ @,h!H` &@6 . &@`` 6@(``` (, @P@!H` &@V6` (@ &@(`@ `. &@'.6, * @(!?/ (?/ y?/ / ?/ i?/ / ?/ X @2 `. `(. @@@6` 3"` @ . `. @(@@ 2l```&@/6/ 6`` 8) &@" "@'@`'@"@"`"`"42 ` "`8) &@" "@'@`'@"@"`"`"4? &``6` 8) &@" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0﨔 ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@&` & 0'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#/ @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@?&@0 '48' - @ `  @ `.@(&@h H`@*@ @ h'H'0?'p  '(+ '$??Hh((+`', M+`$   % ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? '  .@+`@?2[  H+ ` 2?㿀   ( ' #?#d#`#\#h    ??-! ' -@ 2 (-!' ? ( $€㿀d !  ( `' R?,-㸘 4#\#`#d#h\! ?  ,??-!-$ +-'"--\#`#dఘ!(#\#h=  ? 2 (??-"8 $ ?-"X-"x$ ? ( $€0 ( $€ //"!/"@3"" -"`Y G8- @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` - @0(`8>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x dvma_mapindvma_mapoutboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenode %x property %s length %d > %d Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.2read header: %s ELFunknown executable format %d+%d+[%d+%d]=0x%x boot: short read read phdr: %s Can't find entry point. %s%lu+read text: %s +%luseek to section headers: %s read section headers: %d %s%ld [lseek symbols: %s read symbols: %s ] bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.1.40123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %sunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length code inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-8$ 8'8(8(8(8)D8085\85x868687d8=<8?8?8@p8@x8@8(8 88 88 8 $88 888888888   8@` 0123456789abcdef/8?? `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`888Θ88\8\88Θ8(8Μ8)8ΰ58B8M88V8a8p8<u88<88|88808L8L8888,8h8t 8 8Ӱ#8L,8698B8]H85xT8c[ 80b 8Pj 84v8B8 8F 8(8C8888878S48AP8G8 887d80( 8Ҩ.8_d58Ol;87@8yH 8ҠW8_8Dj8np8*z8?8`<8 888^8;88868D8n 8<8R887 8Ө88g 8j8%84+8P`: 8@?8,tJ 8HS 8҈c8r8~8H8 $ 888bX8[|88D8s8'888 8Ұ8 8Ҍ 8Ҙ8. 18y>8=<G8(U8 `8<t8?}8@p8 8AX888T8N8d08M(8\8848TH8<8  8a 88mT&8,8@58HB8V87^8Xc 8Hj8t8}888*t88 88(8 8h8S 8Ҥ8IL8w8S8q88.`*8H=8I88W 8Ѩc8(l8_8s8x8i8$ 8 @8OX8@x 8P8K85\8 8m8T8(8-8c8t 8`8 8q&8t+ 8Ӭ88 G8.Y8 (b8w88 8( 8 8Ґ8)p8788Qd8h888 !8(48T898j> 8ҜC8(M8[8a8q8@v8gT8)D88~8m8W8R8p89848x 8 8 8 8 8: 8xt (8X 28Xl 8 8Ҕ F8 T 8X Y8 b8C| t8^ ygcc2_compiled.open_countnetif_promfilestore.9bootstore.10prom0_fakesaveechopv_putcharsun4_idprom.65dtabstringbuf.75promdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.88elf_execaout_execputchardvma_allocprom0_iclose_remprom_ioctldomainnameloadfilecd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenrpc_fromaddrrpc_portstrerrorrpc_pmap_listrpc_pmap_getcachehznfs_getrootfhnodevether_sprintfnfs_readdirrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openerrnoocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynfs_readdatanbpgdevopencd9660_seekinflate_fast.udivrootipsendethercd9660_readdirrpc_xidinflate_flushtwiddle.divgetsecsndevsip_convertaddrmyipbp_getfilehostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodefile_system_cd9660promvecssymxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvinflate_blocks_freenfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbootfile__ashrdi3crc32nfs_statinflate_maskinflate_trees_fixednoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmem ... (=   @=׍{Y( @@=@@<@`dT U=@@?(0pLl A=*Q=*Q=,ITzо b%I+NmBt{ă eyΟ)l7N¨LNZ/eQl&ʲruë*PYz'/i+Gʝn',KJwĸ5z_ǝLbw>z<9̏2:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:up=\E[A: a  6n} of!33uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2popa3d*POP3 server/var/empty/sbin/nologin2_identd*identd/var/empty/sbin/nologin3_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 server/var/empty/sbin/nologin1popa3d VQkf( (www*CCHTTP server/var/www/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3F_rstatd*rpc.rstatd/var/empty/sbin/nologin3smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp fa#==named*FFBIND Name Service Daemon/var/named/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin3G_x11*##X server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ZU proxy*GGProxy Services/nonexistent/sbin/nologin2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshde`up-( nobody*Unprivileged user/nonexistent/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobodyvm,'<7 _rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3operator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root\Vpk-( T * T_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3C_x11*##X server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucppk _x11*##X server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin3_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerdH

A0HHHHHH HHh e ePXXXph`K r r u@ u8 v zl h |, ~ xhP@(  x`XH0EEEET P |  @  @T  @h (4 X | P t< H, 0 J 4 H d x     > >p >P l t o p p q` r q q q q rƸưƨƠƘƐƈƀxph`h`XPH@80( Ȁ d2d 4    @ ++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy͸Ͱ͈ͨ͐̀͘͠( Boldface3 ">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||Gallant 3)@000` 3ff?ff`f>``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp33)  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް3P3Q23Q)3Q@a3Qp3Q3Q3R3R3R3R3R3R3R  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~3So3T`3T3T3T3T  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     3Ua?3V3W3W 3S&3U!3W0std3[p3[      H , 4`std3[3\ l     8  std3\3\ % '@ & '( '8 (P ! "1+$A'* + + std3]03]X + -H , -0 -@ .(4 ) )std3]3] 2 5 40 4 4 6` .T /D0std3^@3^h @ BT A B< BL C4 > >std3^3^ FP Hl G HT Hd IP C Clstd3_P3_x P R` Sl S S T\T LX Lpstd3_3` W Y X Yh Yx ZH U, Udstd3``3` ^ a b c@ cP a< [T [std3`3a f\ h g g h jT c d0P pP pH@80( u$ v|XP T H x x X T  -,     rd00 ] ]     ]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x (  ]x]x ]x]x]x]x]x]x]x]x]x]x]x]x v y zl  ]]]]]]]]]] ,   t]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x  @ 8 0 T  9 ; = B W W]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]x]]]]] ! ", " #p $ $ %]x %|]x]x]x]x]x]xl]xD]ո0֨]L]x  ]xl ]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]] ( X]x]x]x]x]x]x]x]x]x]xl]x ( d ]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x t ̔  p l ]x ]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x H`]x]x]xd v y   ]xl]x  x ]xl]x f0 h]x]x h`]x]x]x]]]]]]]]x ]]]]]]]]]x ]x]x]x]x]x]xl]x]]]]]]xl]x8]x]x]x]x]x]x]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x , h ]xl]x]]x]x]x]x]]x]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]]]]]]x]x]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x  @]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x 9 ; A B B]xl]x]]]x]x]]x]x]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]]]]]]]]x ]x]x ]]x]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x ! #p $ %x &H 2 % .L /( 4 P]x ]x L]x]]]]x]]x]]x]]]]x]]x]]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]]]x]x]]l]x]]]x]x]]l]x]x]x]x]x]x]xl]x]]]]]]]]x ]]]]]]]]x]]]]]]]]x ]]]]]]]]x]]]x]]]l]xRS0SVW`]x_p]x`| $ ]xl]x]]]x]x]]l]x]]]]]]l]x]x]x]x]x]x]xl]x]]]]]]xl]x]]]]]]x]]x]]]]x]x]]x]x]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]x]x]x]x]x]x]xl]xMMULYp[]xW|]xW]]]x]x]]x]x]x]]]]x]]xl]x]]]]x]x]xl]x]]]]]]xl]x]]]x]x]]x]x]x]]]x]x]]x]x]x~  Z [ 3~3~3~ %%%%h%X%H%0% %%$"P"P"P"P"P"P$$$$$$$$p$`$P$@$0$ $$##"P"P##"P"P####"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P#x#h#X#H#8#(##""""P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P"P""""""p"P"Xޭij)hTGCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease)GCC: (GNU) 2.95.3 20010125 (prerelease).symtab.strtab.shstrtab.text.rodata.data.sbss.bss.comment@`[|![),H#W/33DP533DPȐ:3DP1+3u{C