ELF@40g4 (X@@0f5԰0P xHP rHP nHP jH`HzHP ^HP RHP XHP RHP NHP JHP FHP BHP >HP :H  H H H  H  H  H H H H H H H H HP @HP HP !HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP )֡HP *ҡHP +ΡHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H0P  HP  rHP  nHP  jH`HzHP  ^HP  RHP  HP  RHP  NHP  JHP  FHP  BHP  >HP  :H   H H H   H  H   H H H  H  H  H  H  H  HP qHP  HP ! HP " HP # HP $ HP % HP & HP ' ޡHP ( ڡHP ) ֡HP * ҡHP + ΡHP , ʡHP - ơHP . ¡HP / HP 0 HP 1 HP 2 HP 3 HP 4 HP 5 HP 6 HP 7 HP 8 HP 9 HP : HP ; HP < HP = HP > HP ? ~HP @ zHP A vHP B rHP C nHP D jHP E fHP F bHP G ^HP H ZHP I VHP J RHP K NHP L JHP M FHP N BHP O >HP P :HP Q 6HP R 2HP S .HP T *HP U &HP V "HP W HP X HP Y HP Z HP [ HP \ HP ] HP ^ HP _ HP ` HP a HP b HP c HP d HP e HP f HP g ޡHP h ڡHP i ֡HP j ҡHP k ΡHP l ʡHP m ơHP n ¡HP o HP p HP q HP r HP s HP t HP u HP v HP w HP x HP y HP z HP { HP | HP } HP ~ HP  ~H ġHP  vHP  rHP  nHP  jHP  fHP  bHP  ^H H HP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~HP  zHP  vHP  rHP  nHP  jHP  fHP  bHP  ^HP  ZHP  VHP  RHP  NHP  JHP  FHP  BHP  >HP  :HP  6HP  2HP  .HP  *HP  &HP  "HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ޡHP  ڡHP  ֡HP  ҡHP  ΡHP  ʡHP  ơHP  ¡HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  HP  ~H 0P  HP  rHP  nHP  jH `H zHP  ^HP  RHP HP  RHP  NHP  JHP  FHP  BHP  >HP  :H  H  H  H  H  H  H  H  H  H  H  H  H  H  ޡHP  HP HP HP "HP #HP $HP %HP &HP 'ޡHP (ڡHP mHP ҡHP +eHP ,ʡHP -ơHP .¡HP /HP 0HP 1HP 2HP 3HP 4HP 5HP 6HP 7HP 8HP 9HP :HP ;HP <HP =HP >HP ?~HP @zHP AvHP BrHP CnHP DjHP EfHP FbHP G^HP HZHP IVHP JRHP KNHP LJHP MFHP NBHP O>HP P:HP Q6HP R2HP S.HP T*HP U&HP V"HP WHP XHP YHP ZHP [HP \ HP ]HP ^HP _HP `HP aHP bHP cHP dHP eHP fHP gޡHP hڡHP i֡HP jҡHP kΡHP lʡHP mơHP n¡HP oHP pHP qHP rHP sHP tHP uHP vHP wHP xHP yHP zHP {HP |HP }HP ~HP ~HġHP vHP rHP nHP jHP fHP bHP ^HHHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~HP zHP vHP rHP nHP jHP fHP bHP ^HP ZHP VHP RHP NHP JHP FHP BHP >HP :HP 6HP 2HP .HP *HP &HP "HP HP HP HP HP HP  HP HP HP HP HP HP HP HP HP HP HP ޡHP ڡHP ֡HP ҡHP ΡHP ʡHP ơHP ¡HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP ~H >+h;8;;;;; ;(;0H )@`  >+h!  >+h;8!5 >+0+0;"+*+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >+h 9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->+h %)>+! %"+/> ->+h+cP> z!T`"!T#t@> |#;x ;"`;" @[4@OҊ@@2 @ 0P -@ @ @"P/> P->+h %)>+! %"+/> ->+h+cP> z!T`"!T#t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Zt x ``-`ׁ @Zݐ tx ΁ )>!@!P -@ @ @"P/> P->+h %)>+! %"+/> ->+h+cP> z!T`"!T#t@;x;;>!! ;`#h#l;;;;@``htx ;`#h#l;;;;@``htxm )>("؀@)>(#T P -@ @ @"P/> P->+h %)>+! %"+/> ->+h+cP ;`@;h#t;x;;;;;`@;`htx' />->+h+cPۜP -@ @ @"P/> P->+h %)>+! %"+/> ->+h+cP ;`@;h#t;x;;;`;;@8;`htx -?P -@-P -@ @ @"/>/> />6PP->+h %)>+! %"/>/> />P;x> z!\`"!\@;,/,;@ ;`,;h)> (!#pH  p@  "`@`E <0x  +?P`-@-?P- %0P -@ @ @"/>/> />6PP->+h %)>+! %"/>/> />P;x> z!\`"!\@;,/,;@ ;`,;h)> (!#pH  p@  "`@  0@@W<`x) `E <P -@ @ @"/>/> />6PP->+h %)>+! %"/>/> />P> z!\`"!\?P * * ;`@;h09P -@ @ @"/>/> />6PP->+h %)>+! %"/>/> />P> z!\`"!\?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@X`h ?P `*  P -@ @ @"/>/> />6PP->+h %)>+! %"/>/> />P> z!\`"!\?p " ?P "  ;`@;h@Vޚ`h ?p " m @/>  @̀->+h $)>+! %->+h+cP->+ VP @ H ,@`#>+ah$` (08 @̀;)>+!0+0;"+0+0 `# @ 05-! % >&t 8 >0-@0=`"-@-@0 `# @ 05-"Y  ->+h%- +cP ;`@;h #t;x;`;;;;@~;`htx ->+h& 0Ʀ! H,@` !`hpxX (08@HP @̀H,@`%>+h $!>+!h`8 (0 @̀@ @̀  H ,@`#>+ah$` (08@̀2>?@ @̀;'>+0/0?"/0/0 `# @ 05-!$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#>+ah $`!>+!h`8 (0@̀ ->+  @wP->+h"/> )4ΐ  ! H,@` !X (08@HP @̀>+ἒ `?* `"" * `@">+ے  * `@&* *  ֊@* "``(  +a+x +x  c  mt@ >   >  @@   >  @@ #>%>  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%b@>+"!l *>+"!!`>+"!H(  /  ># |==>+H >+"!> )"> `@"@!> $ H``> -"`x !>%#!>&#$ $ >%# 2> " > " > "!> "!<>#"">#"">#"#D>#"#l>$"" >$""H>$"">$"">("#>("#0>*"!@A@Dd#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP    "%>+> >+"  ">+>@ >+ !h>&b$# !h>&b@# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * >+ >@ *>+ h>&# @" >+h" >+h"   >+h4``6 >+>h:H"(o  (5<`!4"j j ` *@  ( !h> !|` (08$2㿠@_>+al` Ъ@@>€"Т@: H" H*/  dh>+h>'a`" `2 `2`2" " ?" ?@>'al" Њ@" "@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"`2@"" R"`2@"" "`"@"" R"`2@2J?*>+ah>(` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >) "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a>+a """"""""""""""""@2?# * 2  ac  @ a> ?耡 @ 3 >+" c@  Њb@&""""  > c@ @: " longjmp botch `&"`㿠>*@{"T6 0$PPxPd ӜӜPӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜӜ H,,dl8    2     2 㿐 0><`8@Ȕ% 2%  @^ܔ &% % 2%   @^Ӕ &%% >% 2%4>@ !0P >1>!@ 0H * %,>@"%, @j  `. ڐ . %,*"@ *`"  ڑ*  , @Y* %4 . . ڀ`   &  ` & @.%%2  6 `6 N6 b& t& l& x@q  H'> @ɐ>+"*"@ @`*`㿘 ` @ Ȑ`   Ȑ`  !%4` W>>*"*`  Ȓ  ِ Ȑ` ؟ %8` &%8  %8` &%8   %8  Ȑ  &%8. .    .     Ȑ` ԟ  Ȑ` ڟ  Ȑ`   Ȑ` ۟ %4 @I" Ȑ` ԟ  Ȑ` ڟ  Ȑ`   Ȑ` ۟ %4  ` ؟ 㿘 `@> @"H Ȑ`  㿐!>1 h 2%> )>"b`#\ P  @  $ h% 2  & & &  @$ ̢ @E! "@ ̢`@`@0= .%6% "`, @F ̢ @.!  "%    $ , "`, @1 ,  " "  "`, @#,,   2  ̢`@צ@ ̐! &$@ &$  А`:  %<   : `!`*%?`*** ̀@@`  .%   %4  a0 IА#0͐"0 .%@㿐`    ,   .%`  2%4`А"@ >+ @ɒ#>+%b"  @# @`%4 2  Ȑ`   Ȕ     ֔     + %, @ ,`"* %,@* &`%8    2 %4  %4 2 %8"?%8  %8     Ȕ   Ȕ   ` "O`M%8 B`/`D &%(&%$`'%$%( @    Ȑ`  Հ @2 %4  Ȑ` %4  `  %4  `   Ȑ`   `D`/@6 Ȑ` A  %8 "    `  ` .`,`D`,`M`*`N *`D  `..`.%8 R 2Q  &%(&%$' %$%( @    Ȑ`  Հ @2 %4  Ȑ` %4  `   Ȑ`  `!% @ 6%.%     Ȑ` Ÿ  `@0! @  ` C 0`" %! @ 6%.%  F0` B 㿘H /d * % > )"@ &` H 0㿘> 0   `@? H / * % > )@#"H 0` P@~h>;`bx@\`  &`  㿘  ` `0*   @ `,``  Y4$  @[N  2@~4$ > # <$H /d * %  $"` $  $ ,`` " H 0~ 2$ M  $  $ D $  $ H  /  $ D $ @ $$ H, LH /d4$* %$`$ `"%`  $ e  @RH 02  @ " @  @   @  㿘"-  `@ "`H /d * % @~H 0` "%  @ <#贆2 Ȱ 㿘%`" >@ǐ"p```   *     @ ` "`0 @  !H /d* % ,     b &> $  @ZW   H 0@@}5$  < $  "` $$ , " > # `$   "$  ``      H 0e@`5,`M  2 H 0V@ * *@ 22   @ " *@ 2  , , * " ,`NH 0 `    , @``& 耢`2@`"@@``"`& `@"@` ?$` & 0`2&`㿘``/   * @|  .`/  * ,`,`` 4   #&`D&`@&`H&` &`  $-         2, @ , $  쀦@2 G0 &@ " & &  &``  &` % Ð㿘`` *  ,     G@ ``L (2 `, >*`4"2@w `, 2``L,`X` @  $`, $`,`L > 2`H`H$`(j0L$`(``$`@H 쀦@2 `,% &  .%l`, 2`  2`  2`4 , "  `"  "`   "@@Y `* %H /d * % @rAH 0㿘`  `*  ` *8      `2`M*`"``M  ``N*  "` " `?*``  ?&` @``"`& @`"㿘 Ȑ`  $   㿘``>0%$% %% @@" Ȑ@€ %4` * .  @6  Ȑ@€ ,@`@& ߀ % `   Ȑ@€ ,@ Ȑ@`€ %  @6 %  Ȑ@€ ,@`@& % $% 㿘  Ȑ`@ %4 2   Ȑ`   & ȁ㿘e4   ee0  e* *@>"@:`` ? `.   @, `      `` `    ,e `.@  >#(@`v`,e$` ````+`e,`@{d . "* e,@{\* & e8  ` 2 e4 e4 2 e8"?e8  e8 `  `Ȕ  `Ȕ      `Ȑ`  ee @` @ ``   ee @` ,e4e@ $dH$d`   ee`@  `   ee`@ 4e,e 㿘% 2$>#x@t 0"%% >#@i %&% .%%  `  % >%#@V @ 0n% `   ` %% 6%`A0.%% 2%%    `  ( `       `  `?`2 % Ȑ`  0* &%   >!x>   %  *  `">*"ؓ*` $ 6  @r' $>#@ &$ ! $ $ H " ( .%% @"j  " %` @ƒ  Ȑ`     ,      +       i  M  ` N*  ", N" `?*`, N, M *`"` >` 0@ % .%  ,  %8`  Ȓ   Ȑ`   Ȑ`  w%>` X@j  ,  $$ f.% !b$ $$ @$]$ H @&$ HX&$   " 0  2 ,%  , ,%<  "% ``|( %,%  -,; @y , "* %,@y* & , "* %,@y* ,% 2 %< 6 %?,   ,  ,    %% @`.%6% ,% .%  `+ %, @yU ,`"* %,@yM* &`%8    2 %4  %4 2 %8"?%8  %8     Ȕ   Ȕ   %> @ %  2L,  @, +@ %,c @y ,`"* %,@x* &`%8    2 %4  ``%4 2 %8"?%8  %8     Ȕ   Ȕ      V,@p >@J  @p >@C  Ȑ`  %% @=`% 2>%`2 >  ݐ/%%  >!8@  Ȓ6% ʖ %!x@  Ȑ`  %% @ ``  %% @` .%6%%  `   Ȑ`  %&% .%㿐% @$ "!% Ȑ`  6% &% > Ȑ`  %% @% .%@ 6%! @'% 2%4% %    * 6% 6%6%&%@"% %Д ƀ"% %"r  % "%%     % * *@%  *`% *` % *  % * % &%  ,  +@ %,: @wْ ,`"* %,@wё* &`%8    2 %4  ``%4 2 %8"?%8  %8     Ȕ   Ȕ   ]%      % * *@% *`% *  % * I&%% >! @'A  %  9*@ >! @'J   M% * N% * (&%  % .%*@   *    , , *@   %   *@ *@  % .%*@% &%%4 2%%]% Ȑ`  0A%@@8 Ȕ% '% @    Ȑ`  Հ @2 %4   Ȑ` %4   Ȑ`  Ȑ`   Ȑ`   `@x `@ 2   € . @€ %4 ` .  Ȑ@€ .  Ȑ@€  . `$`" ܟ@ ܀ ! ݘ  ܀#&$ Ȑ@€    `   % > @/"  쀢 @ >"@  0@D  ݀ @ @€    `  e %  2L ` "`,fD @""%% "% .%9 >% $@"8 Ȑ@€   `  7 % ` .% @ "A  `@?2 > @Ȑ"x{` @ 2  ݀2* % "& $ 2$$ >% ܐ" ޖ #\ @  ݀ 2  ܖ  ޒ `?`H#\>$@" ݀ >#0@ $   Ȑ`  %% @ ``  %% @`.%6% ܀   6%€  `   Ȑ` D %?`g>*#*` ` "`,` *   Z 2  2 4  8 * "@`"  "`  "@ @R  24%` ``  *  .%  , % 2`>#P@  ` >@#p>@#@w` >  "`, & %`>*#x*` > @#) $  >@ݐ#>@ؐ#%$ ͒  € > @Ȓ  y? Ȓ € >@ 0 ?l ܀`l %6% 6%6%.%@w2` 䀢 $@ " & &  $``  $` & $ `.%> @#BΒ   $%%4 "% > ݔ ސ 8$#\@v ) @.%  %` .%  %%8 " %%4 2%% .%% o> ܒ @N  7 0 ` 2 ݀`2`>@0   ޑ* `>*#d*`  Ȑ`  `2 $ `M 2$>/ Ѐ >* 耊`  `  %% @`@.%6%    %?, , % .% `M   `  %% @a `  %% @ ` Ȑ`  %% @a.%6% O&$%8 " %( @€  A @€  > ܐ   #` @#\ Ȑ`      %%`@ 6%.% Ȑ`  !%8 !%(*  >!H#\#`2 `@ !&$`@ &$`H.%X&$> ޔ ` @! Ȑ`  ѐ ,% D  ܒ `.%> ݐ! @h  % >" @^ %%  ?,`L% % ?>` ! $ $`H`" ( .%"H@B  &%    0V>"h @5 v % 2>`2$>@" "(%  "%44Y Ȁ >&#" ! >#>#%&$ ܀%4 2  ߀ 2 % Ȑ`  %`  .%  $ >% 2 $> ݐ" ޔ @ݒ $$%@ ߀ .%`?V   ݐ" ޔ @ɒ  &$@€   `  %8 C`/`D &%(&%$`'%$%( @    Ȑ`  Հ @2 %4   Ȑ` %4   Ȑ`  Ȑ`   Ȑ`   `@  `D`/  Ȑ`   t&$ Ȑ`  $%@@8 Ȕ$' $ @&$ 2 $ Ȑ`  $%@@8 Ȕ$' $ @&$` >$`     Ȑ`  Հ @2 %4  Ȑ` %4  `   Ȑ`    Ȕ `  Ȑ`@ 0B` .%  &$@ R0  .% * @:B%,@rT 2В@@@ '"@  ? `@ 2_ @:+@ @$  $ Ȱ 㿘` 'А @&`&`  쀦@% >+ Ȑ`  %%`@ 6%.%>+"q'@r#@s?`0 p  ``0*``@i  Ȓ € Ȥ ` @ >#8>#H %>#\ #P#`#d$ #h$#l$#p%#t% L#x #|@^ HH /d4 * % @  >@M#ؐ7 0!>@F# $, 쀦  $ @il>@0#`  В`*  $ БH 0㿘> # =H /d4 ̐* % ̤ 2 !  "' 6 2  2 4  8* $@`"  "`  "@ @N]  `@Ԡ @H 0>+"*"@  0@rw*`㿘 Ȑ@€  . @€ %4 ` .  Ȑ@€ .  Ȑ@€  . `$`" ܟ@ ܀ 2! ݐ &$㿘@  ` S>?!>?>??&% 0c" b&!` &!p&!d6 > & 0&!@(@4Ґ" 8&"" @!  @ @" #>@ @@@" >@ " >    &"&" &" &" &"&""@; @4~"H>@D8">"@> H>6>@!  @d/ &">@" x" *&"" *`&"ܑ*  * &"&"&"ԁ㿘H o*@ g@ H 0h ! 77"I"H* "K"M+ "J*"L@  77ސ 0@/7"&""&"Є@"07&">&"Ȑ?* """ 7037?* "`7"Ԑ " 6" ":""؄@"`0 , //7Ԑ 77֒П@ " f"  ", ""܄@"`00 /7̐7/7Βȟ " f㿘"x  㿘"x  ِ d"|`""@""x l"Ԑ"  "x, 2"x4  켐 d"x  a" "t€ !"?"t€ !"x !B 6  @ ;6 @ 0"> @< "`@㿈"t€  ?Z "x  "x  @  Ȓ`B > ( `B > (> @!x0  > @! B> & $> @! ȐB>  Ȑ ""Ā @ 2  > @Ԓ  a> @͒ ]  > @Đ!T ,?@"*` ?퀢%I@   @j   = @) 9   0 $ $ $ ` ',쀢  @&   쀤@    쀢 ( ' $ 8 $ "l %$@ج쀤 2  `B >  t`B >  @  0@1[ "` :/77 "" "ؓ, "d  d"&""o V"Ȁ`@ ;:6  @>! @0  @>!@@' 0@=h "`"@@ В`B >  > !P@  В`B >  Ȓ`B > Ȁ`` `"  В`B >  `B > " " "А?&""Ѐ  , "ܔ "d `"  0@&""Ѐ "6  㿘>  @a B> 㿐 \ $@ @tܑ-`@d   > \d6 \А!@!D "Z$  &!D&!H$ !L?&!L "N$ D @" -`*    `2 @ h@ 2 ;   <p" <  6 Z0 /77` x  H`@ " А  $ \$6 \$́㿘H /f * '  0@/%   H 00`a2@a1@5a @a@"\K 0!5@;0 !6@7 0@\ 4\  }@M02@  2\i\ ?'4\ 2 @h0 @1@2o 4\ @   " "@4' H 0㿘5㿘 \!'<6`6`6`6@"  @*T  @1w 2 *2 @  *@ 6@ 2   \ = 6 \ \<"6 \6@6`6`6`㿐"'@@㿐"'6㿐"'@l㿘 $  4 '> >1> ""a$  $ @I   >1>@Y"05>@U"H@Iʒ 0. Ԣ $@)$  @I ؠ>@  @q ሑ,`" $$ $ $$ $ > +   $ "@" @v @ `@ܔ 㿘`@(`>1 `&`&`L@|`0 㿘?2  > !Ȓ@2`@6( > !*` `"! `Ѐ `@y ` `` +      `(@ 2  B @ir    㿘?2   > !Ȕ 26 > !*     @(]  Ѐ `@<    㿘>A>"L#@ @KE㿘>A>"L#@ @K9 㿘 D? 2`  2 > a* @`9  p 5 ` <@mA ( . @{W  (`Ѐ 4#     < t& @`̗* "  @8`  0   H @  H @"& @& 4 0 <(& 0& @H /d * % @H 0㿘?  2  2`> !*`    m@"@  s@" 0e`e@;`r@/ 0 "@z   h@3 0 e`g@~`f@ ~ 2``Ѐ w  @G! @q`奔!@Ha f `Ѐ a@a ] `Ѐ X `@!` "`*`` "L H E `@z0 ? e g@;? 2  @?`4# @ `* * `>A@2bL&`Ѐ !     `Ȕ  0  `Ѐ    @N  㿘@j%! "&(&0`̑2 &,&4&8 d&8>bh@(  6>bx@( ,   6p&<. !W&&6H6r6J@u4? 2`  ?6  +  *6>A bL@1G㿘`><! @왖   & & &        㿈0"@ > @E &  @S @] 㿘  @F  2"   " >1쀢`""`" " 㿘>1 쀢  "$ "@ @GE  2㿘>1 쀤 "  @'` 2 2  >1쀠"  2  㿘  㿘>  |   ?>  !!̀ 6 @6  * @> !#*` 㿐>  |`!> !̀ `@B$!̐ @%  6 @T 6  `*`> ! #*  㿘>1  >  | > ! * c* `@  㿘>1 ">  l | 2  3  `*`> ! #*    㿘  b@1>1   @Oh  2 &  >1 ">  l | 2  0 `*`> ! #*  @㿘>1   >  | >  >  |@ 㿘>1 ">  l |   > !2 `#*` * ( ,   €㿘>  |` ``@㿘!>  |   €  | € 㿘>  | !>1>1`?"`  €   $ 㿘>  |    ()())()T)T(*(+++++++++++++++++++++++++++++++++<1l1l111111㿘  @  *@F>1 ` !? l  ? 2: 2  3  *   * `* >1  a ?,  A  렄? `*   $  @2  `*@&㿘  E >1 ` !?   ? 29& 2  2  .   `* >1  a ?,    렄? `*   $& @2 &㿘!<! >F$@ia`8 8  *, $"@    6 6&%&!*  * * *  * `@㿘  *@䕐!  * a*@ "*@ @㿘!    `@@ߐ!  @ ! @㿘 `"!@!  &!% 2     ``*R% &%@ `@㿘H /d4* %  >@ې"0  `0> " @Ғ   & ! 2  !$ * *`@" ! @ƐH 0㿘  0  `d>@# H /d`* %` !  >  #H@ ~!  >@x#p   ! `8$ $ `?#  4`  `# #   #  $# # # ! $!2$$! @e2 H 0㿘! ` @ ܟ@! ,  $,, 20&! ` " `!  "$ > "!&!  ` " >@"#$,$`&!&! `$`*`*  ">`#`@  $,&! `$`*`* @" @h` $@!&!`@\%$&!㿘  ` @$ *"  *  !  ! !$ $@ - ,  a 8  2 `   `@0&$&!@Y! "- ` k> @#!% 3`, $"@&! @ ` &!` &%&%&!&%&%  0  > @ L=$, &%&!&!&%&%&%`  $! &!/&% ," !&&%" `  ؀`" ` !&` @` " ` `"`@`  >+"%@eĒ#` @f @C! "Z$㿐 )>1 @! `>⍐  ɀ @2ℐ    > h `   *@"  >  @ 0.   *@! ^  "  `> @  >1* *  a? @  ֠? > @ے U! 2  >   *  />! @Ē >! ,* $@0>!&!  &! &!!&!@&%&%&%&% *   $*@   `" @  Ȗ0* @@ K0#!0@ !   &!*@א    &%&%@  * *  *! ?&!㿘!a  `*`*`*H /f * ' ` *@` *@` $`ᙐ `? @ ᑐ ` @ 2 `  *@` "``*`*H 0ܐT *`*H 0` * `*@`*` ` * Z` @'a?Q ` @?  `*@D ` @2`` *@` *` *`*` `*0` *a `` $*@ 㿘!    * % ` %Ģ:D$@! ?&!%&%Ģ  @ @ >1 ` !?    ?   2   2 "!% 2 !   ``*%! `&%&!! 2@ `$ % 2 !   ``*%! `&%)&!= ` `%*  &%% `  (:%`27%`% .`$  % 2 % @"$% * >1  a ?   Ǡ? 2 *@h%` 9>D#P*` ]%  %   ``*V% 5% "9!H `  B!% !=%  &! 8&!%   >!`@ܒ %>!@֒ % 2 %   ``*"%  &% @ 4( % ` &!   ``* % &% * >1  a ?   ܠ? 2 *@ޤ㿘  !  *  @  *@%` %%@zP$@%% &%&%%%  *  &%&%` 2&%>D#x*`  2 >(! :     2  .%       .% >"@:  .% >"0@2  %J&% @M>1!}  @ ?  2> @2   28 2 %% 2 % *@^ %&% >1  * * O  ?  2 *@ `4 % p` *@`"㿐!   *  /  *`// ///     @` $ ,!% ` &!   ``*% &% 㿘! ` @`><"X *@4  j !  `>1`* @ >"p@z 0[2   @>"!4` `   9  2  ; >"@T $! "  !&  @) `*!   Ԑ!! !@ " $!$!% ` $!   ``*{%  $%㿐  ! *@ H  >& @ "Ё 㿘!  ! m @ @>@" $,X` @>1` !?  ! D> -#@= d ? 2   >D#,  7/+':#>#h@!% ` &!   ``*% &%>#@ `&%`")    @ " ! &! @ ! `" %      ``*% &% >#@p %      ``*ݼ% &%`^``!>`&!#@S ```! `># @B &!!$(`2>1 a݌  @" ? >#@&   *  * `* *  *  &%&%&!&! &!&!&%&%@@A0ADA㿘?@5>   6.`&``.dϴc3 (g.`ffa'. (`(/`@`> (?0`&?Ğ0 @X/> `L` @+!> @3  @42`(%-`"@%@3# @W /  //  //  @ ////&@ @@ΐ``@_ X@_ 㿐> !Ѐ > .  4@ . @! :` ` * O@`#@`" # & & 4 4 :?  :?# :  :  : :2 >1>1!$a(" :  &  0 > x`B b:x$@$`$`2 2 %> @2m>1a$>  4`@:<>1(@  #a$2 "> p`B :p@2e0;"> * @" "" ` `, B ; ` a$`B  ;@(. !!   8@B ;B :  >     > " @`M!@2*㿐> @a'!#> b`h> B:`h@2  1>1%> ' '@2 b@@B @!> ! @. @1ِ>1>1(!$>    4@ <"("(2`> & @1ѐ 㿘> , @B :㾘@ ֐>  2 `8 '> @1%> ` `2 !> `$ ( !> >   @Q!!>  @-!(@  <`C>1B"a, 8 8(@$@1>  㿘> a  "a>+"*` *> "@ !@_*`㿘#> aЀ 0!> > >N!b0@_ > >O !@_y`> 4  @ @"   $ # > ""@]n">  4@]j$>  @]f!>  @1(   $aЁ㿐!> @1" >  @ > >1!,`B :#!,@1# p!> @1  >  @ > >1!,@B  :#!,@1  Д @@$@Ԑ@] @]!㿘rh!> ϒ0@0ؐ >  @> >1!,@B :#!,@0ِ 㿘   8  @_ @^? 0     㿘` |  @9ߔ o8? 2  @`V>M *` O #> ` G #>  X> ``C :X> @! @X 3` 2 8> `B :" `& :`?c ,`, $  S  @O ` 2`@:$ 㿘`A`? 2`  2  >   2 > @a㿘V`? ? >1!0> a&`8>1!@> `,&`8>  &` @/ &`&@/  㿘!> @/ > a2  "a`2`` "`@/  <" @ 㿘!> @/Ð > `,2  "`,`2`` "`@/Đ  㿘?  2  2`?  :  @8 "@8*`2  @O\ ?` , *``2 ,` , 2` ?` 2`? 2   > "!@9h 㿘 @"@$ "@ "I8""@8d @O_  "@ W b~@Sb}@ P@0P!> @/2 >   @/?&G@@B 2A 5> @/">  `@ "`"`@/)1@@B 2+ !> @/  >  " @A 2  >   ?!>  #@. > "!@A !>   @. > "@[!"@. @ @ 㿘   `  "@    x@@X^B<   p@X`"@ `@ &:@?&& h   @ '  'А?' * ' % '' `@v    X $ ? ΰ @C a\'  ' N =`?'܀ ض'Ԁ``0`4 "  `p   2 `0`t( `0  <`8  '<`8`<   @ > 8`B :8 '`p  @  "`8@`8   @q l H  `8`8  @ @ 8 C|<`8 `@'`  ! x7a\ ?`ܑ2  `? [؀ N ."ah 6 N`! @N`! A`8@ɔ`! ` @ t- `<*'<'`8 @t-   $`@@7 `@@' @ג h@7  `8  B<`8`88Z`8`<8T`81`8: $`@`<O``8@Wo:<  @  @ @   H @*<`8䀢   <`8`0 '䀢 " @ @@ևԀ`` ?@7C @z$`@䀢  > 0`B :0 Ԁ `8<`0"5`@@В @M  % `@@X@ @   А@` H *@D% `5 2А@  " @903%*@` @@΍@'X@ @ ڔ@΀   В @  % ' @@ 㿐  `@VT   `?@ @K '` H @ & '㿘>+">  9 @L(> > "b,"0 㿘> 0 > "(> 6` @ b,* @ "  @2 @2   @ > 0 2  㿘>  b(3  >  b,* @@`"` 2@` 2@ `2``2"`&& " D @4(   2   㿘    @T$  @㠒 㿘  @ " @p&  @6 :$  㿐  '  6`6``@     `.  :,􀦠< H 26  @`!6` @2 ` @6`  2 ` 6`  2 ` 6`  2 ` 6`  @2 ` 6`  * @&`  * @&` `&`!m6`&` @A㿐'􀦠 `@   `*  :Ȗ 􀦠' H 2! ` =@  @  @`  ``&`&` @`  ``&`&`  `@ ``&`&`&`&` @㿘 'l '    &`&@H 8X. * "* "`  @X.* @, : & @X$ d@X ? * @,`,`* :`& *  @X"?. * *" * *" 0*  ``d ,:`*`" *  * "&@&`   * ( Д  㿐 ?/  /  /  / ߒ / ے  //~   ( *  (` (ZZZ4ZZ<ZZZZDZZZZZZZZPZZZZZZZZZZZZZZZZt[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[ (@2  *   (@*   *   (@*    (@2`"`㿘>@vʐ H@5 㿘  `(`$G`0`2 `,6  /,@ ` > ` ` ! >U#ē*`   $@ `$@   @Vp> !"x> ! "  >@v h`,`,5   @`(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N > ``  >V H*`   > !"x> ! "   ?>@v> `, `(@2*``,2`@  ` ?`(&``$""@&`$2`$ܔ`$&`$ `  ?&`㿐`(>```,`$@#" N !   !`ah  #\ `( `@`$0`( `( 2@   (  *` (` ( `"`JC  `( x0"`㿘  (  2 "@@`  @Ui   @` @  " "   -@ڒ`.` 2  "@@3`  @UC   @'` @  " "   @``@  " " ` ?&` 㿘@P     `( (   `*  *` `( ( ? 02 ?@ ?  0?@ * @(@@ `  `㿘 `? @`@&`!X`  `*  * * : :``  ` *  * * : :`` $ `*  (* "`㿘  2,   `  2% ` 2  >` @ 2   2` >`@  >`@y  `" =&`㿐 `!`' `!ah@ 2`  *`  *` *`T "d`!`  ` )&` `  "`L@L@2 L`L @2 €` # ` (`@`: `` >`; ``: `4 `0` + .``8 B<  2` ``@QP   ` ?@  H``@  @M  2  €   2 ` '>1''ܔPNX6  !h x`!7'' '''ܐ !@I>1` !IJ` ?'Đ+`$  7>1'6'''Ĕ@' ` "#>&ad`@|     1&ad`ؐ@s  2?"'>1'ܐ"? 㿘.     ?.>1"Ѐ"  ?* € . 㿐Leג ;) ;Y  А R,`* @ ?Ѐ .@*`@ ;$@    ? +"@ )"@  ! . ; 0 ;   ??? 㿐`\    =. `.X  ;` .F6{z{zz{{z|{> 0 > > '#,@ۅcа  >> )"`!> @}"` >@r!06>>!@aH@7| ."`'|@  | `?"`@||@0G 0> /"|"` 2|"|"@|"`@ 0|@ @ * t  `$`@} @  b @Cp @&(&&$&&,@֋ e< "@Y\ > ! c& @OR    `@ `@! @0: @`$@@2  @0  @   `|o Y| Z`@@Q$ a|d Y| a@@Qڒ$ at t@R 00@㿈   '`$ ''    @ ~@ > "`u ``  @# i耢   ?@ ^l (p ''0c' ?@y 2'  7 Υ:  (?@ć > HaX @a  2  " 4 :0 - ''&l '`X>a`@:  " >ah@2  " >ap@*  "  ` 2  @Ɣ'c @Ɗ'? * b> ?   9@.!l@Q!l$`P a0 P* @ *@ *@ $` " ` `* * `  *` $aT ` `+  * `@ @ *@ $aX$ah`$`@ ̓$`?$`0`&0@9&b&`` `$ &`&`$&`($`$`$` l (  aT` *  : `?@þ Q H $a`l l ?&l`0 "`0@'l  $@` $a\ $a\a\ #!`ˎ "` ` `*  *` * $aT  `*`  * *` $ah$aX0 %0" @̐   "   @ @ż   耢   @֔?`@.  9&b㿘@Ǐ($`D  , :($`0$`<<`p8 @M $`@@@ `>`HaX @  X T cܕ, K? * b B> (@  8@  2 " 2 "  6&p(0<    B  6& .6&0  @ B 6&. !W @ &&6&&6r@Z6 `0 $`0@( 㿘6` @ڐ b   ?" @8 @ @-l 9`$*@$`$$b㿘"!0!\ `?@M -㿘"  &`&`   ;  0>`>`0@ >`>` >`( `} Z!`y Z!taDu t&`t  㿐 `` &`  &@Z & F㿘 @ 㿈"x &. > "8 @v  &" :@,6 > xD @* "`$$|$  @: ""2K'6@ @ F>$!@`!  @ F>!@oE0,  :    ?@  @@J>!@o.0 H @ @ " @5 > !@o@  F$  @ؐ$ 6@ 7"P2`  `*" <>Z *` @G -01> "4" 8@@ > / $ " b" 8@M@x$'p@ tT: h  l `@ "`@ &  2@ "`|"`㿘"@`  `0`4&& |||||||00 H*  2+ 2' ,2# 42 2  2 <$"  < >^(      㿘   o   <@`   `$ `$ ` /$ T`$ `$ `$ `$ ,`$ 0`$ 4`$ 8`$ <`$ @`$ L`p< `p`t@.  < 2*   @*{$      $?'''''''''''@Y耢 А$ < @+  $ D$ H` $ (`p< P <$ 㿀  ` +`` 6  @˜ 0  % ` '@J `  @`&@8 p@b    `;  ;    D`B >@<! @*  .  E :. !"   >  @J-E p  2 t 8?;`#\@ߚ!@*  ?@ƚ:@&@8 |H@@<@  ` p@ `  t@`0 "`0@ `  2a`   E  㿘``* `  ? 6`#0`@* &#@#D`#H 4"@&#@?#H`?&#D&#H @?#0 2>#8 㿘"" N" =`?  " !! 2!@ + ""!  # ! 2%.!   # ". "   ?  6"#(!># "  #(>#" 㿀#P`   @)' '쀢 ,!, ,",!, $#0 $#D 2 '* @( $#D$#H $#@<#(#,   ݘ @) 0p   @  "#(@&#(     H 8#(  @ @ 8 Cm<#( Ӹ4p  ` `!," ` $"t* $"#(  B<#(\ """`<,"#(5>b0!@ ѐ " ` L`!  "," 2 \L`! 2\ ,"`!` ``?h `#\ m,"\ 2#(#(" #(8i#( #,@8c#(  \  ,"ΐ & ` @(ߒ  #H""@" "#8@q#8> #@@("㿐   `!\ " h ?`?2*      @  5 `H   ( @> H   > .`#> .@#@fn    > . #> .#@g@ 0!@  #  @>4> .#@g0  " $  "" "㿘  @B @Ԏ 㿘  @8 @Ԅ 㿘    @&" D㿘    `@& D㿘` |<? >@i"8 p h@21 t t l@2, t  h  l p@L " t 0$ 4($ 0H /d * % @PH 00,?2 t H@J <$ @ t?2 H /d * % @1H 0  >8` $ D8*` @ 㿘>@jL"P 㿘  @% D >^؇( \     % $ "     㿘'   @Lm d  @Lg!`? "aman 퀌   @LW d  @LQ!`? "   8`   6  >"p  @ ` @,` *  *`" *  *`& . h> 0"p!T@J6!@L!`@L .`'  @L  d  @L!`? "~~    @K d  @K!`? amal܀6@  @K d  @Kߒ!`?  '̔@       @ $@@  `.`.`@Iݒ..`@K.@I֒ <.`@K <.`>2t  >2\ t> b<8"b<t 㿘@ݐ 2!@ $!< @SF2  @2  2   " ,    㿘'T?\ &> z *   " $" &   &> z *" "@2   '@`'@  `'@9> z Ф `8 @ "  C@  @ @* @ >i* "@  & *`  " $ $ `$ @'$ @$ $ @"> @* @ѐ >i* "@  & *` " $$ $ `$ @$  @* @ >i* "@  & *`  " $ $ `$ @$ @$ $   8  T @ >j@ >j*`"  `& *"  &" " " " @" " T"x  #\#``#d#h#l @ 2`  'T D ''P'L''''@  'd   <   ``@L@V!   X $  ``@7! 2`x  4 2` ݰ  "` ,  @$ 2`  > z ԅ.8 @ x"| "  "`@ @@ @L,@T"!D "@@O;> z` .`x8 @ |@ `$`  't  " @  @ 't`$@#dt#`#\t@ 2`$t#`#d#\t@ "\ t@ `  *@"@T,@"L"D` @B'l 7'h 3`/ d dT @'d  " 'pL#\ plh  l@ p   @ "@L"!$P"`pl 'p`@à @`  @3 @$h pT@Х"x`  ` 3   '0/ 2, ?* 2  8% a H ",  ,  @#a  ?&a&a , &     #> . @a#a l  〥 ,2,",ޠ  2 >2 π΀ @>2 |&a4 . 4`?'>⠐ @   #>2`x  `x,@, ` 2`x 2,. 4, d ?'耢`X'>c#*` ` 2  ' " ?'a`#\%䀤`'䀊  a?&a(&aa  " &a &a" &a",a ?&a&a a  " &a &a" &a  , a ?&a a?2 &a@a> za  Ԓ@ @*@&a&a&a@ &a$  @" " *" ," @"" &a8&aD @#;@{a@ "> .#@aҒ@#* @` Pa@aD`'E a8  @# > .#@a@`01@ & '  ''  '> z '   ''''   ''''a<''' @@"ݒ > .#@a~   㿘,,   @" a < ,.0 &. d! @   @! a   `@2 `@`  `0 .2  * `@" @" 㿐` 4 a(?`? *a` &>b@(  2' `  @8  @ L  2` ,  @ J@ 2`*@ @*L     J@ "` "` M %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` l `` `@秐! @ؐ @*  "&`@ /a0 a(  &a(2` >7#4"`" (2 `, ?"`,`0?"`0`, "`@Aѐ`0` "` ?" a(  &a(@!  ? @!@\$  ? @ $@N ?$@  $a(  >@ $U  $ a0 @dR$$&` @˒ 2$`a(   &a(`@@˒ > .#@`&a(&a, a&a(`h@"`a" d1 a." " 4a(   &a( ?&a(a0@  ``@@塒 `> .`4@_#  @!L ?  @!E ?@`㿘 ?, , " & @ |* , " q*  @ @!) ?& 㿘  :    " @u   `  & @!  ? && 㿘` @   `  "   $ € ```"``㿈`> z,  ` 2' ` 2#  "`  @  2` A#@` $ #`` #\#d@̒`  `@㿀` 2> z ` c*&`#\ ?`  $@ * #`#d` @̩? 2(  #`#\` `@ #d`  `#h`@#l 2` 2` `  @  8  $ @ @ 㿈`> z``A`#*&```  $ * #``#\#d ?@d?  㿘<>&a&a > z ` 4 * &a ``@*```>j* "a` &`*"@ @ aa a" " "`a"`"`"` "`"```@*`֐`` * "` &`*"@ a @ "`a a" "`"`"`"` "` 㿀> >` 0" $`@D)> @Ig@Q>>b@bu#@k@SC@@@@S@#@@n@z@ *> " " "`$```$``""`$`  $` `"` % $` > b$a4> @ $`<@`<"`@"$`@ > @ #b@" "# > ""  $`D"" $`H>  bd"bd# "`0Ho  "`>2`Д  ,`5$a>,a"a## >`X`x@C>bؔ@C`> "@ " `@(k"```"@` @-G2 > "$`(@.@  $`> `b0"` b0+ ?@8  :>+"$ @ @< @4$!> z    :+    P <  8 <`  > !> $>   #@*`,>+"#ؐ $`  $a<$`$@" @+@=>@+J 0@EN@`@$@@>1 @`  @  $ @  2 H /f* '@A @U@NH 0'> @F-\#d>lb#\#`   @ɘ >@`;#@q!> + >6>  @<Җ  >>6!@5\ @> )" "> >@`#> /$!> . "$  €# "`>@`#%> #"``@ʐ #@簒 \`" #" @ʃ \> `> "` """ "`` $`"` "`"`@ $`$```2` @>V> ؒ @ ">m>@_#>!L @ ">m>@_ >!0 @ ">m>@_ >!( @ ">V>@_ 0>!@ @s >@_ P@ @@> "b>6 @4!(> `"`@>@DP>  @ '''''@  `>>@`y 0@`v 0@IX'!>   >  @;  >Ӑ+> z`> $"@ '#`#\#dԖ ?@ݚ? " $>@_9 >2"aQa> "X  -/Ԁ`Дآ@ِ s/ْڦ  *@`"@  $@  ''@? $@'В ?''АВ ̠? ?Ȓ Ȕ'''@o蔒 >! @_ 2> >@_!8>@^ݐ!P㿘> 0@ѩ 㿘> 0@ 㿘@h㿘 > )> )"#H@"cL> "̀`> >+"Ȁ ""@@7> "c㿘@. 㿘@. 㿘> 0`-0"@)>  @  >+  >+" @@ 2  @A8  >+  >+" @@ >  @A' > "̀ 2`L@k`L? $`L@DV@ t> #>+ " > )P> bА "P" "P`> "㬀> "#" "㬚@ > "  > "#@ B ``B<;####> "< 2` `B#:> Д b?" ?/!"  > " "?/!"" #"> "# "> "#@A >+!l>  *`  0 㿐@ " А"@? &- (c (c& >+, "@*`" * * >+b ?@?  "%@?@4 >+b ?@?ސ   #㿘  &- (c`(c& >+. "@*`" * * >+b ?@?  "%@? 4 b>+b @?   #㿘 0 4 0Ho  "`> b  !"b> "̀ H /m * . > #> )> > )""cH@"LH 0㿘 0 2 0Ho  ?"`> b? "b> ̀ H /m * . ̖ > )> )"cH@"LH 0㿘> 0  %> )H`D  `$`D$`@> @"> @" @  0 "`@ @aΐ`@? X$`@ L!"`B < ``B 8<```B 3<`" `@ 0 !@@a``@? 9$`@ >!h@ "`( `B < `(`B <`("`0`H" `0 ؒ`B < ` `B <` `B <`0H $`@ l> c ` $ l>`0`  "`@D]㿀>+>+">+b > > ''"'̀`' ' @7Y Ho o> "" H 㿐@*`" *  * & &㿐ݐ*`" *  * & &㿐@*`" *  * & &㿐@$*`" *  * & &㿐@> bb" &`" `& А"@@& &Ho o> "" H İŴ$(xȝ㿐!>6!> >#ԚaX#\ `  @W > >#\#a`!(  @Wy > " :  ( ("(   6 *  ? * "? @*`2,  㿐@ 2 0'  $ 0(@ @?  0 ,?`$ 0@9 0 @Đ@ސ@@㿐`@     ` A ` =>+"$@ @6 2 0&1  $ 0(@I@@  0 ,?`$ 0@9 0 @w@NŐ@">@[!h@@=x@ @` a 2 0  $ 0`` y>p *` `  `` k ` (h 0>+"$@a (@@ܰ   @) 0 ,?`$ 0@9O 0@Đ 2  0ܐ@J  ,?`$ 0@99 0@0;   /&`   @ '*@ @ ?#*@ * :` ?* :  ` & #  34 ` ̒@ 4   `'ؐb~؟ 2 0  `@' b}ذ b~  ?4 '  ؟ 0T 2  ( <& `wذ &T ` ("`<`  "`@`  "`D  @ 2!4  &`   `v` PT  ` (  2 0W W䀒@耢 6 薠 ` ? @ b  @ B ?W ";   ~ 0 z 0  8`0Ho  "`   !`0Ho  "`   @@CT =  (`E  26 0W W䀒@耢 6 薠 ` ? @ b  @ B ?W      @} @ 2  0`   0 ,?`$ 0@7 0㿘` #@  `0`,?`&`0@7`0F . `"" `0 $`0"   @ ?*@`  &` `0`,?`&`0@7ϐ`0`> +   +@@"   ?2   3 * +@@"  4$ ` ' 0@ @u 㿘.`"  @>`&  * ?2   2*`  * *#  `  * *"  @0& 㿘 .` `2`05  $`0"  * @>`$  * ?2   2*`  * *#  `  * *"  @2 0$  0@@ @㿘 @   (@@֐0 (`@ 2 0!  $ 0   0 ,?`$ 0@7  0  @ 2'` p㿘@ 2`0-  $`0T` "`(  -`  "& `@}`@7@ `0 -`0`,?`$`0@6ǐ`0㿘  >+ b$ @8@ @&: <`   <`  , "@ ?2 ?2,  2``  ?, ?2,   , ?o8??O `-   <  , "@ ?2 ?2,   , ?J8?-  .`@@6$<`+  ` +@@"  ?2 3 * +@@" @4$ @$$ &   㿘  1 2* -` ' @m* b-` "@@8LX@8D%@ `@  '` :`: ` :`: @7 ,` '@B,` ' @< >  > . -@8$ >  ?.  @8 $@ :  :  $ $@ђ '@Β '$$$$$㿐   2p> >+"$@+  @;`&  *?2   2*`  * *#   ` * *" @> =& >@V!x< `"> !@Sb#Ԗ ", `" > @ "@" "@ "`` "`" "`"  `@* "@"   "@ "@&@&0 "0 㿘> #@S'!     @I$` $` @C>a@`(>2 ʒ`@ ` ``?4`&4`$$@$`$`$`$`$`0$` $` &0& 㿘 >  @R#Q @  " @ " @   `6 & @ &&   @: `c*`@4`,` '@/ ,` & &`< :   '  &  &  @, & ,  '@ & & ,`   < < ,  ,   0?  @ "  R 2  `@ ?& 0& 4& <& 8  @` ` # "`  `@ 㿘  &?* `F4 & @`" `0 "`0$@ @9`&    @c '  :  :  $   @X ' @U '  " @ " 4@ 4 " <@C  < "> @= > #@Rޒ㿀 `o " ,`0 " ,V 2 , (   ??77 @݅ @ , 0 0@4& 0N  ? &  0?& 0D  0` & ,> 0 @2  0 > /*  @2  (   ??77 @M    € `"  "` "@@ > > "@Rj#԰㿀` @ 2R 6 3 -(  ?7  ? 7?А*@2     7 27   2   @     @ 0? 0 "` 㿘> 0 0!@  7`" `@ :   7 2}R " u #@2n .`"@ >` @+ *@ ` "    +@  "   ?2   3 * +@@"  @4K& J . .`" >` @+`*@`"   * (   "   ?2   3`* `(@"  @4&  >&  * ?2   2*`  (*"   (*@"  2 &  㿘   @   S `@$ 㿘 @ (@L @@d  < `@@Y 㿐!>6!> > a    @O#\> >#\!\a @  @O 㿘`4 €`4(R`  >5"`8 "`  4(2  2  4 ("  㿘@e  >*  0   ` `  0!  @5 "    & 4 6 ?Ȓ*  0 & & 6 ! & $!   ( 4 2  2 㿀<@ ,    &  @  (  `  6 & (# @2  ,   ? .@  $ '77'''@   &  @ 㿐  &  (  & (@   0@4˒#' 0@6#* "@*`@*`'@5 <㿐>6>6 @4%  0`"@4#' 0@6#* "@*`@*`'w ` 6   @ >x@5c@5Ð& < 㿘 <@6@ >6`?"` @ "  㿐  + 2` 2` >5c"> !@OD "@"`" (& 0 && 0"``, ?"`,`0?"`0`,  @1F`0 㿈`@ p T` "`00j $`0`  8  2X`0&`` B`( ' ' * `#* B쀦#    o4 @A ` 04 $ `  `  ``?&` &` *`` `* "  &` &`   &``` @'&`0`,?`$`0@0͐`0㿘V` `   `  ` 8 >6 *` 2  "1`8@ 20  $0  $ @`0K*`4@ G 2V`T @>  : 2V`T @2/ `, @2 `<* @ " 2  2 *T :     2 2V`T @2 `   R 2-`> !\@N)  2$  $ 4 $ 80,?`$0@050`$ ,`  $ 0&`&`  @@   .$ ,` $ 0`$ $Ho o 8   €   (  $ (@H 0` " ` 8`@@7 "` ( 2`Ho o (  $ (H 0`  ( Ho o (  ?`$ (@H 0@ ( ? ?#@2'`' h?@2 & T!@ >+"*` * "@*`" * XД "?' @'?/!'9'''5   /` ؐ @ꀥ " " ''А"@''T!@ >+"*` * "@*`" *  ` H/` /``!6`  #> $`!@-<H 0 ? # "  '`'`"$``@ ` "` $`   "@H 0@ 0{ (  ?   8` €   ( ?$ (`?$`      ( ?$ (`?$`H 0 8`@ @jH/` / " $  ($ ?$ ($ `?$`` $ `"$` H 0- ,  H/` / ~`"` $`"@H 0 ` - x*%'@   㿘 ( H/` /`A   @c   $ H 0㿘 (@0l p   :&`>`8&`H 㿘`  0& ( 4,@ @ @ 4`0 "`0 8 @ 4> !\@L$`2  0& 4 8 "?   <,@ @ @  8`@> !\@L$`2  8 * <>  @L& ( 㿘   ?& @-А   ?& @cz @ 㿘  8` € "   (  & (@  2 8㿘 @`@ @S@ 2 8㿘 .``4@㿘 8 `8 2   @  @#`8$`< `82  %`<`0  ! (!  @ , `0`4*`0$* @@/*``4 "$`0@ ] $`0$`4 `4* @@&&@& (㿘 8  482  <* @@2@2@@"@ ( " 8@3 8  >  4`0 "`0 4> !\@KĒ㿘 H` &   &  "@"  (`& ( `" H p@ & H    "`    (" (`"`H ``( `"`(2```2`(x`(D% (% $@I  &a <``  `@@ԕa 2 4 X $  "a` 3"``@o @ 2 4a  I2 `@?  2w 4 @կ#\#`  ` #d`#h#l@Θ 2T+>2` `t" &` @ (  >2 \ € a4 8 " ` 2a( a(  =`t`@ >2 >a$@8 a @@  a   $   ` @@] > . 4@J#0 4> .@J#@Nx 0 Ho  %`  'l'''h@''h''l ''@'!> "< ?@  "<h'''''' '''Ȓ>2 Ю'''ؐ 7> ((@ؠ   @ @J@,`J@   @@@  ?`@  `@  ?ؐ ?'``;  2` ??찒 ! ?``?%'   耢 2`` ? 찒  ?" 0 ``?%'a  耢 #>6`4  ? (!`4* " h@` ` *   "  ?Ѐ@'۰ 'А>@s> z$ $`   * 2 $`$`   * 2 $`$`   * 2 $`$`$`Ā ''>`$"  =c  0@T @8# ' ?,Nc 4N@1 @$Ho  "`0 Ho  ?"`@*L @`20` 0` 20`0Ho  "`0Ho * "`,v0@Ő p0Ho  "`@t`"@( $  "`$  "`'䀢 ='䀦   v .@@Q܀   @܀  `H "`H 2 >72` #4"`"`(`, ?"`,`0?"`0`, " @*`0  $0Ho  >"` @ "` @ "`0 ((H /i * * @.$$$$  *@" "  @"`"`H 0(@t#> .@H^c @ " ,€ 2 (@- 0(@[ @  ?`" `H䀢@؟€ؐ `,7 ,7 @€0$Ho * "` c04؀  ?'Ґ`> .@G#耢 "@ C @̈́ > .@Gߐ#(@@ 3 ?Ho * "` P> .#@GÒ 0Ku@s kؒ@=`> .@G#耢 "@ > .@G# @:(@@ ? @Ւ 0Ho * "` > .#@Gy  㿈`` ''Ԕ  2U !4,  * * @  @'&@'  -f쀢 6  @ ?' '  ? &`   C쀢  ?  '   㿀`4`0" `< .  @@&`<> z %><`c 0 `<* '#`#\#d @e "`0`<@ 0(`  * @*@  @B&!8@`<> z  *  $a`< #`!8#\#d@> 2`< @{ 㿘@*`@  㿘 8 'H6`>!`@I  `"  "` "`  " 0 > ;> "@EԒ  0&!PHo  "` 0Ho  7"` 0 "?Ho  ?"`@' L?&! @,&  @,̐  @,ɐ 4!4 `2"!4` "&`` `|2``x  @ @lb` ` " &`@ ` "&`@&`&`!4@ p  . 5 <`" @ @"`@ @ <"@ ` "`   ">  &  "` "&  X`> @'f"\`"\`P@`0(`0Ho  7"`@ >  0@2 J6!L  H!P!P`@[  !P@`H! & pp  0@>  L 0  > "\ L@S`X 2 ,@' ,  0(  @ L@' L@+! H`> z@> z`@%"㿘#>6@`8>6DD & <D <"`@"D& @@`8@&㿘>6 8@%>6D  @> АD@$ >6 <`" @ @"`@ @ <"@@ِ@ 0     L@, 5@& L>6@>6㿐@ 2`!4  &@`?" Xհ    02 P@" ` 8  !4  2 P`` , " P L 52L 5 , 2 PL 5 E  8&``  !L' 2` `"  \!Py H 2 \ " h@ i $ \@ ,  0(  @@&Lz  h $ h@ 8 & h4!L !P@ H @0h 2*` 0 2%`( 0`"`Ho  "` 8&``  !L*  '#@; #  0  0Ho 8 "` 8&`` ?#'   P 2G 0 2` 2 &>ؐ! @# "2 X  L > \@2 P " , P T T T P `X" P`X P T"`X`X" T" L㿘> !P@DU" @ *@ T `"  "`   "@ P`" T T"`T T P"@  ?@ u ! " 0@ 0@2>  @   `?  "`  @ > `@D!x>  @D"@> #@D>6`H?"`H㿘 0(@( @!㿈  $>#`a#\#d  @L 㿈#`#\#d    @? 㿈@` @ @ "  $@ ` `@   `@2@` 2#`#\#d   @ 㿘> "@@B ""  " &   &  "@" & 㿐>+ #>6" ` `H\ `d 2> )  > )>6#T@(`L >@FS! #$`H @   :` p  >< t ><@?`H #><! @   > @?`H ?$`H @B#Ġ , 5$ ,$ 0 \@&ג !! (>`X x@(ǔ> b@(” $ !$! 0 " 0蘐 0!  0Ho  "`">  0 Ho  "`>  @BF!x  "`   `   "   @ "@! $!@X  $ %$ '$   ` " @L  "`"   ` "`!4    0  0Ho  "` 0Ho  "`@$ L 0Ho  "`$ X h$ h@!@$ (! D€6 `$!<>#H`#\#\@ƒ >m a@' >m a@' $> b$b$ "b$   @(" > $ "   @" $ "   @ "> $  "    @"> "3>  b ]b @'Œc $@@b > b $ 8>  $  "` "$ > >  8 @*` $ <  <"`@ 8 * "@ 8 * @$ @ X $ P X P"`T& X X$ T D $ D D D"`H& D D$ H 0( 8$ \ L L a * @r $   " "  8"`  8"`H /m * .  % ؐ  4!N, 5@ H 0!  8 < > z ` "`` "`` "`2% 0 @!  0 >  0(@    8% %㿘@Ґ 2 @ 2 >  `" `8"  a4 2` `2`8 㿀#d> 'T'X#\ #` "Ж  0Ho ""`!# @EWT& 㿘  > 0 `8>!@Da#> 0 . Z 㿘> "D  0 @  2">@CӐ" "">6 T "@" 㿘#>6`T>   "bD T T@`" T" @ @; `T 㿘@$a  p?& && & &    2 㿘> 0 @  8p@ @   *@& &@ `>@Cr"@`Q` >0``>0 )`  @   2 M@  `&    @ &  뀌`   & 0  &  > >@C,"`  ? & & * && 0 ``@@ ɠ >@C"  & 0 @   " 02 M@  `&    @ &  뀌`  &02 M   `&    @y &  쀌` *@& z &&  "m >@B"  > "@B ?&  * &?& 0   ?&   I@!0E `>@B#@8   4  0@   &   @ ` 2 M@       &&  & 0@BP#0 @@      *@&@ 㿘/> zЦ*`"  >@B(#X 5 3 @0 . ) ' $ "  0    @     ,"@> *`!@H /f4* ' L Б* `,@ *``@,< , >6 \@n 2> >@A#xH 03 "> `&: ̑* @2@Б*`@2~"%""@ "% %H 0 @= 㿘> z > `"> &b̑: * R@@*" > * a  * H /f * '  Б*  `>6` \@* H 00 2""&"H 0>6`#>6`d>6> z8"`d h> > z8" h> & h88`d*"`㿈%><> z #>6 0'> ``'> )c`#\  @ݐ>6"`\> "``> #!*` @_ $́``"   " `"4 `` -02` ->6l > "l%> H@!{   H > "@*@A@!`` ?,@> @XHe(( "  @ 4> > G!E"04> > @"h>" $!4> > 6"4#4> > /#H-#4 04> > ##4> >  ( ` @4> >     Ѐ4> > !!@ 8''@4 8 -> zЅ((6*   . ,  @) ' @"!"" !$($    @(0㿘`@5` @< 㿘> 0  @% @, 㿘`@ @k㿘`@  @] 2 " " "㿈`* #>>, c 0   ?*@`@7  @`"@'aϐ`?@Ɛ  ` @U `  #2   2 @ 㿘 ` ? ?  @ݐ㿘> 0 `?  @H /d * %  `0  &`0> @֖ `0 `0 &`0H 0&`D&`4&`,&` `{@,n  &`0`*2 @ : >`p@&`H (&`<&`<`<`H  @X `0&`4(&`00*@ݒ@H /d * %  @ `0">`0 &`0H 0@`H@:`0("`<`4 " `<`@"  "  &&`;`` B# ?` '`@  `&@H /d * % `0?# @&`0 @40 `0 @`0*@&`0@H 0㿘H /d * % > .!,@:Ғ H 0@ !P#!& 㿘 | > .@> .!,@;~ <@4" <㿐> " > " !>+" %>  >  ): @ " $`#> `:`>  )8@ " `$bԒ`:`>  ) @> `""<bԀ !>6>@>#!> >#\#Ě`!X  @9 > >#\"@`   @9 > >#\"`( H  @9 > >!T`8#\ P  @9 > > `@#\   @9 > >#`H 0   @9}#\> >#\!x`X   @9s 㿘> #> b< @* @@  2  ) ~     2  + )0 "` "@" $"` 㿘͐ @ " >@= `>0"  8>  0 L2 8 > > @( "   8  < 2 8 > 8> @ԅ( "     2  㿘 2N!4 8 > k  @9 "> #@9  $$ $ $ !4     0Ho  ?"`$` !4 $` @ "@$`$`> 8> "Ԑ@*  $@ " 8"Ԑ@* @"@$`$`@"% @Y !4@U  D` H"`H H D"!4` 2&!4@# &!4` & D` D"`H`$`& H 㿘 D` H"`H H D"!4` 2&!4@ &!4 㿘  `"`x""`x`"  "` "@ @? "@>  @9ː#>  @9ǒ㿘 L!4@` ` 2 X` &`? &`@% X !4@" P` 2 P 5?  ` "`? "`@  P 2!4㿘  N 5 2 D`@  @   D 0 2N 5  8"  L8"!4 "㿘@`8@"4 2!4  4 `  4  &㿘@`8@"4 " !44 `   4     8&   "  " 0 ""   "  "㿘 @`  R &R @:`   Q.  2& 㿘!4 8  " P " 8 ^  8 &㿘` @A  8"a4 "5  2a4. !4 ` 2( `0@"a4! a4   2`8`8  " !4`  @  㿘  @ `  `` ޔ ` ֔ ` ϔ  "㿘@` `  @ @ "w  r @ @  @ @x 2^ @ @  @ @b 2H    @M 1  @ 7?4 $  `@@Z $"  0 2$  0Ho !"` 㿘  @ `  `` * ` " `   "㿘@` `  @ @ "d  _ @ @  @ @Ē 2K @ @  @ @ 25    @ 2$ @$" 2$  0Ho !"` 㿈 ` @'쀦' @2'  2 '? ?'?'e㿈 ` @'쀦'@2'  2 '? ?'?'㿘  @`  @ "=  @" @"`@ @ "* @@   @"$ ? $ $ @$ 0" Ho !"` 㿘  @ "$  @  @ @Β @$ 0" Ho !"` 㿘  @`  @ "4  @" @"`@ @ "! @@ $ $ @$ 0" Ho !"` 㿘  @ "$  @  @ @] @$ 0" Ho !"` 㿘 `@= 2$@  @[@$@``G,  2@ 02 Ho !"` R` `(@ :    *  2  `2 !N2!N  @ 㿘> !@4ܐ!T "㿘@? "@> @5!T㿘   P &㿘ؠ P &㿘`  &`!4 ` @㿘   !4  @i` ?"  02  &  㿘@  )  "`O "'`K    2    &`>   )   `@2 N!"&  2  ) )?&  㿘@    "`T "-`P  9 C`@F= ` !4= 3`  /``@0 D `$` >    &`>  `   `@2  `@`  2 `` 㿘  @ ```  @( 4 &?Na"6 .a"  .a"H /m * . @H 0 㿈`  @@㿘`(  .`   2 @   2   @ d "   ```  `"` @y  "`  `>6` `` >6  p  x>+"$>+" : ? 8 >2  (>@8  ` @`>`2-  @" 8 2   @( >   >  # "> z Ԓ8  @  $@  << 㿘@ *   `  㿘H o4+@n   БH 0 @D@B 2 > %%&&&&"̀4`>+", @,`b2*@ *@ b 2`* @ *`B2*@ 8*@ Д @@&Д @@6`.  .`@c3`+ +` b 2**@C3`+ +`&  @ Д @@%А @@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@b Д @\@&А @_@&㿘@ `   M `  H`4 H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿐!> )# > >6a#\>"ؚ`x   @0  $#>  @1"ؠ  $ $ 㿘`? "`> @2g"؁㿘`>#O$ H$ L㿘1> )>># `X "#>@5  &#㿘> 0 H /m * .  @,5H 0&'> !H /m * .  @,5H 0 `L`"@@"`@@<"@j `L2< ڢ !> !0 '> !0㿐> @ح"@' "@`'А"@@'' Ȓb? & Ȗ & ?/!& &  L & < L <"`@$ L L& @H /m4 H* . H *`5E  > *` ``"  ! 2`"> *`"  > !  ( "  a @0` > *` @` > *> !  ( (" 㿘!> ! > 0 X 2 H o@ H /m!> !* .!> ! . 5 ?> #* `"  "`"  "@#   * *@$ aaabbbbbbabbbbaabaabbaabbbbbbbaa@ 5 32 0!44 - 0&>X*`     0`@ @       㿐> !>!\b`@@ >6a> !>#\ `!<  @/, 㿘> ! @/  (֔!< $!8 ("`( (8 8㿘 (!8 @& (㿘 (a8? "a8> !& (@0 㿈@   (` ` `2`Y ` F,` '@ $ $  *@ 2$  2  $  "   $  `  @$ 2  0 " 0  $  0@"   $   2   $  `* $  2`   "@ 㿘? `((H) &2 (&? M `0H&`8H&`8`0 `01`03H&1H@(&@(&@ (& (&(& >62a`H8& "aa'aa a8'aa'aH >6*`  `(!"!``>6㿘! * (!p * 8 >6*&!   ! &!Ho  "`$@ ! 2!  0$a $a$a$aHo * "``P "$`P " H   "` "` ? "`("?"H    "㿘 (?!b! $!$!@ &!>!(@# > 㿈 (! 2`!  $! ``"@!'!'!  ' *@ $    !  ! ?$!#@  ! $!$!$!$!  㿈 (! 2`!  $! ``! +@ '  "  !  ! ?$!$! #@ !!`$!]   㿘 `` . @z 2`#  2` ` @+ `    @㿘   $>  L8 $0"2ؖ `@28/ " !4: 2 (  !8 $D0"2D  ` 5? @ŒD28  㿘 K*  D  @    "  "   2 D@ D 䀦0      "  "   @n㿘   @ 㿘   " 0 0 "  D 0@2 D@I D 㿐 0  (* /!",$!0!2($!0 .``< "`<!' ! ! &!!`!* &!>6  "$!&! $$!0$!($!,@$!$㿘 0@ ! i@ >6 .`  0 *  ! ! !   N!"  .!"  !4     Ho * "`  Ho * "` 0 Ho * "` Ho @#@``N 5 H /m4N 5* .N 5 =   " 00> )0 (  Ho *"`0of2e! h Ho *"`6!L@) 0U 0hR` I * 0 Ho  "`  Ho *"`"&!  t & &. 5 Ho *"`0 t `@ ː0   "b! 2 2.! @ H 0`@  L㿘 02   !  0*@ *  ?  * Ho @* $@`! 0("! 0 ((2; (  6!LH /m * . @  "  0H 0 0("!!L "!? !*@ 2!Ho * "` (+  >6  6 0@ 8 $!`*` 0(2!!4   `2!  6!LH /m * . @-  "k!H 0c!2a! ` 2\! 0(2X!>@. S!Ho  "` 㿘  0. 5Ho * "` 0Ho  &`> !!\` ` @R >+!l>  *`  `a `@㿘>  " 0  0Ho 8 "` L`0   @  L  2 0㿐> 0 ? (* Ho 8 "`. a$ @  a(a,a0@E0AH/` /a  ?a#a` a   >6  "#@ #@H 0 `< "`<a$2'#a0#a$#a(#a,' ` 㿘 0Ho  "`!N>6 6!N`.`@  (@ "a$ "`D p>` ``0`$a4  >6`0! >6! >6!  > `/> z    `@*     `D  0 a#>ؖ "@-И ! 9``  $`# !$''''@s'ܰ 0yH@ٖ c< _ P`[L 6X T@2S @A  ?h@ːaNa<4aNc0!Xa<@d'@a `('a$'a(' '` *' +' `+ + @' @ߖ  #`#\#d#h#l  @  @ @͐ "㿘E  N㿘@  &&  & ` > ؓ*` & & > 0 2 " 4a " "a   4 2  2 @*@   "  @ 㿘`W  S` `?&A&8  ")@> 0  "@_  2@@  "@0# 2@@ @&@`@"$`$@@"B &>` 2㿐` "0 ``4@*   2` &`&@  "  /ǔ   0*  `?$ $```B >`&`㿘 >@+  , *, ؑ,     @?*``@ &?&㿘    2&  `&  && " $  &" $ & $㿘@``"`& `@"@U 㿘`  @  2 0` "`&  " @ `3  2㿘  l  2&  & >60 & 0&""`"0㿘>60@ "` 0@"0"@ 㿘H/` / #>6a0  €  a02 0 #>6a0€ a02 H 0\xt0pH`tX4lDth(@LXd,\LDLDDDDDDDDDDDDDDDDDDDDDDLDDDDLDDDDLDLDDDLDDDDDLLLLLLDLDDL,D\p$xLhtНX`   'Đ ` | @*#Ȱ uȒ?`  >#T*` >`   >#>C#> "><  `>9!$>|!Q -`   H` "%`#>6a<饒  => z    H2 " @ za<- `@  "oa<0"`#\``ğ``` ">6@>6W!<  ` ` 㾀`\?`9> *`  ?`F>#|*` > > Đxk> > @> /!>+" >+"$> N > ,K#> /H!F> ,@#3> !b|'@z  b|`?   `8 x  t&b|> !"@! . f> !c""x> !!x@!  U> !R"#!> !#'@7E$#@> Ϙ @3@].> -"ϖaʖ Ŗ    >7!>7!>7#0> "!!& ڰذ >6Ø!z u p k > +! a@  \> +! a@"  4  #\ך!> "@n > 0 + @ $+ "   " ``  > . `> $ @h @R_>+"4>6!>6 H@dP @&qI#>6`4'@.젒 ;``5  1 #@$$`40*) >6!>+@ "( @WP>7"D@  @ -㿐` \`ǰ `>!*` > > | >2 ̒VQ> > z!`ؐH* > z > !" * >> z В9 @ >6!Lf>c  @  z> + >6* + aP#@+ k> + > !#`a -@ \@T3> !b O -1>6@g!8 2F!8 d d&!8!8 &&!8 b@!86 > !#/ -> !"> !#> !"> !# @$> > z`! > z > !# +    @  -㿐'@6 @   ' 㿘  @     `&@   㿘'P` @     `&@P 㿘 @ *  \ -㿘  @     `&@c  T 㿐''` @     `&@? 㿐@#\㿐 #\@㿘\@w `  @@  `,  `% ` "&@@   ?*?@@@*&@  /㿘@:   @     &@ϒ㿘  @ ` `&@ 㿘` @   ` &@㿘@  >   ` *` *  (&@`!> "&@ x   &&@   `_e `   `&&@ 㿘&@!4``  &` ` ` ` P@N 5  5 8  $&a&a&a&a$a8@\!&bH@&a a8&a !&a &a$  &bH L "&bL 8&bL!4 &bP!4 6bT 0 ?` `?`l&bX`x " #&b\`|&b`&bX` @ &bx!4  2 `&bx `bd>!  @õ `.bk`6bp&bl6bt6brb|@ë .b! @æb.b      P>b  &b㿘3>6aD䁒  /> +଀ s#> +`    @  +>6aL  ⥒ ->6P "> +➒ > +  * * "  * %P%aL%P Ҕ ` * ;%aL >aLa( %>! @%3 aL @ڐP@  @ @h $$` (X<` 0<`  8<`( @<`0 H<`8 P$`@ T$`D X$`H \$`L `$`P d@_$`T >>6!L*?2%଀ /> + +>6 !P  @֐ @0 $$` (X<` 0<`  8<`( @<`0 H<`8 P$`@ T$`D X$`H \$`L `$`P d@'$`T >6㻐aD 㿘` >??  0 ??2   \ ( > !*` ``" 㿈>+" > +" Ho o> ("0 " " " H4"("# +! # t# #:`> !㨄#   㿘> 0    `   , 5`@ @ "`@0@ݐ !!*`HH 0  0Ho  ?"`㿘`> 0 @I x㿘> 0 0$"0Ho  ;"` #  @ x 㿘> 0 a`3&  0Ho  "` `  0(!@ Đ  &  t  @j , 5&  t & & 㿘> 0   "%    `  0(!@   &    (?*@  ? 㿘H /m4 t* . t  N 5 @ h 0@ 0Ho $"`H 0`t@8` > !㨄` `@ "`t㿘H /m * . > > ! c#@&@"`$ t $` $ "L 5 2  @( , 5$  > > )""" `2 tH 0㿘?㿘@* 㿈# @'` '>!0@"sZ > !"| > b耤b` > 0 b耤 > #  @>!`@"W" 0>H /i * * > @"@'` "@`'А"@@''@`"# > ""Д`b?#" #`?/!#"#`H 0@ɝ 㿐@ "    0 0ĥ`Ľ `* "@*`@ ȓ*`?`{{ 㿐S `{f  2 @ 2 ]  㿐@  2 >+"'@>"'``{H p@{:  \#@('а'@ "`O  n  > *> ,! ?"  #" ` 1S"@'ܒ" `'沐"@''"@'"@`'沐"@''耢 6`''`z  2㿐@   @ɳ@zՔ   ``>+"z˔ 㿀磒 2/@ z  &` z  @ *`" * *''䀢  ` >+b"b" 㿐` >+": > "@#?`z  2,@ 'X 2#@zl  H /i * * >+": @ > ":H 0 㿐@ H /i * * > "#H 0 _` 2m@z*  fc*"@ *`" *  * ` @`#>6@!T# >6!T@4>+ @>+"*` * "@Ӓ @}E`& H /i * * > "#> ""#"cH 0 ` !В"@@Ő'"@@'`y͔   㿀@ K H /i4@* *@ +  zu  $ 䀢@"  '" '''"@`'А"@@' ' * @`zK H 0`yx x@ 8r ` yc  2h`` @?  Z V@ 2Q @ "@J  + @F©耢 쀢 " @UД "?' '?/!'' y  @H /i * * @ *  yД H 0 㿈  2   2 & >&  b? &   & ?/!& & D  @4  $  " " '耢'А"@''?$  0@ @Ԓ }x@8  Є?`  2  " >+ &"  >+  &"  6  "@ @" "   "  "  " " "  `" Є@@" "  㿈 "@' "@`'А"@@''@@`       && 㿈{"@' "@`'А"@@''쀦2   耢   $$  &@ @  @ @4&@> *  > "*` `c  " " " 㿘!>6@ː!X> " @   ?&  & "@ &@  "` "@& > *# &&  "@" @ѻ!X㿘>+"@ :`: @  >+b @`@ : D 4`c 㿘>+"@ :`: @ >+  *"@ *`@ `@p*`@ : D 4`c 㿘>+"@ :`: @l `   0( (@c3`+ +` b 2**@C3`+  >+"  @3 @ : D 4`cT 㿘>+":   @/>`  `c; 㿘>+" @1㿘>+" * "@*`@*`@"㿘!>6@!X  "   "` "@  ?&  !X @& 㿘!>6@ѐ!X>   > "c* @  > *c`"@ `" ""`#@ " 2I> *:  'h@  > *c`"@ `" ""`#@ ":` 0> *:` 'h@  > *c`"@ `" ""`#@ ":` > *2`* h@  > *c`"@ `" ""`#@ "> *##@ @ @x!X㿘'>6@`X> *@>6@`"``@"@> `"@$`@4 @:` ` !4 2`:` "> "* c c> "*`#@@`#  #`;   !@ 3 ;  "> "* c c> "*`#@@`#@" 4 @: ! 2: "> "* c c> "*`#@ @"`" 4 @: ! 2: "> "* c c> "*`#@ " X `` #`@`@X##@d>6@ɐ!X㿐> *>a##\   @И >6!x"!x"`> = 㿘>6!d>> "ᰒ " >@ ! $ 㿘  ϔ    >&& & & "0& & & 0 㿘H/` /  ?`&c>  }   H 0T 㿘 >6!dHo o .`> *#@ H 0" """" Ho o" " & H 0֒  㿘>> "ᰒf > @!0  & 㿘H/` /`5  (>    & &   & H 0  € H > *#@}   ? & >    2  ?& H 0 = 㿘ᣒ @E@llxlll㿘!> * >ʒ`>+"@ > +"`@- > + >" <0 H(   " H > > ) " 㿘> {> !hb̀* > ">  ^ 5 ?` $   $ >6!w p 2 `F$ pH /m * . d p  l l* *  @ّ* @$ p h$ lw@ђ($ h@Y ! `1> 0 " !!L 5 2 !! !!2`2 @" !!# !! ,! 0,! H 0  2 5@> + >+"(㿘> {!h* *   h& h`&  w?@( "& h ? & & h@㿘> 0 H /m * . !! ,! , 5 `@ @1"`@H 0㿘> 0  >@#"(H /m * . !! ,! , 5 `D @ "`DH 0㿐> @ 0  @!" '"@`'А"@@''`Ȓb? $`` $`?/!$`$`` `: @ '2   !      0   @8    @`B < ?$[@  > z "sR>  ,`5> " `v 㿘N 5`*`># >@"X 0(!L  ?* Ho  "` . 5  & !   H> 0 H@ > > )"b"J!"( h  @8  *!! H>0H ` > > ) " 㿘H /m * .  h $ @8& h! 1!!.! H 0> + > + > + >6"`"  㿘   @%>6 >``@"hV` >>@"V`@"2  @ 2 `>`@ʐ"  >``"@̔   " &   "& 7 & &  / 㿀''''耦` `   @ > + ' +'!  * 2  ( $ *`: * @*``  2V  $  2V   2>6! 耢`>    >`@g"@c"㿘` `   @ > + 3) % * 2  (  $ *`: * @*``  2`@ܒ`T@ @ $  2T 2㿀>1R`$'' ''''`$V>,* * bH  @  2V 6V㿘B @'"  !>6!ƀ * @ 㿘  >@Ӑ#@  @ 㿘      `  @c `* @"@V   V `  6 6 > +`&```&``""`@ >>#`@` > +#p`@  > + "2 $V `@2 $V   6 V 2 $  6  $  逢2@@J㿘@ /`>@A#    2`>@8# V` && (&& V` V`@#& ` @ @*` >  V`@& `  @ *`@ 2  V`&  >` @C  (& $>@#` #  , @$*`*`$` ӹ   ">> ( 0>@ @q, @` $@ @* @  > 8@͒& ,㿘     @  € - `>[  X@ >,"H2 $T  T  @"4 T 2  $ T  @ 4  $  怢 `"  "`> +"   "@@ `@* "@> @ @` @ 6`@ 2 ``@ *` "``@  @ޒ $`$@4  㿘`  ` `(  -   $`(`€ 2$`(㿘`  ` `(  -  ?$`(`€  2$`(㿘 $  >@    2">@ " "> +  ""@@'" 㿘%> +   $`"  $`"  " @  p@ `2 > + 㿘> +  "  S 㿘!> +   `" `$2 `  "     2`$ 㿘> +  ``$``` - J ^  㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,? & ,  $2L"`$`@ @B $"D"`$ $ @@:  $@*8 $2 p`p41 $2 t`t8* $  $2 $$"`$ $2 $"`$ @@ * $2 p`p4 $2 t`t8 $  $2 $ $"`$" $ (   @*`2 (""(p< @B 28?2p"<8 >'!2  0 0  @B 2 2p<  @2"2" @""2r 㾨 !W'H@  " >! > !(' >!H &?#?*. 2 @ @6@ !W@ Z? @ @ *`* @ 2 2` L  * 2` C*   @`@ ( 5? 4 (  ,  0 ' 8 @  ' <*` @ '| +  B  D+` P ' H(' J?' L ' @ / |/` N(''x'' (. @ ' ,+` ' 0/  @ ' 4*` @ ' 8,`@ '   o9n? ` n,  - H5 5  `H6p&<6&6&6(H6H8'T'H'P '  '? '1>!`( 1>!  ''2?`p@(?`p ?`p( '`<'`0H@@j  P?"1>s!`H!l @?L  ?# ? ** @2@ 2@ "   "   ?" ?,/  ?c ? **` 2 2 'P 0 2,  &0, 28  ?&,8 0n,&8  -  !p? * c5<3? (( @3  @@  0@ B+?2  8  5*( 0 2  @  B8z  trF A    9(`  3(` 0   + ' '(`   !(` (`   ?#?*  (@2@ 0@ `'  ' (`   2'  ?# ?* *@ 2 @2@ ? D 0` ` + +` 03    @0`     I- `   563P`H: # *  @ !@&P * :  ~* 2 .aP  *  a P  @ B  6&6& . P "T `: ?`p( '`0H€'`<@i< 1>`H˒!㿘`8 "g `( !2a @X !W@2Y ` 2U \ EN lϐ? `* @ ,.* @     B @ B 22  2/      @B @ B 8  2 (    + +  36`6`jz! 㿘D <*  @:` `8 R:`p  6  > p!t@  p `(B 5 @ B @튔 8-`2 @ -`2  5  @ B @y p@ b  #$@+` $<  `(   @ 4  @bB p@ D`8l @X$@0 ($0$4?㿐 D? @2  `@ `4` a>@֒a>"l>ͤ ,  0:` >">" >"Ā <"  p>"(Ā`   ? F>"0Ā  "@Ā `@ , <`(@9    @ `8B F   @싒 >#\Ā"P`8 @컔 `,  @t `,   @쭒 > "hĀ > + > +> +  ฝ㿘 W @   $  㿘 ! ! ˔  & >@ "ܐ P&> +  &  "@" > +> +  ""ଁ㿘 i `"  "`> +"  "> +> + ?"଀ ">@ ʐ"㿘 @F $  & $ X@O㿈 @7 $??& $> @" X"@' \"@`'А"@@'' `b? d& ` & d?/!& `& d`& X& \ >` @ (@ CB> (> @ H 0@ CB> 0> H 8`B > 8@ @ 㿘 ͣ 㿘 +> )b`!? @ `b`4 @* 4  `@* ?`> !4 @ # `>,  0 *    >b`"@ %`e  `e@ ">b`# @   - ?>  @ B 2@ >@ #P  2@ >Z >@#p> 㿘!ؒ ʳ  2>>@ #>>!$a<&& & 㿘Z 㿘`, "  J!"   !@ ]`$  4   "  $"`$㿘@ >@ #> + > 2 >#@    2>@ #㿘`9 @ ? *`: > + * 2#  @ 2 L 2 @ې 6 >@ X#?*  `*` @*@ & 2> )?'p`?  > > bX "bX> "X ">@ = ->> @ 6  2>> @ .`a>@ + (->@ (0H/` / x@  H 0x)>@ 8  @   @@ې ?L@ *2  ,@>t tx6t >  hp>@ ސ @>` P> `> h@ ΐ @ ̐0H/` /= x@ 7 H 0x@ 8  @   )?''pt? 2  @?`v# @* ` *  'p זp >@ p?'ppt@>p> )t> )h?"b`"h> )" U#bd 'p (!> )#> )b`?2#!> )@А ?*`@` @ *  `  *+  @ $b`'p'pp> )> )"bh)"d"`2 @ɐ "`? @2  `x `4 @>`ap @ [@ t > x@          @ >@` >@  0f h- !> )"`> >c0> )" В@ `a> )h?h"`3  ? @ 22 `@  2`2 @"h ?"`? > )bd@!> )> )"h"bd!> )"h?2 @E "h? 2`   > 2@ a!> )"d?">2 @0 "d? 2`   > 2@ a>@ #㿘'> !<   <@e@ 2` <?> !<"  <`2@@< 㿘> * " "`> +> a @ 㿘!>6!  $! @ !& & &  $!& & > *`` & `""` "   > *    㿐!> * $  > +> a#\   @  $ $㿘\@ `@겐?& ( 0& $ &  `? "@ " '  "` &   Ǫ 2&  & && & & `&  &   & 㿘  " `"`"@@E   3 㿘     @ 9"' '   ' "  & :'   + `2@&  @ "" & `""`"@@ @0 ' '  '" &' 㿘 @  4 @ 2 -      &  !>Ζ " @ # ``(` k 㿘`\@P &@ְ ?        @İ    * N   I" E*9  4`$?@  $ @ @@  @    @  8  ? ^ ] x" u:   "  E  ? (? 75`$@  $ @ @@  @       ?  # ," )     &  !> "=&@@˒  #d "㿘    @i 2? b ; 2  2 `""`"@@ @ 2%@   2@ @  *@ (  & & "  &" "&  > @*@>! @>@А!H"  "@W  " ?& B 㿘  & "`'   & ` ! >H 20  뀎` `"  "` !"@H /f  .` * ' .`> + @ `H 0  & 㿘 =` %  "` "@ " &  &"`H / * ' > +@z H 0  "` "@ " &  "`    & 0H / * ' > +@P H 0㿘`/`a> + "        @絒 a&&   J   @   > +> +"a"> +@a``(`` "`"`&`"``` ` "`"`> +ᤀ   ᤐ > +> + ᰁ 㿘> +! H/` / > +H 0G #!>`"!h!7 "  H 003  @H 0> +a ?"aɔ  `$  @&`$ ``     " 8㿘 H/` /`A> +!   > +@[aH 0R` > +> +>6!"`8"` +Ḁ2  2 H  <`` " ``@ 㿘> +! > +@!#> +a a   v a > +[!a ?$a   }@"/ ~@w@= 0?@< v@' 07H> +a H 6#"a "> +ᰄ ᰄ > +     > +" 㿘 &`&`@F` @ ?@   &`&` "   &`&`" $ 㿘 @ `` ?@ 2 `2``&&@ "  x`#t#p5  ?@ 6 " "6#  $", ?@ $ " "#``"` ?@ " 2#`# t p #xx`#t#p& 6  ""#"" """#  "`뀢`ր`# "t p #x㿘` 2 H ?&  H @" & H@``"``@" l  t)" ` &@" & &`@ l 2 <> +!@ < `& <@& 㿐\ 2 >6!   > z А $  a$ ?$ " `( @@ib& & & & > +̐ ?`& 8& d& P& <& 0& 4& l& h& $& (& X& H& L& & & & & "̀`& T>@!p  & : @:&  & l ?&  & t@ϒ&@& , $&@@(& @aْ@!&@aԒ& x?& p& |& & & & & & & @a > +! $ 2>6> a#\  } @  >6& a` & `""`㿘@?& p㿘 (  ` `"  "`>6"!  "㿘 l  @> +@!Ё㿘@@'@& a    @@@  a  $  $@2 㿘`L`P@2` `" "0`h` '`園` ">`a@ ` 2/ @    @`2`h`  a$``$`h`d  `L@,` $` 2>`d@!` "`$  "@`H`L?`$`H$`L  2 `?$`` "` "` $`" $``$    `$ ` "` "` $`" $``$ @K`H`0@@ 㿘  €@N@ @[  & x X @ l " t @ t '  t @ ?@   2> d@! &@" " "&`?" H L  & H& L&  h  ?& h   & 0:`2! @  8  &  Ҕ 0`"`"  " " &  "@0?@`"`"  " " &  "& 㿘@ @@@]`@Y @)  4 `& & 4`@ n  ` @ 4 8@ `& 8@ 㿘 ( ,  & " &  &&& && l 2 | tm |  x  & @ & |& | $@@ @ H  & H&@ &` "&  $@ "&  <  @& <& 㿘   &  H 0@@   ` @  "  " 㿘` & 0 @@㲐_e @@ @& 4& 4@ H 0@@㿘`  @@㖐_I @@ @& 8& 8㿘 L@  & & & P& `&   @@x_+ @@t @& 8& 8" " " 㿐'@   < 4@  H @ 0" @`  ` "` "@  l 2> +!6 2 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' >6! T  ' H 0          0 0@ d   & d[*㿘6` " X@  X€ @㿘 X`€㿘6`@e 㿘@e:$??:@??????:H:l?:d:x?:;;;;;;;;;??????????;t??????????!@ 㿘>b @9 㿘#> +b'H'L'P'T'X !H !!> * ("@E ($b>@"8@>@"@@㿘>"H@>6!܀ 4> >"hϒ㿘'L'P'T'XH/` /@L   @#H 0> +!   @ 㿀  <@C >@ؒ O   >L @4  L   > @+ 㿘'H'L'P'T'XH/ /H   @ݘH 0> +!   @͖ r 㿘> +" >1" `  `>1 ```@)  ```>1`""``    `> +! `. A: ` >1  >6!@㿘>'H'L'P'T'X 0 `0  a4 ` `   @mH㿘'L'P'T'X  @`L㿘!>6'H'L'P'T'X@l!А   @OH> +" @n!Ё㿘!>6@V!А  @9 > +" @X!Ё㿐?'P'T'X`'' (@P`*㿐?`'' (@ `*H  '`' ' :  `  2.` 9 N.N`%`* N !  ''Ħ?/N `Z+>ː"̓*`    ? 2  "2   @  ? ?  ?L  > > n O> cO L`  2.`  L.L 2L QL  $ @   @ :  < ,`  2.` !L.|L:   2.`  L.eL`  `*  L  "L 9 >` - 2+.` \,N='N23N //-  ?`('Ē '$  +!/N`*   ?&?NЀ   ,* ?ФNЀ  &?  ,* ?ФNЀ  ' @N l2   " ?/    ? 2  "   @?* : ?:  6  -`/   ?=:  @ ?"" ?2    ?HH 2  "2   @  ? ? d  ?>b '  Y x ?>"  @g "@$/@ݻ    ? 2  "2   @  ? ? & >">" ' ?  2  "2   @  ? ?   2 /' ?`"N逢 ", 4` 2, >>4`,  `4 0 - 402 0/- @ `0- @  ` `0-, 4`  ` 4  -"@$ $`/ /&*``  2   <`Ĥ" `  2.` ɐ .<` `  *` .1- ) 0`  2.` `0.z`  2.` 0 .f Ĥ" 0`  2.` k .I"1 0`  2.` N .,`  2.` 4 .2M Ĥ" `  2.`  .N`2&㿘` @@`% 2   H /m * . `"` " @"`"H 0 㿘   @ %&@   @٤ * 2`     0   $ $ Ho  "`> ) "b㿐 0 +) ` @ #&@   @r * 2`@   ` UW   7UT  JXJlJ|JXJ|XYYYYYYYYYYYYYYYYYYYYXXXXY Y YY4YYYYHYYYYY\YYpYYYiLn,n,n,n,n,n,n,n,n,n,n,n,n,n,n,n,n,n,n,n,iijTjkDkn,lhn,n,n,ltn,n,n,n,ln,lln,m>,bH%   bH >,( `P >6>6 耢?   `>6R4"R ``$bH  $`*` (>,H2 >6 $>6 쀠`>6 㿘!>6!  >6!@2 !>#ru> $!!,`:` `q$!`Q >6>6>6@"> +`( "㿘#> +> (%b@ΐb1>6">6b !> +"@bUb@ڼb"@&">6>6 > + ( >6"!"㿘` >6!䀢 " >4 >  >> 0> 0 (㿘. > . @>,*`"H@ >` 0V `*`>ѐ! >V  0 > 80> @0> H㿘>6. !> @ >6!쀢@%>6>w X0%>6*>  (>1 <$!>1`@$ ?`* * @>1 ,  > xX$?* @ >>M >J 0Z!>  $. >A 0Q@>,*`"H@>7 >2 T? >*  T% Tt | T?>T   4>> >  '>,* `R ?  `T>, 0*`  > /@T?`>!㿘N -    N 02% N x  X2       ɠ  V  *`:   Ѐ  ? &@         `K*  Є 8K +`8 ( (* 8І `Ѐ`  K K "  "  " K"!?22 㿘N?  J@    `)>6,!:  4-`>, 0,: @@,:  @@ "* !:`@ -`: ? &@?㿐 >!@O#> ,>!b@ (LbL "  "  " L  > &@!  >㿘>6!耦#>6. `>`>!8p8>ܐ!H, :  y Y n N>, :  y Y c̐>,.  * H `      H  " H $ `$ >,`,`R ? ``R ?, O  >!P0 S@->,,``R ?"> `T>,*` 0 `WzT?>!`M p  , @ % Ւ >Y С>`>S!h̐0Ra쀦 >1>!xH0I <@ 4C>. <><!8o>6!H, :  y Y n N>, :  y Y' c&a!>1&  <*`>@!a &?* a>1&?`,* @>!~<( 㿘>6!耦- . >,* bH R` "   "  >4 > 2` 2` >ڐ!>֐ Б. %:  0>ΐ!3>!>6!쀦 >1>!Ò0- < 4'>& >1 ,*` >"!>1&?`@* `@ 4 >" >"@  d>!0 㿘>6!耦* . >,* bH R` "   "  > " >2` 2` q!>m Б. :  (>0+!>6!쀦 >1>"0]0- < 4'>& >1 ,*` >M"!>1&?`@* `@ $ >?! >"@ 1 e>]>3" 00 㿘>*"P#>6bn ,#@@@ 4 #>6>"  >#>6b* @ ?* : `*H*`>ѐ! >"B>>"=>>"8>>#3>>#8.>>#`)>>#$>>ߐ#>>ڐ#>>Ր >>А >>ː h >>Ɛ >> >!Hb,@J b㿘#>6 $a, : & >6>1!`< ?u ?$a㿘#>6  $a 0,   > >6!?\ >,?$a㿘/>6 ->6@ R% >,bH@ >,`* `R ?>`   `R. : @/`2@2 @$*.:`e sd >  > E ,`: 7:` ` R?Ǥ`@`$?%㿐L?  L     2 LL "  "  " +>6,a:  4->, 0,: @- :  @p "* a:`@ -: ?2L>ސ!0    >O s0ː! 㿘/ ?  c >6"!>,"H a!>1 "H@Ր 2R`$`@, 2J`$.: `` `@R  `2:`$@R.: @23`$R  2-`$^ .!>1,:` d e c >  f> `$ݐ`$p `$/ : `$b:``$"H  !>1 < 6G,>1 ,/  @ϐ 8 <.:  3 <,:` d">6 e c >6#> f">6>! E@ <>6! @ <! )@ <!  * :  <!:` < >1,:  c>6?"a㿐NN    2 NN "  "  " N >!80  >.`.: :^0ڐ! 㿐?' >#> ,ϐ!Xb@ (LbL "  "  " L ?͒ 2'L>6!􀢀 *> 1>, bH* `@`@!  .`:  a>!` ' ? q   f  Q>!  >hА@ $>6!->6  >h!x0).:  >,>_!0 bH    bH @.  bH`@ʔ " bH  $ bH >>:!0! a]̀?* @>,"H*`@ $Nt>"77ڒ iG̀? a.: -`: 2̀̑.* $>,"HNJ $̴?%>,*` * H N: $>,ax 6>1>,!|.R   2 ax>,>1`( 6>1 $.R   2 `(>1H %耢`%? H`@ӌ `@( 2R ``R 4 $H H>,bH $? bH@b 2 $`@ 2 $R`  2 $R`4 $bH bH>,bH % bH@: 2 $`@֔ 2 $R`  2 $R` 2`2`  $bH bHW΁㿐N  N "  " NN    2 >6-`J ?@2 `@ "`J `NN "  "  " ?  M S >"@N >6*`" ?* : `*?*`>ѐ"\ N >Ր"`5  >>6+"!N >Ð"x#  >W?W N  2>`` `>>6"!>" N f   >Wj cN %  n dհ  q̰ Ɩ >WG dN >W"  F e ]   >W eN >/" ? W  f>W fPWw  0sN W>Z 0l q.?0gN g 0`ې] N   ;>N .!>+$"  *`:   2 NN "  " N   ""  t!>+"̠" >+"">" !  >6! `?`"!>#># >" >#( 㿘0>#@>#X> +"@j ( >P ">>#`    N - 2  *  > !( 2  * > !(#> '$2`6?> ( 6?> '0* ? @ `2 ?@ (@* ?> !2` > (!?? @ `2 ?@  (@* @  6?> '0* > '?㿐@ _ " `  `0 "`0`#\`@  pВ '?'''' '% ذ  耢 ?  # ' P8 >B`C \>8>P"0,?`&060㿐@   " `  `0 "`0`#\`@  8  / $  X  J  '''''J 9`'   '  `(    耢 ?  # $ P8 < B`C \>8>P"`Ò 0,?`&0ͷ0㿐@  " `  `0 "`0`#\`@  p '''''''쀧 '+  ذ 耢 ?  #  = ' X@ >B`C \>@>X"0,?`&0Y0㿐@ , " `  `0 "`0`#\`@  8/   $  z  Q   '''''I) ?`'   '  `.    耢 ?  #   $ X@ < B`C \>@>X"`ޒ 0,?`&0Ґ0 @    2`0b b> z` @ ?* ` @  *  Б,2    0 $ 0    x `H 2 0 @η   `$@ b|"5@"{"UT g b}b~2` @ 't    ?4    b~St@ 't  @  ?4    b}At'tT   ( "`<   "`@   2"`D  6 2!4(  't   `vt 2  (  <$@ `w@  $@  2  0`H 0 ,?`$ 0 0` H`@ 84,`,`,   ,`,   ''''''Р@ '''?'` G 2`0` G 2`0` G `0` "G  `0  Д "?'  '?/!'''' /> ,`0Ho  @$`А@ k`0 g` .Ȑ @X`0" " ''А"@''T!@ >+"*` * "@*`" * H/` /`0 @ H 0/> ,Ho  ?"`> ,>#p!H 0 /> ,`0Ho  ?"`?"  #" ``" `F 2``F۔ 2` `FҔ 2А@  㿘    6< 4* )@-,~ 2 04  $ 0 >#x-     4`*  `-  &` 0 ,?`$ 0ʂ 0If " ?@Ѭ  &ʑ4  @'@  `E㿘@ 8 "&@i " &@ t> ,#@2&@` 6`㿘 D  > ,c  "c> ,6 @#H 3&H /m * . t> ,#@2 0J5  0Ő 0 @0Ho  ?"`H 0㿘  @* @` 6`Ԑ 2 0 6` $ 0  V`6` 0 ,?`$ 0 0V` "` ڲ`&`>+  b$` `  ,   @EĔ ߀  2`@  ,#@̨* "**% *"@ *`@ *`?Ѐ   Д Ԑ"?'Ж  '?/!''''Ԫ 7> ,0Ho @ @$@`b f0.ؐЀ Ԁ@X0̒" " ''А"@''T!@ >+"*` * "@*`" *  H/` /0 @ H 07> ,Ho  ?"`> ,>#!+H 0 7> ,0Ho  ?"` #"@?  0@D "  @Dْ 㿈#> ,(Y 欐c@{ Z c椒 @s O I 2 >62 b" ("`& 202 2 " (" &$ <$`<`, ?"`,`0?"`0`, "Ȉ`0`, ?"`,`0?"`0`, y`0" Ґ? @ @㿘><!@Mޒ " @]> *b(& && & & "b( 㿘 & @} & @& <& D 2v 0 0 4c& 8& (& ,& & $ 㿘 $ @>!H   @!" @ !$ @㿘 @ ~b& @ |& @㿘 @ @ ?& @  @   8#@ `  7 㿘(  { D 4$ D  $ $ " $$ $ % ;  ?$ @ѐ3  # @> $ @!ߖ 2) D 2# D" @  " @ 8 @ 8   p "  2 Dΐ  D?  $ D @  ?$ @NJ !T@8   @  ?$ @{ " !f㿘 ( <   @ " DͰ  $ D #> ,c        @ c $c* "q D? $ D @  ?$ @40" $ > 2^ D "@(O @ "@ 4  ۔    $@є     $ $@$ $ؐ 2) D $ @   #Ԑ @> $ @! 2 D @ 2   " D @"   D?  $ D @  ?$ @Ƽ   @  ?$ @Ư    " 2א (  }@  ( ~@ @ 0@ @ 0@ @    88 "㿘 (`A <   2  @   @ 2 `" `@ `   ` @" !8 ג  @ @$ @`ϒ``@ @$`@㿘`(@_ p&`  &`H   @  C B?@>`8>`@ &`  $&`$ (&`( ,&`, 0&`0 4&`4` &`` &`㿘 (& @& ( 㿘   > ,c?"c> *b(><" "b(! @J & 㿘 0Ԑ @ D `& @ِ @> & @   D  <  @`$ @ "$ < $ <> ,#^`4(R`  <2 >6"`8 "` " >6 "`8"`   4(R `< ` "`22  2  4(<" @2  " @`  2     4(<`" `@" @  2 "    ` "   㿐>6a> ,>#\#c H  O 㿘 (   @" 㿘 (   @  㿘c  (L "7cG2K  "~ ""}2?  ##28  ! >3 G    |" ` | = 3 3 3 |3  P # <`  # @`  $# D <  "  2  " i r   @>    `    @  㿘 ( H /``A* !`A  L `@:   2  T 2 2  8 ` `!`  "@  "@@ 4  @   2   "    2  8 ` `  H 2   @  ` p | 4 |`ؒ   4 H 0㿘 (@c p0&` `   㿘 (  @$ ($$ DXXX|XX4㿘H /e * & `p &`l &`p`@ `p =&`pH 0 㿘>1`""`@ג  & x | ` 6 @? "@>  |T#& p& | 㿘`l *`f˒@`(" `H /e4* &@ @ ʐH 0a > ,#`DB:#` &`D> ,#`$B:#`&`$> - ?`B : 7` @ . 22V @w  `x2` @2)`p" `!@i ! "!@a!  ( 퀌@`@"`p@`p @h 2?h2`@*@&`p!d=` 2  `` @ ^ @`p@ ?`p &`p ` `! @`*@&`@ @ %``( "`@ ِ`&`5 2  ` 2 `@ޒ @    2 `x  `@ǒ @ `x  `p( 2 " `p2 `n> !*c * `&`p@ € 0|"f`px  2i`  2X`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` "`p@`@ x`p2/  +`V``@` `"`p@p`@ `` `p@ I` @ D``"6`@`6``p>*@&`p 2C  ?d= b`@ 9`@D  ?"`p@ ,@8?  )># @@ @'?   `# @ @@ޒ`p 2  d" @ `p 2` d` `x @2v`p@ Ir`p``( # V``H 6d`p @w_`p@ [`p`@ Sa @ ߐ@ K`p   2`ހd  6`@`(@  `p`ޒ`*`:  6``6``p@*@&`p /@5V`ܐ@ z 2`p `"`pV`ܐ" 8  $ `p @?  `p! 2`   ` `p* &`&`p@ΐ㿘` 2 > ,# `d``B ;# &`d`H@ ٰ? <  9 `5 `ܔ   "$ H /e * & >`H@ > ,c&`d > B;c&`dH 0`܀6`?  2?  > ,# `d``B ;#  &`d @Ē`H " 6`~  6`܀ 2`` 2 `` ? ` 2?0@`@"-`?`>"P*`   ' ! ^ ( ) \? "`> ,c \`dB:c &`d@`H =` @ > ,V`܀ "2?> ,# `d``B ;# &`d@d`H  >#  ?`V`>"4*` 4 6`` " 6`  6`ܰ?0 `@: `{@  ]`z@/`^@, D  r g@"%!4`@`e@ `@0`@ . !4 r  T > +>6`!@ ՘ g!4|   0` x ` !  ! "  @ ;`o@`^@ ` @`@3?05`a@`n@%?0-s@"H "@k@?0 [@  hw@?0@װ?0 `b@" ~@   ] r@}@'?0`@j`@?0 Z@ `e@`v@~?0g@  `@Ր`@ װ?0H /e4* &  p p ?$pH 0 H /e * & @ː&H 0 H /e * & p$$pH 0 ` ` @ 4!>1  " > p ( (>u > Ȓ @ '''''@Ee g@dv`  !@f@g @K( RO$ >1`"J"`I @~ "D 0B; ,> h:&; 5 H /e * & &&H 0 !4 |@ 0 2 xr  x " ː#H /e * & p ;$pH 0 H /e4* &#@  @   H 00Ӑ @2@Z  : Ѐ€ " pH 00p2   2 $ࠐ ߐ"$p@$$$($(  |   Ӓ @  @"( ऒ ! @ ` $@c(@  : :: *@$$ऀh$ ( 7&  @  $ऐ; H 0I >7 ` lA  h= H /e * & h>6#@*`  €.€  h*` €H 00,hH 0  H /e4p* &p  @  * $p$@%H 0  `   `   >6!4 |@԰  0 >6 h#@*`  €ư H /e4p* &p n> !*c * `$p@€ H 0 !4 ` ` | "|  |`" !4@? "@> |۠#!4 0 @ "@!4 $|!4$x!4 " Ho  "`i !4 |`  0 \`2` X  U R$x@{O @|  G 9x # ? H /e * & t@*@* *@* $t @@@$t t $t @t $t t $tH 0 ?  㿘2  *> !c *`@ @ H /e`A* &`A @ 4   @2` p 2`` T  H $  `ђ `̒ H 0㿘6  `*`> ! # * @V`? ?2  >6# `&`8>6#0`&`8&`> !* c* `@@ <H /e4* &   "`2`` "`H 0 㿘 `>> !*c * `@@`<H /e * & @^$` H 0  2 `  p 2` `  4`   㿘 >> !* c* `@@ <H /e4* &   "`2`` "`H 0 㿘 >> !* c* `@@ < H& R 䀢@   㿘 @" @ !  (    " 㿘 H /e+ * &$ @ H 2 p p - p2   @$ ̀  & p>6 H!@   H  p  2   @ ̀`H 0㿘 @ 㿘H /e`* &`  (`" @ ( `" p@  p>*@& p6 @{6 @5`> ! n p* ~ & p* € H`@ H HY H 0㿘>6" 7ߔ 㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @ H 2  p`@@.& p @@ Ԁ €   p @& p㿘H /e * &  p @ & pH 0㿘 ̀`@ 㿘`K 0= 㿘 p ` @` & pސ2 2/  n> !*c * `& p@€    & p  @2  | "   "    & p@] 㿘`" p p & p ` & p  @2  | "   "    x  p @ *& & p 6 & & &  @ː  p *@& p㿘 㿘> 0      H /e4* &@ ĐH 04 | +0' x#      ϔ > +>6`!@P  H /ea* &a; >+"8 @>    &1 p0x   )q   o >cN M [ U " p0O ( L ( p   @    H 0  H 0 # >6#>6#!@Ԙ H 0"  2 #  #p #m( H 0G 2  d$2  x  `<> +>6`!@ 2 2 a' !  a     d  @ 6 H /e4 * &   @H 0dQ 㿘 p @%  $" ` "  @g H 2  p & p @@ Ԁ €  p ?& p㿘V H /e`* &` > 0    H`Ȁ@$@"Ɛ`> 0  "  pH 0 >+b & p>ؐ H   HH 0 㽘` V    H /e4 p* & p*   @%  H 0  >6H 0 # !@ H 0쀤`H 0> 0 4 | 2`0 "` x @ 2~` 2y` 2u`  u   > +>6`!@b f  @2e&` HjQ`8"! ꀤ4BA >@x0 ?6 5 6E H  @@ H<0# H@6 > ,$ ܚ@  d< C 6 8@& d !$  @  H4 ʐ` 2 4 `&``@,F H?H /e4 H* & H  H 00 " pH 0``&`@`  #>6 & p H!@ H 0`2`0ށ㿐` h  *@`z&`V`ހ &`ސ> >#  ?e>"̓* @| v`` @"r`ސ@s m`ޑ*`:  @{0eH /e * & `p`@   V`ܢ``&`p&`6`ܐ@ @@r ` `p* *&`&`pH 0V``ܠ$  6`ܠ ?,%`ސ 3? `> ؼ`ހ` `p 2 &`p \@b``@]`ސ?6`ށ㿘`   `㿐 @? H /e * &  (@/ @)@  @ @@  p*@& pH 0 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^  @ ?㿘=  p   x    @2``@2@?㿘 @j 2`@: !4! & 6 6  (  h* h 4(  4@ 3* @*`@*`6 㿈& > {!h d* *  * $4` @7 d@>a׬ | 2 x> a `2`>a@  >a`טz6 ސ@y 2 D L5 #  > 2 8>!!>!8>ua #Д@"? '?/!`''! @ݒ#>Va '?/!`''@Ȓ#>Aap d* * " *  * $@4` L5  5 ( $@}> >aؔ6 ށ `  5 2 `5  `5*   G 3 `h h*7 0`8  @  ( # `"`8`   0`0 2`8 `8 8  㿘H /e4`p* &`p    ` @ H 0?2  ԐH 0 㿘 ! "V , : @ ?> -  > , 㿘 > 1! $@Ȕ  ($@Ĕ  H$@ &> -  & "@" > ,> "a, 㿘> ,c?"c`"  "`> -"  "@@ @ (@ H >㿘> ,# *  * > -`> -"` l"@"`("`H"` 2`2`2`p"`|"`x ""`  "` h*`$`( 㿘`"8 ?`3>"*` > -> , > ,> , > ,#!> -*  +  G 0 -㿘   t t @ @ t t @~!?㿘 >a  & ,`:   >V & &  & & && &  㿘  " @.   >  " &  ,:`@ `  >& & ?H4(*( 8 82!   8 (** """"" H  㿘H /e. * &'   "  " 4 /ϔ @    @" & " @@ &@&  &  4  & & H 0$@ H4(1`2     `( % a    : 8 `0    `H H4(@"'"`$     4   ""@ ""`4 "" H 㿘H /e * & @`@`2` ` 2&`>I!$  " `H 0.?&`&` ` *`` `"@! :` `  * @+ ` * *+ @`  ``@ &@&` `&` H 0  :` @ `**2+@` `8@ + "@ 8  ""  ( @ ( (+@   @ * +@ @ *   +@ +@ &+@㿘`U H /e * & @>`5` 2/&>ӱ"$  ."& " " 4.T  "  @@ &&@& & `@& H 0 > *> * ,> *,  ,  " "` "8 @8!"> * ,  "@ "    8 8"@ ?H4(!  2 "  " `   8 @82" " H  xH /e4* &   H 00+@  `@ؒ-# - - H 00H 00\L?㿘0  4   `@U?@WА@YB 0 㿘``0  a4   `@U?@X@Y$ 0 㿘``0  a4   `@U?@W@Y 0 㿘`0 a4   # a@q @ a4   `0Ho  ?"` @Wɘ?㿘0 4   @WȞ!㿘> - >7!$>:" b>:8"` "`# ` "```:` "`` 4* ``2`> -c > - "c> -c  > -" #> *> -"b0>`#bt!> *"H>n`Lb0p "Hm > -"  22 㿘 2    :  V  4 *V 㿘   2    :V @V2  4V 2  4`2 4 " 4 *V 㿘`(4   .   @do$ `8     @   R` 2`4`0`4@ *R` *㿘> -    @: `  `4@*`  2 㿘> -  >+  @: `( "  `4@*`(  2 >+"2`@ :`㿘> -  >+  @: `$ "  `4@*`$  2 >+"@O ~㿐#> ->#\b`b8!  d !> ->#bh#\(  Z @ >+", b8>+"0#㿘>7 !>+"(> -#? <> -"(*"8㿘H /f4> -* '> -     @: `, "  `4@*`,  2 H 0> -`` "`㿘H /f * ' @?> -"8˺ ` > -`.``6 @   2@ & && 6 H 0㿘H /f * ' @?> -"8ˑ ` > -`.``6 @  8 2@  & 6 && & & & & $& (& ,& 06 4. 6. 7H 0 80     $ ( , 004(6(7㿘   @m 0 㿘H /f * ' @?> -#< `& 8H 0 8 (  & 6 & D& <& @& P& L㿘H /f * ' T > -`*`@ ?2@    @L  "  L@  P"`P P L"`L> - 8˾#$ D < 8 D @$ D  H$ D> -"8˪4 H 0㿘  㿘`>d"pV  2  `7#֐ @6 ) $ ?# @6 & 8&&  " ?@& & 㿘@  㿘@ 㿐` `>"  `  2 `&@` 2 >"@:x' $@7 #֒ @4   $)V $ @ɐ沐" 8$ $   "8$   @ '  8@$  8)7 H /f * '    @4  L$ P$ L& L L" PH 0 Ԑ$ @$ $  " 8 $   )@  (@沐" &  @@   2V 沐">͇"  > -cȐ  "c > -cȐ "cȁ㿘`>"n`>#h&@` 2 >_# @:2 >U#@" )& 쀦 㿘 J  @*@  &@T`>  3`8 " $@@` @4@@ 2@T`   " $@@$ ` "` @(͐&ݲ    && 㿘 2`!   "& L2&@*` ( &  (``  @ & 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘  ` ! `` ` ``  &@SV   M$`  `7#֐ @4` `' $ ?# @6 & `8$```  ?$@*`> - * 8 `` $ ' ` &@$`  " &  & Z`ـ `$@ N> -cİ  "cā㿘`h  h ( h` h V`  &&@IV |  C ` =$`  `7#֐ @ 4` `'' $ ?# @6 &  ` 8``  ' ` &@$`  " &  & `〦 `$@ ސ&> -cİ  "cā`&  (""@`2 "` 㿘@ `=`"@`"Y ` @8@`"R ` @ "@@ @"   "@ & @`""`4@  ݒ  2 " & Ő"   "`  & ` " &`   @@ 2@"@ @ 2@@ "@&@㿘$@ ~  @8 w " 2T (7#֒ @6  $&N & @  8"& & $  % `& Ɣ H&$C   2T <e   " ?@&   % 8 8& H /f * '    @6  L& P& L$ L L" PH 0  &   &]& $ &$㿐'   E   R  0M$ $ $ `G     $ $8 x   (8$    2$ > -# 8$   $ $   $@ %$@&@㿘     8@h D  8 @h֔   @hД  2 㿘`>#X `>#p(&@` 2 >#@:2 >#" @ & 뀦  `  `L 0`8` `" "   L 0  8D " "㿘 >ɓ#`  &@`  (   "     "  L` `"   "  "@  q @@ 2@& "@& &    @@ S``} `     X& X`"!TF 2T`  `""`` "`  `$Ȑ  "& 4T         , 2$ p   $  "&   _  $  $&2&㿘:`T   { .7 c֐ 6   $$ & @{ 8&  = 쀦     Ӑ  &  㿘` `I o " 2 2   "@" 㿘 @ & @2@@"@ o㿘 &  ڒ o `2 2   2  㿘      # 0 㿘Ґ``   ǐ 2 "@& "@$@`  "  @㿐> ->#̚c#\ Ԕ  æ 㿘> 0 hK "` +  2VZ +U )H /` * ! > -#6!$  $ $  $ $4`   2` 4 `  $ `  $ ` $ `$ `8$ $   2  H 0&@  `@f4 H 0㿘H o *@ a   `  H p@㿘H /` * ! ` >`0  `   " ` H 00 `` 4`>7!@>7>7!>7!@&4`4H 0 㿘      @   @  @> -#@㿘H /` * !     @ Ò @Z  2 @  @P   7  " 2 @Ӑ 2   "   !!"   >+"!>$V  ( 6m! "   > `0  `   `"  " >Ư#6 H 0㿘 >`0 `   㿘H /`4 * !   >ƃ  ?(6   2  5 >`0  `  H 0㿘  / -H /`4 * !      2 8@: "  8 >`0 `   H 0㿘H /` * !  >`0  `  H p@㿘H /`4 * !    9 "   %>`0  `   H 0㿐  ` 'H 'P   P :   U ```   `     `4 "`42  +`, #@ ( H 0q 5 8H 0g H 0_ H 0W  5  ^P  5 H /`4 * !  Ǥ  8 ̀ 2   $2 2 92  9H 0# H  '  "  "@@ 4 ` '     @  (   (H 0 @ =D< +@ ) !  ! # ? 5 ?5  @   ?Ȓ* 5 H 0 PG H 0P$ P n qoP     $$s  쀤 4&`#   (P > -"& @4  $h4( $4 $P 2 6  " ?@$$ %@P `  U"` ```P` 2``  5 H /` * !   2 ` ?Ȑ*@5    > 0 PHH 0`   ?5  'P  PI ? * 5  5 ?5  P   㿈 'H''X'`'&@ 2'X` @ ? !2``-  >`0`` `   @  6"`2^2& $" |  > 0  `    | `  #@ǐ L 6 | 2yH /` * !  d`2e L@ :` `@ `@"Z T8V 2R` 2N 8  2H`756 8 ` 2=. | "7  "1 2V ` 2   " 9 a a #`  | ? 6 | ?6 |ɐ |@H LH 0" | "`  `8 "`8` `'H    H"@t L " & LV  " X P " & P X?& X HD"@& XH "& d&R d;M& d    '= L " & LV  " X P " & P X?& X  D"@& X` `" '  2'@'& d& d `   @& d ' V ``2V&& lV`'`!2a"2 b   & d& h& l в ?6  H "8 "8!"@쀢 "@H 0'H /` * ! 쀢`%& "@;` 2``" LH " & LV  " X P " & P X?& X D"@& X%& d%_& d && l& d& h& l@ ɖ % "@&&  L P""@& L& P H `2 @"  & H  @O6 @M`I`@0" 0  ,@ސ L " d | ? 6 | ?6 |Q |H 0 2     " 8 V  ! `2  ``  ```2&@ L`2!2 ` & d& h& l "& l` "   > 0  `  @2쀢``   | ? 6 | ?6 |ې |H 0 |쀢 2X`" |@"@ | ? 6 | ?6 | |H 0㿘` `` 2 @`>  >`0`     ` L 0  @ 4 0@0 4 0H /f * ' @ 0 ? 4 0 ?4 0r 0 4G@ 4  4 0$ (H 0   `@@_㿘?#@'P  " * `  @P *7 > 0  쀤`"P`""K`@"F`A`Ƥ *=`¤ *"9` 4` *` *",`"'`"` *` * *4 *g`" ` 2 ``b#@4 6 `" ` ( `  {6 *x6 `" ` ( ` $ " T 0a !0[ @ 2f 7  @ 2^ 7 L@ GU 7  8 =&  T 8 6& `"E ` 8`? '>+ @y >+bc"@@r. !ɐ   @e,  2 ``06 6 ~`  ` ` @P `㿘?#  " * `@ :  S&` 4" "OV "JV "EV 0eA"@V 0`3 @"8V 0X4"3V 0S`"8 4` ")V `"$V 0D)`"' T0=``" ``"V0-&`  ` "@V `)" V ` $"@` 8"@6 8 `"2V ~V >+" &` `@$@>+b  `$ e *& 㿘 <  @ DI p`4R`(2(  >7X>7h"`8 L>7x"`8 H4 (( ("`" ( 02 0H  4(H4`t(`t  "`t2 `t`|2`|H `4( L"`   "  8` 2` 8 "`"`,  " ``0   4(H4`(`  "`2 ``2`H 4(`` `` 4" `   2`8"`82,`   , 0  `&  4(P2" P2@  2 㿘   ;  6 @ @͔ @I L    6Q 0 6@9 L   @/ 㿘  6 `8|6 @# @  L   㿘  6 h0f6 @  @  L   㿘@ !> -# P d* * @"  L@o T4T2*T0 @ @f+> -c M@i !>76 ?6 6  6  & 66 6<& <& & & & & @& @D& D!@ 2!T'>7@  2ᨒ@Ȑ@* >`0  `    @1c `@L ܐ6 6 "` 0 2 0 2 2 2"``"`(`("`, ` `   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6 @= 㿘 ` 6 @4 L   㿘 0!  @6 0 >R 20㿘 @4 0 0! >8   0   0  4 0㿘`$`0 ? 6`0 ?6`0L "  D <Y @`(m 㿘 @" @ L  ` 2  & ` 2 (&   8&  @* 7`>7@0  (*`"   " "    > -PL0 7 㿘@& & 㿘` "&  "@0 @j㿘 @c & 㿘`0  &R  "    &  !&  " D@&  "& " & ` "?# 2` 2`@-㿘`A ` R`  2  @`2R`  &R  "    &  !&  "D@& " "& "` "?# 2` 2`@㿘@  >Ð @ "  ` "@  "@@ 4 4W  ?  2@L $` `a "$$@  &T   "    &  !&   " D@&  2  &T   "    &  !&   "  D@&  "& " & &  㿘>K P   ` `"   "@  "@@ 4 $#?   &R  "    &  !&  "D@&    &R  "    &  !&  " D@&  "& " & &  㿘 `r ``  " @ 2R R V`@  1@.& / +( ` "VV`@ `x `   & `  &V`   `  & ސ"& && `  &V`  "  `  &  !& ` `D@& ?# @6& >6{ `㿘 @ 2㿘 = ;2  >P x1@("@" ""&R ? > ":& " &R  &@ "   " &  ?&  D"@& b `ƀ0" &R  "   " &  ?&  D"@& E  `""& & " 2& &  "& 㿘 "" &  " &R  "   " &  ?&  D"@&   2  & & 㿘`  (> ’"  J     꿒   2    `  & `$ $$ 㿈 `(ybG - 2` 2` >6""``@z` `Qc0"`(`, ?"`,`0?"`0`, "ܐ`0&y㿐 @@ ``@    ( 0" 0`, `0㿐 @@ ` (`0?"`0`, `0㿈`  `   @@ H /`4* ! (     a T 2 2% 8`  # 5  8 `   6!{ 2 T 2   8    > 54 8 8 y4 8   2>    xÐ (aq찒  $` 2 4 2$` $`( `("`,`("``"`$`, 6Ւ L 쒄 t& iP  2` 2`>6""` " (  `` 8'  `    _Ab0`, ?"`,`0?"`0`, А`0א xv (H 00,?`$00㿐 @@' q`(  !!2``0?"`0`, c %`0_ %`@  2B  2<   !! 0" 0`, `0銰 $0>H /` * !     8  >  6! "   84 8H 0  ?4 `0?"`0`, L`0 ?O?" x`@`` @`` | (w`gఒ j '2  2 >6""`"(`Qఒ 2M2 2 " "`('O谒 5` 2 ` E찒 +`   $`, ?"`,`0?"`0`, "ސ`0`, ?"`,`0?"`0`, ϐ`0wx ^(a'^!a'耢 %wa쀢 p`` ``'` @'''''И'@4؁8`  &䀢$# ( *  tΔ 䀢*  `@@ 'un h '@w԰ y    ''? '''' ` '  `@#  C`"'8 @  4Ԛ ( ̰ 耢 ?  #   ْ Ԑ&@' @`B ; @Ԗ:  X@ B ; X 0" 0`, `0Ѐ p`   "`0'`` `'` '`@''''И'@?؁8`Ȕ  1䀢$. ( *  s `䀢 '* @'@  `' t h ''@԰    ?' ?''' ` '  `@ ؀  Ԙ (̖   耢 ?  #  c$'`"̀2 ' ''AȰ KȀ &6  @`,  Ѐ !  ` :` &`@`` ?$  ` 2` &&  8`B ; 8Ԗ:  P@ B ; P 0" 0`, ڐ`0̀ "Ѐ 㿐 @@ `  (`0?"`0`, `0㿐 @@à ;`(' `  幐 ``1    7 2`  7 `  `$  ( `6` 慐 0" 0`, q`0㿈 @@'찒 B`  `j  (' (`` 2` `쀢 " 8' P `I  0" 0`, ,`0쀢 㿈M谒 ''@%   t ([[ t (㿐@@ :`  %  (x  `   ` 8'`` `  0" 0`, `Ɛ`0`ʐ㿐@@΢ H`(  $ 2``0?"`0`, : 9`06 9  $ #  `   ` 8'`` `  0" 0`, q`0x㿐@}@ J `(:  @ 0" 0`, : -R`06 - ֒  2 ! 7`   ` 2 - ` `B ` ;  0" 0`, `0%㿘 0 ! $ 䝒   2 俐 7 $  䳐0$@ * 㿘W 2R`    &&`0  "`0dd d0dHd`ddddeghgcchThtdxhhhhh㿘 `  c -`     M - ``2G `A.`>#(  < 8@G8@s5 @.  + ) @"@Z@x     2  >7& Ha Ґ@ V  2>>ڐ    X , `"  &` X$ , ( L`"  &` L$ (ဧ  @ ׀ V ; r> n 8@ h  "b 9  ``>7!`LÖ `     7B @>   " 7  3 9 `L 2  `L `,`X`L " " &  `X", (`L " " &  `Lv"(`   > [`Z @V @ 5Q  &HV  ? "?`L@&H?&  2 0> .`$  "` 0 &0 4& &$&4&(&, 6&  "'&  &   "&   "&  &          &     & > Ȁ id㿘 "V T  V ">7 ">7 >>7!>7!     8o{  " 7& "@Uc`0 㿘  " " @ &  "  @ @M 6  2 "  > .  qp @dp `` ]  @?? XU `@P,  'p'L'H'l't@hH 2DX \@8͒l\@10@@,1 0@- '`$8 a'\X@7Sl X@$   $`$``@  $` ` $`@8$`$P` D`  a '''''K?  (0W* @  R < L &`@7K B `"> =U@V@@9 )`  1`  2`) =` `沔 ⌖ $   $   ` $ $ $   $ $ $$$@@r㿘V@V@  )`" V  >"d"  _" ]  㿘 '& R`` 2  $  2 >k 2 $ & ` ?2`vs$ 㿘R    =㿘4 8   $  n 㿐> 0 4, m    `@6R`   '`( <` `2`@4\` 2` p ( S'$@ˠ 2H,   ,` W@   ,`@V<,`  (X& o (`@@*`" > .' ?"" `%& o֐ (n, 㿐 ` ``?#@2} @ @  ` ?4q 4 ,`? $ΐ`  _    W 7  @  @$@` & -? % S#' #@     > .`  "` ? "`"     > .` ?"` ?""㿘)> . #> ` > .%  "` ?̐*@4  2 ` 7> .  > .?Ȑ*4  " `"2  @" T  4  (>7 !$@2  >dcp@Z  2 > . `>   &* l `  ` @2  @2  $@` 0 $ 0  $  2 @R` 2 ?`( "??` @Xݒ ?`m  &% 㿘 >c@ 㿘 1 *R 2# ?#@2 2?2  @$@@`? 2R   ` R`  > .  2`2`㿘 > . 0 & 0 ?& "Xn 㿘   > . `@> .`   > . `@> .` > . @>! 0 > z > . 8 : :  (@ b  ; ( > . 8 : :  @ b ;  ` "`#`  "> .B?:㿘@ > #?!P#!a,& & & D& & 㿘H /d * % > .!, H 0 A @S > #!Pc!!,?& & & D& > p& 8& H& 0> h& x& 4& @& <& & & & & @CH /d * % >7aa &a" "a& > .`B:`@H 0㿘%> z > (  , 4  0:#> .` ; B > . D  !,p& 0@& H> . &  "` "`"& > . &  "` "& >7aa &a" "a& ````B <`B;`  8`(; ; B;`(㿘`"  "` "@> .`B@:` > .!,㿐> > ( '> (%> .!"4$ $0@Z d $0&f!$> z А @ $? @!> .$>a #\!,   ] !, > . `@ "@"``> . @*"@@0 & > . : | 0> ."a   : * @3  > .:> ."  "@ 0> .$"a@ $> .> ."""a㿘  @ `0" `0 > .&`0  8 HB`B ; H; 8@4g> 0  `, "`," <@q < 2 X    2  x`B > x`B > 㿘  @'@㿘 \d  @$  @% 2 `.`@  `@ @㿘 L@  0( 0 "0@Ơ  jl & X㿈'Ta T'> z Ԓ*@ `F   @3쀢  T ?'?"T`@3@ 4 *  ir  T ?-@ = F`B @ ? - 0 "0@?? j T-  $ ? - 0 "0@?? iT ǒ-$ @  @ 2 @  0 "0@r?  i̐T> f'   > .  8 HB`B ; H; 8`0 @#`0 @U l%> . #> .a * @ $  @F`l a* `" @9  l a * $@-`l * $`  >B; p" 8" <? " H `X"`X``@ B ; `@ `0 D`> F > .%`|=`p =`h%`0%`L%`x 8 HB`B ; H; 8@2ѐ> 0  `, "`,T@@`㿘 |` `< 2`X`  0  `$ @@SO  `"p`B :`B :p> .  0 @B`B ; @; 0 0?  0a $ 0H /d* % @'  |> 0  `0 "`0 |`t "`tH 0 0@ $ 0@2e` @@s㿘 0 $>  0>  & 0c #& H /d * % @H 0> 0  `0 "`0# > !# F> !* "@ *`  @0  0 & 0 0b& 0@*㿘 0`& 0@2㿘 0   0>  & 0c`#@& 㿘 0  0 & 0@㿘H /d * %  0"@ 0 & 0 0@_ > .!`@ 0 " | 0 ?& 0 | " H@ H > z X > z 0 @ 0*@& 0H 00 > . 8`:  :`(> . B;`(`(;   > .`,` ,#> . &  "` "`"O&  0  > z > . 8`:  :`(> . B;`(`(;   > .`,> .` ,#> .  > . 8 :  : B> .;   0 "&  &  "` ""& > #   & ""> #!,& > .`B : 0>ߐ# @& 0@> .b b?"b ?  0 @ 0*@& 0yH 0㿘 @> .b@> . a* @  h2  l2   |2  0@  2 h 㿐 @+> .b )> .!* @  @ߐb !* @ X` h2P  l2L  |2H H /d * %  0 -``0 &`0> . &``"` "&`   0  & 0>( 'H 0  r  0@6> .H 0  2 h` `0 &`0> . &``"` "&` e '`%@`  ?ʀ y 08P`B :P  0` & 0@xH 0Ā`" &  "` && > h> pH /d * % @EH 0㿘  @  0 & 0> . &  "` "& 㿘H /d * % > . > .` :  > . $> .> .!` (: @  > . , > .-!> .!!> .  (: @ + , '> .!> . } | " @ `"  "`   "@> .!  (: @  , > . .%> .   R | " @ΐ `"  "`   "@^  ?? H 0+ +& 0@ | @H 0  ?& D> p& <> h& x& 4& @& & & &  `"  "`   "@㿀> 0 > ."!(H /d * % > . > .  :`    $ > .>!0  J> . > .> .!%> . :  ܖ $> .Ð@4H 0 0@" H /dk * %d ? 0@:> .!$    - 0 $ 0H /d * % > z ؘ 8:  : B; $ > .`` $ `""` `B ; @[%> .Jx"@'"@`'А"@@''H /d4* %耢 W > . p> .Q> .㿘H /d * % 8   0">H 0 0$ 0  ;$ 00  0(  4 " 㿘 0"> !@ 0 "& 0`> .!`@ 0@> . 0@*@> .& 00B?:0@! |0  @ 0@  0@8B?:8 0 @  0  x& 0€4 0 0 0 *@& 0X㿈> ."<""<"`!> .> z><`Ж !? 0?$"D#\#`#d"D@[ "D>!P> ."$@> .> .""H" "  " "  " 㿘H /d * %  0 H & 0`2B P> .> .D"@ @@"D!> .> ." >"`"" #"" x  "< "> .@'> z    `, @ B   X@"  >  8, @    8:   & H`" T T"`T> .""@ P T"H 0H( 0" 0H 㿘H /d4 H* % H  > .& Pb<` P& T`""`> .b b ?"b  F  0/c & 0H 0㿘H /d * %  H & H 8@iX X  @ސ  H 00  0 & H P`" T T"`T> .""@ T P"@ 0 ?& 0 0 & 0> .<< & P< P"`T P"`"<<& TH 0 㿘H /d * %  P`" T T"`T> .""@ T P"@ H 8& H@h 0@> .!,H 0㿐H /d * % > z> . ؘ 6@D:  N> .`L"H)> z  +> .,@ D bH@! "  >!G @-!   ,@ D  bH #\@& > ("0Ho  ?"`  > .6@ `B `D :@)> z> ."H& 8& X> `H 0㿘 XH /d * %  `  > `& X   В: @ D @!,@("`0> .B?`:D > z   8: :  БH 0㿘> 0 &@>7!   > .(?`B :(*@&T +     `> ."P> . c* @  2 T@2L (2@B ) 2 2 > . ?`B : @&> . `2( $  @> .`B : `  "`  "@$ > .c`$ `""`° `B :`T> .`B :@@ Ɛ9 @" @* & @ U )   $  @'? "@ ސ0*@ @ <       @* &  `T)  > .@ > .`B :`B :@     R?@&  K*@&F?> .`B : `  "`  "@$ > .c`$ `""`&@-  `"  "`> ."#  "@`"  "` "@$  ` > .  2"   "@$ > ."T> .c|??"c|㿘>7! @> .#> . Tcx * @"1> . 2)$ 2%  " T@2> .@`B :@J(& )&@ "&&@ 2 > .H`B :H&@?㿘>7!  >+"#> .c|  > .> .!"Tc|`($c|# # ` "`"  "@ `"   2"  "@$  ` `  2"   "@$ `$ `T$ $$  T )$ , (*:$ > .c` $ `""`  T.   `?> ."P> .c* @@ $@" "@$ $ `+$ @(`< $L (`4> .``L * . > .`L ) .> .`T> .cx *  $  "` "$ 㿐> .#"#"`#> .!>+"> . Pvw "`$c`:`> .  vl> .>6"cx> .>#\"TaȒ H  " > ."" T> .P> .(@ @"  $ 2 $@:@"" T㿘#> .c; 3 X20" "$ c" "@`"   2" "@" ` > . 2"  "@" > ."TH > .c|?"c|2㿈 h |  >`>`>`&` ` `"X``B 2X 2X <;  `;  B p 2X t "`X@@`8` ? Q' <: `` %@@uD,`@2* <``B 2$ < 2! <@ѐ` *`` @( ` ٠ *_3 + <#\#```@e  < S (_ +Q>` <D: @'@"  p@(B   p? t? s&`  p>`>`,>`  &` D>`e >`>`>` ;`@  `#\@#`D>`&` >` p>`㿘\`D H @``2````#0+* V `0 9 0 0 E `0 ` D &Ȑ D 㿘``  +$, ] `  & @&  .` <?`D `@&  .`" `& 㿘> 0   < 2 @ " @   @ 2 @@  @(-! >"$ @В |G 0%!($ @ " @  2< <@2 "@   @(2  @ >$ @@   "    `"  :@  2" 㿘 㿘  $> .#     P >7, 8    `@" "  2  㿘2# > .# * \ "@ @2@>7#P" @`>>!$>" * "  2㿘>7cP* @ > .>"8#   #cP* @" #㿘'>7     ,``,`" ,`>8a > . ## ,`a `#,`"  `##     ,``,`      ,``,`  㿐>6a#\> .>#$  bp= @>7>7"b"" "b  @?`$`T4t$h㿐>6a> />#\ Xbx 8   㿘` `` >7"D* @4  > />7"D@$  > /`" X " 4㿘`u 4 > /" Xa㿘>W` 0 `b``"@\ @ B&U `` @2`?? DE?4F 28A  2   "  7`6      2< ) < $ $ `$ 4 $ $ $$ (\ 4   0@@%@o0 㿐V  $   (^a  @| #"$ @    @2`tl `t>7`"H@ >7"@  @ @2`?*  @2 &  6 @ؐ 6 & & , ( ,& 0 ("$ (>7Hz    ,` 0"`0"( 0 ,"@& '@( 2'  @5  `*`>-" `" "& V   R` @,  2| V R 2r  @  @ " `B  & :@ϒ@Y V  R` @ ``"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  "  '&  "|   & "  B?:@'l`" "&  `B :@ 㿐  2@'0G9 @?`@>-"*`  "[03     @ @J #"  "B   B?: ' `B  : @I  㿘@( "  6`6` >@ ?2   ?2    @ b `B >` @?  8&`&`6` 㿐 '  R` 2`   @ 2V  㿘'` ` `@< "  `@4    ? 4 @2 "#   42  2     4   8  & '    @      4 2    ?  4 2i  c 4  @2 "U  @  ? @ 4 2I   C 4    @   424  @  ? ( 4> 2 > @ 4    > ?>  >H" - 㿘 `@2   ` @2 ``B > &&` `@2 4 `@2  4` B?> &`  x 8``B < $ ,$ $ $$ (`B?> &` & 㿘 $`0"`0& (0,"@"  y:  $2,p,$  `$0` `$2> .#H $` $`R$`  "  > .`#$`@"$ `@  "L /"? ""$, $  $ > .#$ `J /2` @,^ X`> .# > .`#0 > .# `` '` $  ?'''''''@!ޒа   ([`> .#U`2  # ?( `> .`}#$`*@@$`J /@' @ϐ X `$`@1$ @`@ @d> .`T# $`   @@2  @!Δ  `$  >`> .;#@@$㿐$` $ `  `  "$ $`@*@$` `$@`'J /2$`'J /"`""@$$`< v J 2` 2$k $`  ($`'$` ! `􀢠/`+  @ `  /+ `2#@`$`"`$`B ?$" $J /2` 'J  /" "$$` $`*@$` J 2``` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @@֐`@f > .#2@$$@Ő` "$`!"X$$`*@$`@0 ?€` ` `X $  $@  ` `*@$`` ""@$` "@$$` J 2 `  $`@' 2< @   €@0 2j @$< 2 < "<`!ސ<` @@  @@"$$` ]$``@ =`` @2 @$`@`@? `* X $ %"  X $ "` `@ @ $2`@[`   @ "  ` `  @  @C@>$@$㿘@*   "&`@hJ 2>;"@">4"@? ?HF  X $ A@@ @< ? @%  X $  " X $ 0@ @ 2@  @     @@@ @ː@&@㿐>+">6a> /"#\> />!(bВ   x > /! "! "`> /!"!"`> /a"a@ K" 㿘  >bW `" `" @  W`  㿘X;  @ 㿘>7"``@6 2` `&  UZ" ̒ $ $ @ $ $$ $ `> `$` $*  $ $` @6ѐ  /, ! Y &  > / 2 @` 2@ @2` 㿐 > ! !> *c "` * & `& `4"`"`?# @ `> / * @ ' '0"` `'4"`Ɛ & J   *J8*` @ ???: P" " `": " D" H" @" <" 8" 4" 0" ," L" (" " " " " 㿘> 0> * > /d'> /!*` "d"dH /d * % ! > /!耢`!> /! `! d "H 0> /!.!(`4$ @ 2 \ 2 \H 0>"&* ` `"``$ ` \"@ L ?$ LH 0 < @$ @$ $ <$ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> /&@"  O &@$ <@  '@&@ 㿘>< 0` Y @D >` ?> /* b      @2< <@2 D  @; ꀦ      < "  SȐ ($"`"` ` "@"`"`@v  $@h$@ @h@& @ @@ 8& 8& V$<㿘 @!`"W & @> re N  L  D 2` /`H /d4 P* % P    \`2  ` `> / "!$ \`" ` `"``> /"! ` \"@ L ?& LH 0  D` & D@ " D? & D "@   D" DH( L P" L> / > / <2" \@" \@ \ ` \"`"@" `` \" `` "`H 㿘> 0  D? & D @ 0 @ D  L 㿘> 0  D? & D @5 @ D  L `L`P`D2`P`\"```` `> / ```\ "`\> / `\"`` `P"`P`P`L"`P`D`\"```` `> / $```\ "`\> /`\"`` 㿘 `` `X `d@ 㿘> 0 @"2 ` @ 2* "  D H "#  < 2  D @ "` <?  @ > /"& 8    &`㿈>7''a'쀠`  㿘 D  & D @!"!>L"& @ @@,` ? @r  ` ?@@ @ޔ@  >!# D?  & D P ># > /" & 8 D˒ @ @& ~b& @ |& @r㿘 D  @  㿘> 0 @㿘 @! ">& @8 p~ 0  X R  <? 8[ D "W D@"@  `2"`2 @>#@ @("6  !   @2 < <@2     @2< <@2 " >#P2 @ @ 7# @ @ 7& @ Q &  D `:& < L 6H /d4 P* % P  >Z#`> /耢 \` `"``" ` \"耢 & \ \"`` \"`"& `H 0 : ?> /(   2<@2"  㿐@?# *`@`@ * @ٔ @ `@?㿘 @(2 # D   @@   ` @2 < <@2  D  2 㿐`3>7"`[ ` 2` `T @\#\`,J  "`   -0?4 -0<>7"l5>71 "`,  `' `2` `   PY $P $ $$mn$ Q 0 > .mb X -㿐 > /! ` *` * J&@$@&@D +> /@aa :  -  &'`X >7" >M#x``dȔ  `” 0'{aː$@&@     @" `" `  2``< <2`"`  㿘\`  $"} $`0`4? P $`4 $ "o$ $`l d h`f d @ 1O `XT\ U `\@$d_,`d" \`A B d@$ g,  "6 , ` 2 > - ``, @2`` `$€@, 2  7@ @"  $`0`4Ҕ P $`4 O 1㿘 `   O 1㿘 ,` >:bТ`   OԒ $`",`㿘@" $ <& $! D " $!& $ 㿘 $! `* @` `€  2  $"2㿘`   @ `I/ -   ! @! 2 @` @XG  @2 !2 2   @2 !2  2 @  㿘 '> /     2> 0 @ >#  2  ># >#֨ 㿘H o@>#> +" >   @ې @   >> 0 㿘> 0  >   @  #  >7! 3  0  @`"  0 "%H /d * % 5ꦐH 0D   ?`>I (   `> 8;' @㿘`  2 -> !"|  >7iҘ"㿐  -\#\ِ 㿘  t   t L`$ L`l " t㿘  t??& t>א @ L`  & LnQ t㿘`IH /d * % >X Ö `p .H 0@  H /d4`t* %`t  `p > hH 0@0H 0H /d * % `l ` h  h`&   `p  `0   h`&  7`h &+0 0  &0>X k "`lH 00*錐0 0 &0LЀ``l` `p > H 0 㿘H /d4 p* % p %  0   0 > אHH 0 |`0+0Ӡ`` >H 00 Ֆ  p  H 00H 0㿘`| > &`| <? 8?  &`D l &` l`"` l& l&`㿘 |2 > !P#!@  `"  "`  "@& L`"& |p 2& | "Lx`"||"`||x"@& | 㿘 | ΐ 0"@`t`x&`t `"  "`  "@!P#!& 㿘 !P#!@   |`"  "`  "@&  0 2 L L`/ l p 2,@ $ L x` |"`| x | "  p <   >7">7"ȓ2   :    >7"@o "@@ & @ "`$@& 㿘>7" " @,ؒ      >7 @4"& " (`" @ 㿘#>7bb  @,  2 2     $b     4 2 >7""  <  㿘`  `@, `0``& `d & dl Z& l`0&@> @P> PH> HX> XhL& ha H Zat!DD l㿘#>7!> *bĒ  bV"t"t> *`"x$bā>7Ą@4>7> *t @H4 L( L  x" | | | | x  L" L> *x*` " x  x |x " |H 㿘> 0 > /"!)> # H /d * % > *>7"x>7*`"Ē` @"" 2 7  $H 0   @ݐH /* d % >7@v Ғ H 0>7b̀ ?"b# )> > +>  (if )> 㿘H /m4> /* .> /!  t> + @t H 0>7">72 ̐ :   >7"Д`"""а 㿐> /!  /$  "`H> *> *bpl `" <#bp>7"Ā@> *"h22   : :` l  #"h>7"đ2`@:  l#"h"h#bp bp$ 㿘  X>7"   `$ ?`$`$ @    `$ @$`$ 㿘 D 2X  @ڒ 0"" H /d * % x`"||"`||x"@L ?"LH 0  "H 㿘>   x>7#0  Se e` Z$ \ Dؒ ''''' P@`@@`@ 2`XD @ $     S0 "0,    `a;` &``&`  "`h0@ $ @$ $`@   ,  R "H0   "`a`: &``X $ `&``   "`<#0΀ Ȱ @ 刖 >70"@** 2 2` -    H" k >$ $   $* @ $ $@*w $   $ ` " $ $ `@$ $ $>ߐ# $ $`  ^ @  $ $` `@ 2 $> # $  $@@"%$` $@ $ $ $@*@ $ $$ $ $     G "$ $ $0?R 23  $> /$`$  2`""" @* @b $    0 `  z0 "`I U㿐 D 7   € "> >z! `!> .` 2  T$  2 `J$ ``2`!> .#;$#P@ D'''''P .  X `  Q "`$0`$@ @  ^  `@㿘 $ ?& $躐  " $ &  $ 2  ` @ " @     @2 $ `L1&"> /@ "` @"@ ` "`  "   >!H:  㿘%> / @(  "`$` 2` ?$`$ @@&ې `` @ "``$ @$`$`@ܐ P@ @'''''  V X `` `@`㿐P֒   ? ` ``   `h h!!P@ @'''''J  X  0`   $>*@$ 0`㿐@ V@ 0`( X 2 `0?"`0`, # g`0  0 `0?"`0`,  g{`0  > $*@$ 0`㿘``@k!)> /!!@2   `%` 0 ` " $ $>*@$@T a !Ӑ` (&&0& 㿐@@ А I ("`0?"`0`, "g `0`@  <  `@Ԓ @< ! `  ` €    @ `7 $`P@ D '''''@2 ` &`P O 2@ D'''''@  "  $  $ 㿘   <   ``@Z @ 0@ Ȣ` (G,0(  @` $ `@?'X'0$``*@ m'T'4$'\ 0   ; 0@ ’   ?``(2ǐ  ?,2(&?"b a(@ $``, 2`, 02 ,>7#4"`,(" (  ?7 ?x 77   0 @;, @sx 5(`@ , 2.,  2`X  $  `<  @  G,  ?@ Ж   @(.+,10@ (&,`, ?"`,,`0?"`0,`, e`0G\0N & D@''''') ؐ@g̒  X'' X$€А `ᕔ   'LNg ``  @`b`(İ FT/P X'T@d  Ti 2  FL` ` 2'LL`< ` -  !@  TdL`< | @ X xTL @  pTdx  ?L@  `TL@ ɖ XT`L`H "`HT `2`T 2 T>7#4"`T`0L)"`(  ?7` ? 77`  0L@ LT @Mఒ L$'L`@ wT 2L@  P&T`, ?"`,T`0?"`0T`, d`0Fd T  P-T0}L FQM %h@ࣔ   2  Fd` p d@ d ` ppMc 2/@v  2'{ 2   F` ԟ 2 X  0    $>*@$ 0`U M, S` N @ 'l 'H'p'L't괐H AX " `< $`8 @ ` / @' '     2 '' ' \Xl@ @ l\S 3 J -P@ @'''''b - <   ` ''''ܐP'  @ @   0@ 3԰ '> . 㘢@$T 24`  'H'l'p'L'tH 'X \@ ~lX@ X X۰ 㘠ܐ $X8 '\l@ /P@  '''''  @ @ FĀ敖0 @!Ĕ@ (  @)   2T W 2T (`<  M ``?  `   @  <  @ B@  "/@ D   6!< % `h@J 2< `  @  (@  B @c 8<   @8< 0>H `B 7" ?`@ʒ  3@?=`'`'' @Ð @'H'l'p'L'tDH @X`@TX $ 4 `?`??I 2>7" ?`@}  3@?`'`'' @v쿐(@&@ O (`@ X $ 5 `?`??IH 2>7" ?`@3  3@?ꥐ`'`'' @+@ ]  0" 0`, `!`0آꂠ`  %* '''  ?耢??'?2@?'@ @'`'8'\'<'d}8 (H`@`X $  + *" " * *   * *''''`@ǐ+`  $Ӑ '''۾  J耢??'?2@?'@|@V  8| (`@:`X  $  + *" " * *   * *''''`@r@ | 0" 0|`, _h`0@ @'p'H'l'L'tH 'X`@`<  @v `@ 駐`? @0y(`@@ 3` `6`( `@`<  @= v? @@3  0" 0`, ^`0㿐@@`  (`@`@G @  `0?"`0`, ^А`0@% '''''L 2u`< ,` '''h''l9h  @ Mx |`<` < `  @ < @ @" @"? | "@Ĕ|@x@m@Ґ 겐 "ꭐ@\p> .}# "> .> .|#? @ `'l'p'H'L'tǐH *X \@-l\ꑐ0rꌐ 荐` '`$`8 ! @'\X@l XXP@  '''''䏐 %`<   " `@    Ĕ@@ĀF0'%`` N `@@ G` 2`(6  < 2 ` `''''''''`@V̒ ?   '@̰:` @Ғ  ` ٫ `"@& 0" 0`, ]`0 $ "`0$@ @'p'H'l'L'tH %  X@U    @FN  `D `@(@ 鱐㿘## " R`   `( <  `0 "`0& 㿈@ #  "  2R  (`< 2` ?0 "0#\``㿈@ " "  2R  (`< 20  "0```?#\ג㿈@ " "  2R  (`< 20  "0```?#\1㿈@ " "  2R  (`< 20  "0```?#\j;l;d;d;l;l;d;l;l;l>>>??? ?,@@@t@t@l@l@t0`,` d$b 6  $`(i$`$ L$`( ` 2`ϐ`''`@`$ {#`@Q`$``@贐 `蔐 `h$`m }$`$a  D$`(Ȑ b`<  Y -bU d` !@ I`d< B @D = @ 6d< p  ?@ "@ @$ ;&@$` &@ `; ` H &H!㿘 X $ " @ <` >N *`    @ " @C    @" @㿘` H?$ H`@N@qp`d hl`@8'\ '''?'쀦 '' '@@ذ %  " @ 㿘(`@@ > <  *  @\@$@ @ C >@@x 㿘 ( `<   2   2  2  `X  $ ` `@ǐ@>@7 @$B>@@? 㿘 (@0 @ "J&@&` <?`>N ,*`   ( 0%  *2 @ 2 >`@&`&` &`&`&`>`8&` &`$&`(&`,&`0&`4&`H&`L&`P0`( <?` >N H*` "@`@@ +`$ " &&!@ !   T`@  a@4   "44` v"`㿘 (@㿘@`@ @! "@t   $ @>0 Xf  @2 @㿘  (V 㿘 (@~㿐#\  "@ך `?ب  `@h " X%}&@ ("'D'@'H`>@!8 'L'T'X'P'\'`@@ ;%`&@ @P%Y Q "" 9(    В ?'?'''''  '<@<      "$ ` (  "  &@ @&   < "  %9 㿘> 0 |  ?.Ő%)&@@ T@' 2&@ 2 &@T 2&@婐&@ &?帐%㿐\ @ `'D'' `> .#PNDD`ޔ D'D2D`W' /S*Q DM'D< `!  `@ ?!@: X`R'DD 2 D` D@ 逢Dd? DȘ `' /*?'D' D& "DD (㿘   `?`  㿈`4  " "  7 #\, 4  ';  A   $@&ԛ@8 㿐>7#\ 8#\''*` @㿈>7#h 8#h''''*` @㿀>7#t 8#t'''''*` @㿀>7# 8#'''''*` @㿀>7# 8#'''''*` @㿀>7# 8#'''''*` @㿀>7# 8#'''''*` @㿀>7# 8#'''''*` @㿀>7# 8#'''''*` @㿀>7# 8#'''''*` @㿀>7# 8#'''''*` @x>7# 8#'''''''*` @؁㿈>7# 8#''''*` @㿈>7# 8#'''*` @㿈>8  8 '''*` @㿀>8  8 '''''*` @㿈>8  8 ''''*` @㿈>8 ( 8 (''''*` @x>8 4 8 4'''''''*` @؁㿀>8 @ 8 @'''''*` @㿈>8 L 8 L''''*` @㿀>8 X 8 X''''''*` @x>8 d 8 d'''''''*` @؁㿈>8 p 8 p''''*` @㿈>8 | 8 |'''*` @㿈>8  8 '''*` @㿈>8  8 '''*` @㿈>8  8 ''''*` @㿈>8  8 ''''*` @x>8  8 ''?'''*` @؁㿐>8  8 ''*` @㿈>8  8 ''''*` @㿀>8  8 ''''''*` @㿈>8  8 '''*` @㿐 |>8`'`'8* @@㿐 |>8a'a'8* @@ 㿘@  " >wʐ# @   㿘@w  >w# 㿘@m   >7 #8*` @  㿘  | " @T  `0("`0H /d * % d H 0  㿘   @, >8    8*` @㿘@  "        㿘>xb#  㿘>wK#ȝ㿘 @! "& @> S  @!  VVVUTtVVVVbbbccbbcb㿘> /@*` @㿐`X``  `$  <`>T#*` > '#$ ` ?0> !` +> !|  > !, #@*` $ q | > !? 㫔  `D 俐 Z@ U > !#, *  $  (@ $@ (  @p?h```͔0.> !#* > !"| ` ?`  > !,  "@*`   t , "> !`* @`` h   Ű `<  > `> ! c* * `@  `w0 6` (` '> ! `#>> !*`" * ` @`3  `h@  +  ? *@  ? *`2 @W*  2 ܀ `"'ܑ:` :` US* 2` ܆`: >  @Tq @ & 8 ` @B܀@D ??#\#`#dɪ ?ɕ`: @"@8 HJ 쀦 "0u#Ӑ 㿘   X 㿈  `<  > H`> ! c* * ` @  `0 2 6` > !  c=(> !*`" * ` @`3  `h@  +=   ? *@  ? *`2 @VƑ*  2 = `= = = ><* 2` `:  @S @ %@ 8  ?ܚ@%8 HIT@ ʯ쀦 "0t  㿘  < `   `>*> ! c* `*> !" `* ` @    @ tʐ 㿘 `< 2 ` > !* c* `@    E㿘 > ! c  ( *` *   ,   € 㿘 < 9H /d4p* %p   0   0 >tz `ѐH 0o0ܠ` >8 m H 0 㿘    F> .!`"> !@> !,  "@ *` @ 㿘   <`; `k>6 4  " `!4   `  !4 " 4 `* @'> !ㄓ*` ( @5M  ` @!1 `* ㄒ@*` 7 @!2  `    '  @!`  ` 4 @!4 > !* "@*` s̐ H  㿘  @ "     % 㿘`  @  ``  `` ` `Q 0 㿘  @ "      㿘 ?  ` > 2 ` `t  >Tć(   "      㿐       #\   㿘>sK x㿐  2`  `* ``?<`  `: 2` * * `@2 H ? `#* @ ` * ’ : ̐ > ! c+  `* @@ `( 2  @ @ "@ 0Ô   "" "`  @$ d $ @<`` @ ` * **@ 㿘 > ! c `* * @     ?   @ 2 `@ 2` `+ * ݡ*  㿘` "$. `". `` ".c `".` ".Z `i`" .S  .    .   h A J $@$ ` $    2$ . 7$ & FÒ % @      %  "@$ $   є  2"` ې Ԑ" `"`"` 㿘 8  . 8 @   " >r,   " @@@ >r "@  2&   "& > / 㿘?2  @n  >8# X `"X""H 㿘? 2 @GH /f4 * '   @Ő@zH 0 㿘?2  @#  2`  @ H /f * '  X   $ X $ 28$ $> "4$ $2$ $ "   28$   > $> b?  #АN6! ? #@'H 00W     )$     2 :  %$  $  $ $ $ H 0 E H /f  @H 0 @H 0 * '  $ $ @$ H 0㾐?2  @y `2`; `\ 2`5 2 0 `  ,V '`l ( @  (  /H /` * ! a, H 0 "" 4" " " 4" " " 0㿘? 2 @% `; I 8< C|@@j@; "v@ "5-"h+fq@- (t@%s@ "$"kbo@ bn@"@ w "p@"k "m@0"{@ "k@"*`Qs@"`H!bv@X  bh@ΐbi@"`w j@"`f@"`l q@6 f "@~x@"5 `<t@"(`@U |@"0 `=O "n@ ">+ "o w@";`LA @"`0<  ~@ "( "y@ " "r@ "&8"u"p@"$ @" "}@ ""z@ 0}@"  "w@ "V"g@ "N "m  v@" @>+ 0"f@"*` "l@ 00"{@l 0H /f * ' ` ``@H 0&& 2ǰ >8#   8$` &$`  @H /f * ' H 00 " H /f4 `8* ' `8   ` @2   ,`8H 00{` u@t "q  n&` j@ e "b  @ 0]@Y"+>+" @P M$`  I G$` "` @Qc&` @Q>+b :&&`46&4,`:616/&@ +$`@),`;'&@ #,`<!& ,`= ?$` $` $`D$`L   $`P    $`T& ($`H &㿘" ( ,` 2 @@ 2S H /f* ' & ,& (H 00b5,`  ,`N '@ !H /f* ' & ,& (ĐH 0-!  -  㿘> /#     0@ p 2 `"`  @( 2 `",    @ !H /f4 * ' @  pH 0 㿘 0  㿘`A?5  2 @@ - H /4`* '`  `: "` ` ` ?  `$ > ""`$+`\H 0㿘? 2 @S@V`?>8 #``&`8&`'#@w < 2  2 0㿘 2 >mm ؀ -@㿘`, ` @`  " 0 = & 0   (@g >^"@2 < "` 6` 2 0㿀''7' @6㿀H '''H7' @6㿐    @ 4   $&  `2  4 r& 4& & & & Km&  D   H` L P  b #  & $ & & & & K&  D   H` L P<  T \ `& \D 㿘  *F  &   *?  & & &   *  7㿘 X? "& X  " (*   " *ے  " (*Ւ  ( " ,*ϒ  , *ɒ @㿘  *  2> />l3 # "@"#""" "&""㿘> /# ;# 2$> '#$ @ 6# > !c>Z @@"   `@ 0c  @@2` #  2 l`h ۖ  `> /*t  2 & D㿐`-    -0%1>8#'E 2`>8#@4 >8#'E " 4&#  > / "  h2l2h 㿘   t )^   > /& h  & l  l"`p" & p㿘 l`" p p"`p p l"@) 㿘 > /  c  "&@ 2`"`@@  ,`    "`&@㿘 ` ,> /#`    2 2  H /f * ' EH 0 㿘I D   H` L P: T@ \ `& \ʒ  H4PX$d<x(`LTlx 8ll@ " 9"@ @: `  " * ( (/  "-    " "  * ( (  * ( (   * ( (  " "@ @: `  "   "  "  *  H  #?? `>a l*`    `>2  w`  `G2  @ X2 ` @ O"@ @:F– ` 2ذ B@ @ **  *`   ` 2 s@ @ *`  @ 2 ` @ "@ @:~ |@  @ 2 ` @ "@ @: @ c, a _  * Z@ * U@ * P"@ * K"@-  () '  *# !  2   "  (  *    2  "  * "  0    *2  "  Ƶ   @J     * 2   3 *`*)>a4(@">8 s >8z "n`" q 2o >8]\d @"U`"P KS F0M "ApP<D 72@ 41. 5   0 " ' @" ! *   :  :   x**``?㿘!> *"|>iJĒc@"|㿘>9  >9 ("`>9>9`@6!>9*` ">9?`#@ "   ">g `@ *` >9 %>9 ` 6 X>9 >9   : >9  " @)>9* @")>9 * * % `  u&1  $ * %p #>9` `  c` & $`  & & >@a>9 >9` * "@!P > ->9 &!P> -  @@#d 㿘!  0@H 0@HX i@( , ( %*  (, ( ,` 0 X>9 i+  h2`,`,`,`4`>i" !$ $  `$  "` &  $ & $&!@$ ,@` *@㿘 X>9`* @ H o *@ g  @g &!H 0㿘H /f4> /* '> /#  @  H 0㿘H /f * ' !@G > -   ,`" @*`$@   2 ,H 0㿘>9    > /#"#"`> /#"#"` & &   $y  & $>f!" "  $m  & (>f!" "  $a  & ,>f!" "> / &  "` "`"& n㿘>9    > /#"#"`> /#"#"` & &   $1  & $>f_!0" "  $%  & (>fS!0" "  $  & ,>fG!0" "& > /c` & `""`,㿘!L!P@&  ` \$ ` "!0 `"  "`>9" (  "@ ` ?& `!0@0*   0& $ & `& >9`$` & `""`> Ho  "`>+!l>  *` 㿘H /f * ' `""`>9" ( "@` ?"`0@ >9 $2 H 0㿘H /f   \@  X* '  \>l {>m>m>mؖ4 <`D ,6 \&!0&!4&!8&!@:Ԓ y@ɐ@(s>:`x@> Ab@ `"  "`> /"#  " ` "<  `"  "`>9" (  ."@`"`& "@  2 X<`"@@"`@> A"!h@<"@ X>9`* @"  "  ?@O  "  2 @ `2@ X!>9 * @"  X* @` t?"`  X  * "# $ (#  ,# > -   0 !* @`" €  2 0@  H 0㿘@  `"&@$`` "&`` &`p"` &` 2㿐@S  @А   €  @Đ @ 㿘@7 0 @ 2`)  2 \$ - "`H /f * ' @!H 0`@`@ `@㿘$  L  А 8 6$`F L B`4 >9 0>9L  9>9  "$@EG 2 @ 2 $  А  *` :` /" @EĒ @,` L*  ?В$ ``L  `2&@>9"  " > /     > / 㿈> /#  &#    4>9 ?` @D ` @z  "@ 㿘    !   & >ha`F>+"@EP dF 㿘  "J& 㿘> /# ,  "%  `  2  @ @]  \ "   "   " @L    2  2  㿘> /# " \ "   "   `@2   `"   @@#    2  2 \ 㿘     >9  > />9 .  >9 9> /#`4` ",` 2#  `` @@ @   @`* "  @ m "   2``2`> / "     22 㿘 ! H ` "D `2; `" " `\ " @ . `"&  @ 2  0" ``   @    @`  @  2㿘 ,`@ ( `$`     $ `@` ?@ &`@"` &`@  >i!Ԁ㿘 \ ?6 \@    " !DF   2!D` ` &!D&!H"`!L?&!L` !D@㿘 \ 6 \@  @㿘@ (7x 㿘  & && 㿘H /f4> /* '> /#  T Z   Z*` 4 Z!@`" @  2T ZH 0>+"D㿘> /# "  0@ 2   0 0a@ a$@ @JF!@:  az@=ay@ :00 !@ #!0!x@0+@0')2 " !z@ܐ@@א ) @   !J@\: aI@a@\ a@ta@ a2@Ȑa1@ Ő0̐a@  a@a@ڐ  !@ "'8 !@  !F0aH@aG@a@"4pa@"6 a@.a5@ a@"( a~@a@" 0 !6@"40 !@r 0!K@"{4k v&ls&h xm(~ n\  H /f * ' {H 0 "\\ 2\H /f * ' H 0\?bR! 4 %4\ \(1 !$p(( 4(  4 @@ @֖t(  @t 2\  @@=@ @\ Ӱ @f Π @ tð'Ւ Š t 2\@\(@4('’ 4@V "\0@ "\0' 4@ "\0' >9X`* @ " `"  2}  " hw    k   b 2`   ``@  \ LH /f * ' \x ?4\7! 4!\! 4\74H 0 ""\ "    2 @!_  2\ 2  - \ @ ؁x@  > /# "f&@    @ `? ``   2 &@O > /#1`. @ ` Ȕ    " ؒ  2    2  ? ``2@   ؐ 0   2Ȣ@? Ɣ "?@"&@㿘!D` ` &!D&!H"`!L?&!L` !D  㿘 , Ӕ  @' > /c` & & & & & $& (" $"` 㿘N@ " @?ՐJ? /$  @?ΐJ? 94 K `  @@ "B ``2@     5    > /# @ 2 $ 2  2  1 .   $ $@$$ $ "$ $` `$` "&  㿘   @r 2  2 ? ` "`&   "@"2"`"`" "@  `? "` $`" ( ("`(> /"#  $ ("ϒ ̒  㿈  ``")   & ``2    ` `@>ڒ @ @D  ``  㿈> /# @ 2 $ 2 0   `"*   & @`2 !  `  @>` `0@o  @`  㿘> /# @ 2 $   $` 㿘> /# @ 2 $ 2   @`(  "`$ `!4 a@`2` 㿘    ` @ ` @㿈> /#  >aH@\ 2 $ "  "  >ՒaH 2  @>  //@  < >]aH x`" @ \`2 @ 2  & @a 6 \? & @ \ > 6 \   \ !4a7ذ㿘\`      -0  -0  6Ϙ  6 㿀\ A A  2": 4   @ 3  8?$ 8 4 " 4 h "  0 4  @  0 @  $ h 2 4Ͱ A " ``> # : A @ "   ,>2!P#>.!P@ 2` !(\((`7  (沔 R (7 M H  70] } / @  ``  &` &`  ` ` `` $`2`X 7     ` ``H /f * ' LP@&$`  7H 2" $DL$H $L "T $T" H 00 >`B<`B <ΐH 00`㿘` '  \`a@ ,h>9  ` @"`  2` `  @  C>9 0@w  !"6 `B > #>   B> aa `  ZHo  "`  #ې0ڀ  \! "@>  0ʑH /f * ' ,2`"1 \  0N 5D0I ` > AaHo  "`>+!l>  *`# > Aq" A >: faHo  "`>+!l>  *` >:O x \ H@ܐ0aC2`@ @ ;  ` 7*@"@2 "E && 1&   ?`&&   -  &$A h,l0  @  `b&   0 &  2" & &  & H 0> *  >980 :*@ `*@`*@`> **"㿘"      .".".".".".">o    %. i. j&!,. h& l& !"  i`E &"  D ; 㿘" `""`"@  7" 2  @ > h( 2 ( 2      @ > a @>2!(2* @ 2( *  㿘Ɛ?㿘֐?㿘   "  ' / ה    >9 P͔ >9 XȔ   ^.@.`.`  `.` .`  .` 㿈H o *@ g    H 00e 耊 2 b H 0X  @l  2  @e  2      & H 0:  7m   H 0, 7Z  U  & & b & b  "`&b b & b$ &b$@)  b( &b(H 0 4㿈H o *@ g  > " b H 00H @  2  @  2  2  H 0. ?  & H 0"  `"  "`  "@ 7b$&b$@Ĕ  b(?&b(H 0 4㿘!>9 `@ א `㿘" Ô  >-  Z-`0 ?>t>s!`ᤘ  $`l4`\$a4$a,,`h,`j`$@ ,`i!> /$#$#$ 0WX`D 쌖  㿘> /#$" A  㿘` 2 D>X"  \  뇖 &`4! @" %4u r 3p A B> ` : B>  > 0Y"(Z /> A"H /f * '  @`"H 0< 7 O & &` 2" "" ">  Ho  "`>+!l>  *`  B> ` : B> H 0 ` "`\ 2@  1@ @"  \ @" A2 \>t ""  /  /" l "  " " " "" " 㿘    2"`>Wݐ"@"` "`"@ "`"& 㿘 `` ``㿘@ 2 & >8 Xǐ"```@ 2&  Ė @ 2& >W"㿘 4 `1/0!50 !6"$` c `@` `" @2@2O &@& F&C& 6> ` `&`&`&`&`€  ` $.     *$*`$Ȑ 2  &`  8   @  2  2 "㿘 2 @2 $ & "@ } 뀦>9x"  x@ 2` @ x   R`  ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @9  2  @>       2 `  @ ``> *  @8@ @@   @  ` 㿘@V``  ` ` @"``V` 6` ``2 @ `    JJ@   ` e` 20_:   :  ",@8 `` V`4 `E ?``2` `@ 2@  "` T4& + @8          2  U    2 @2`  ` 8( :` 0 ?2"  "( * 㿘@`     JJ@ *J 5&& "@ *:  ` ` ``V`8`     $ $ &` &   2& & &  㿐-> /0 @ " @( > *> *"b `'> *Ⱔ@$?('> *L? '> *Ⱒ$@4 !>9>9cĀ6"c> /#(r #Ā 6Ⱂ"@@5$#*)> /#(&Ⰰ` Ⱄ@ 2 V`T0  0  K 0@5`0 0Ⱂ#(D` >bU Q 0/   "  $  `*`:; `>9#*`J:`@2 $ $* @8`6   .  @ 2  :  @ ` *  㿘> /c,  "c,  >  >bT  @5  6 .  " & & & $㿐   ` ?`   2  8`T  퀦`,T :   r     2   $  ` , `$ $`2$$  2`$ ` 2" >S"`$  $`$ $`  $ " ? . & 6` $ 4  @,  ?`8` `T 60 ,T: @& 2 < &2` *`V:@ :V@&$@&`P-T`:  0J  & E$ :T`@2"2,V<`@&!4* "  ` >cS Ӑ Ɛ 2<`V@&$ΐ&㿘m 4  @@" 2 `       2  `"T O > $T c@S@ İ >c@S8 8  ? 2" T `8V @4,  V @2 > / & 2> /#c,""c,2 > Sch   ` ' 2  & 2 & & &   "   b  `2"`"`" S"    `2"`"`&`"3 V  "*#2## & ? " > /c,""c,2>>cR    "  " `2"`"`  # ` , , #㿘V  6   `2  "   V  6    @   2  "  㿘  l   ٔ  " &@㿘@2 l> *"W  P  , $ $ *` 82` K> *">x>w>u>u>y$` #$c`l#l&& & & & &  㿘> - ` !> /> /`(04"0``> /!> /#0`*`>cQ 0)   #> * $b>Q #0*@2g@ #0> *b> *  "⸀ " +  *+> /#( >Q 㿘  >9 7#>9ѐ "$    4 4 > /c4c4 $c4" "c4$  㿘  A"``"  "` "@ 㿘    \x\> / 4㿀> /#4'T'X'P'H'L H  @@2@ `" `@28  "  @Β 2.  @Ē 2$沔 ͖  L4   %฀    2 L k0  ฀  0^ 㿘 `  k -    \ -J`U.`>z#,   M I "F 96C "> 9A0 8 1 8$ + 9 `€"  $ #R   2   2   91& >Pd 㿘> / #D  *    > -?  "& "  > 0  $* €@  2 & 㿐> 0>`(  #\ x KԖ S!> 0 @0ޒ #> - > /  +cD  cD *+cD  2 @  ?>P  0㿘 + >9#Ѐ> / *   ǔ    >9#!> /#@*#@s > />9"#@"c> /#@. @ 2?@?  >9Ѐ> /@* @  㿘`  `<  `4   @ &P'H /` * ! @0] @ @' G  € "A  2= `5' 4!1  0@  "' 8 0$ 8  4") @0, @ ' ' 0' < "  < ' @' < 4 @  0 8 $ 8  > /cH`  "` `   @/ @' @ t H 0㿘 2 8>O0 H?/& 8 4 +  > />O  Pc8? "c8> `P&0@ 0 @ @`` ?"` @  t   > 0 L+㿘 2 >N ? w 0& P   냐 2` r 3 ( @'  0 @2 @ 2  @  2 AC" "4  4 1 2#4o @/V @''''''  0@ ``4> /#L4> / "4cP  @O  A  `'@<> /cH "cH " $@/ @''''Ԓ @  X'D@/ @DD` '`'`0 '`4' `v@`< @ i  D`8  "`8D㿘 4@@ l̒  㿘>} cܟ -㿘   | Cr ꕐ 2 < "   8 4?` & 8 `@2 @  @ "  `@ ڐ "㿘 8   `" 4 ` 2  4\ " 4` & 8 4 2  4  " 4& 4 4 2& 4    "  "   8`" & 4`    0 0 {& 4 4`" 3 8 ` & 8㿘H /` * ! ` @ 2`0, / 2&` "   "p`40T0``   ``    4!&  "  h>M7  $`h  8 ?$ 8$`h`l`"`4`8?"`8$`l`4`@ ? $`4 > /c8 "c8&`8 А $`8ѐ0"ʰ  "ư  4a2 @ @ v@&`0 0&` D &` ` &`0 2`4 `4/> 0IE  7@- x`0 $ 4 0, v$ p`@` I 7`  `@`,J`N 4`y `, " @K 4 t  $ $ @ $ < P`P  v, v$ l`8 "`8 `  v@  Ӕ @4@ . `  v@8 ?$8`2  ?$  4@@"  h l " h* h " $  ݒ I " 4& 8 $ 8 4!%` `H 0㿘@ ?     0 "  ?  8  (    ה  2 & 7 ϐ & h @& 0Ð y  h `8 ?"`8& h 4  , & h X 2   \" `\8& \ 㿘@.@ @`.@ `     .@`@ *@ @,g"( ' `21   |6  2 7 Ē ה " 8 @?@$ 8|} 3{ A| e$ @@,( @ `'''' !( " @U  @, " "//@y ' 'Đ ј ```   @ 8 ` $ 8`24`21 "- 8 @?!$ 8> L0 @    @` ?"` $ @ $ <   &   @㿐#>9c܀ "> />J >`#\#\   F > /"# *">-al>+"-" $c܁㿘>9#܀      @+ && &  & > /<<`&  "`"<& "X: `"` ` "` ` `"@@``"`& `@`"@``€> /@+J @`  '`  v > /#\G  ">?& K! `2` ` "`  " 㿘% p`"  "`   "@`"  "` "`  "@ ` ">?"`KZ!0> /Gs#\ p 2 㿘> #> #  p .& ` 2'  `"  "`   "@`"  "` "`  "@ ` ">?"`K"!`> /#\G;> / 2 > /#\Fl  7@* $ $ $ $  p $  p "`  p& p$ $ $  "&  `  "`> /@*` `> 0 (@ 㿘   X> #H /`4> /* !> /#<G 8`"` ` "` ` `"@@``"`$ `@"@``€> /@*J @`  '`  v > /#\F ">?$J!`" ` &`2H 0>+",㿘N 0 '>9Ԁ  Ԑ@=  "7 , Ԁ , (,``* `(2 @"@,02`#P@ 0     @N  ,4 ( ` $ ,`$$ `" $` (  $ ,$ $  "@"  (>9Ԁ`" `(* 02@``2`( 㿘.  ">9cԀ+ (2  ,? ",""c" "@ ` 0+ 㿘  ` " `> a #>``" `㿘 <2  4 aa 2  # <<<㿘`   e & `  > 0`ܐ? "`> 0``?"`> 0`` ?"` H /``* !` > 0  2 Ԑ `- *  ْ H 00#  > 0`ܐ  "`>9> 0`` "`>9#> 0"  `"   @6 H 0 'L'T'X'P'H  '     '  {  2 6 7  2 >H! (ݸ  @2ظ  ` 2Ը + W)    zw> 0  8`& X6&  2   2 ɐ "    ?8 @(z @ '@`' ` !8  "  !8 Ȁ  c   @ Ð@J` "s 7 '  > 0  "d `^>!ܓ*`    0 OJ($@P`8?"`8"`D < X;6  0ߖ 3`8 4$`8k  $ /sIJ " ` 2 `8 $`8 `Ē`?`?@   " `   f0񀦠0` '`0'`'`D'`t @'ǒ " "/`t @+ ''' 0`<"'`@'\ "'`@ 'X6  @     2 7Z  @ `4  >(& `v`P. @(&   `   È "E "` Ѐ`    "㜒 -&`@Ѐ  2 `  ``4q` "` `"`@ " `@  `@` Ր?"` &`@`  '` &`<> " $`4*@ @&`4$(@}`P`< X6`@ "   Ȁ 2&`D䀤  `t> Ր6`t`X$* &`X$0 &`X - "&  @&`"`` @ > 0 耢 4 ` w1 25   >:2  x  w{ "@y"m   >:>9>9`  5   ` " `"㿘@&} 0 &` &`  &`>@㿘@&n , :  *$ ?  @  *㿘` `  X `    X$ >E!vG    v    v 0 & & & @&! - `  @*@&@ ?   x  -   ,`4@4`,`vϐ 㿘 &   X   X`@ ,  *@& ?    ؔ , )? %`$  '      "v    ' '    '  @%` 4`,`,`4@㿘> 0 耢 "`* @ "" 2@" X2 2 >:2 >:2 >:>9>9 `jX> 0 耢 @%T @   x` X h4 V \ $ >: $ >9>9 F3 X> 0  ` c  @%, @        @'`'`''ؠ = X 2``$"``"`"`     "( '0''   X2`4`"`  "`"` 2 >:2 >:2 >:>9>9`ߐX> 0 耢 @$Œ @p   ` X 04 @' >: 4 >9>9 3 0@    4`@\ @$ @ <  0' ' D'' @'@'\ " t`' t  "@$~ t "/ @ '   x` "$` " ` 4 4 P$  v (,  8$ < <`X4 $ +` "`&`&`X@$@ @> /#"w ``"X@2k`f @'̐  2``` "O'` 4K'Xh4 T\ x$  $ ` 2F`&`5'"@@ 2/`@ '` '`'ؖ ````"`` 4``  X2``"``$"`"` `` "`&```ˀ '''2` x      @# `   '''' '  f H /`4ؐ* !؀ #  $> /01 / `"``")`  `@2`> ` `0 .H H 0#H 0 # 䀦@ '"  &  *` * " @$  &㿘H /` * ! >+">:Vl%&> 0!`` ` @> # 8@ `2`H 0㿘>:`0 `H>   `"  " !> *">$bl>+"$"`4` `< `h `l!@8&`\0Հ "` `0"A 02 `4` ?a&`4`4a'>:`  ې`<>  h`0,`< X4c `<&`` h `X `\!@ `l &`\@" ` ``< @  > 8`<aЀ` h,`< X|4     &`H>aA 0oƐ M > 0> 0!$`#!"$@"k $``4$&`4> 0aa $@a" "a$`> A!d N  `< "H  2 <`   H@2 < ; &```< ,`" M >: > /#$&`<`@ '` ?"`   $ &`@> 0a$?"a$@`"``"``@"@&`H`4 ;&`4` "rܒ 㿈 r  5 `$ $ @!$>9 0 (4  4`(  4 4 , ,  ` ` ` !,  // 㿐!>9 0P "  ^// /   / / {/ `"`H @'>bA#   @V "  @'>bPA  `2``raP ``0> # @( \  2  \    09 \ 26  "$ r?$ ```"+ `4 ?&`4  > # @"  > # >:&`` ` @  $ `@@`@"  >: t`4``` &``&`4$  㿘H /f * ' >:`x `x "`x""?"H 0 +  s      *   : sӐ  h@@ 0qĐ 0x   #   > A!d H2<  @2<!d܀ H2<  @2<  `h ``@  2``2 ڀ"bH@ތ    >9`0@ށ   ܐ@'>bx? 0܀'@>b? ' @`? ``0 : `@F ``4@ܐ@R'ΐ>b`0? 0v`< @A'`< 0仐>9c(@5'䱐> ch?`0 /$```<@", `H" `h`H "$  `h 2 `h`T"  `h 2`T ܐ@ '`< 0䃐>c`0?k 0*  `,  `` > >:# `p $```4 ?$`4 $$ a,`  p$ p0K  ɔ Ŕ @f  `< h   h  `0      (55  (4   //a, X `2`8>>#Ѐ `0`  `  *`& `4 ?$`4@X @` '` ' `v  X> * *쀠 @ * " 2 Ҕ 2 8&  4? $& 8 0  " H``4 @@" @ ' 0 '  ' v   -㿘`H "`>c0!&`&`㿘      *   h@@0o㿘   /  >:0) '0%  >:  @#>:` > 0b @ܺ  > 0a ˔ > 0 a Ɣ  $`> 0|! o㿈 n  4 $ $ @$>9 0   54`  4(  " 4 4 , ,    !,  // 㿘%>:  , >:#>: "`$`??>+">2 > 0! :?  #"? $`> 0!X > 0! S   3㿐ɒBBBBB?????> 0> * , 㿘#> *b   2  $    2   8"       b""" $b$ ?㿘!> *""  "  2   8  " """ $"  㿘> *""  2   " 8㿈%> 0'L'P'T'X'H0   $0`$ 0``n$`0  ` : p~ 2 ` $` "& & @' 0`ng"0q " & & `0``00_ 00\  $  \ V `2Mv  nA0K"`"`8 @2D > A!d'' ` ``t`<`'`'`/` 2` 2@8 ?   &`F 2 &` > 0"!, `` ``t`<`'`'`2`0< 8 2 `m$ 0`" > A!d'' ` ``t`<`'`'`` 2(@8 !@@ 2`?`>"*` ` ( &` &` > 0"!, &` `` ``t`<`'`'`2`0 " \ <` 8 2Z2V ?@> A!d` > A` 2`<`> A`0& > A!d` ` 2`<```t`v0``"q0@ 2``j0&` ` "`` "` ` ^ \&`  "W U  " \ O<` 8 2" `m6"0@?@> A!d` > A` 2`<`> A`0& > A!d` ` 2`<```t`0``0@ 2``0&`  `" `?` >"*`  &`@!㿘H /` * !   ?8  &    \ 2& ߐ? H 00@  &  2 & > 0"!,& H 0㿘    8 ?    \     @ 㿐#> 0a, QH /` * ! > A!d$a,'' `4 `t`< '+  ? $   2    @L   @G  $  $a, ` `t`< ' ' 2 H 0H(> *2     2H㿈 kU  <> -#` @ $` $`$` 2* *2" ""` ` ?$` $`*, $ @4 4 ` `  $` $` ` '/ /  @ > 0a0`  "` 㿐` @ ` > 0!0  $   *#\>: 5 >:Ā> Ad`" `,`( " `<`2`, > Ad`"  `4`0 " `<`2`4 <  8  ?     * H"*  "   " * `` 8 2`*  㿘@w   . ``:` `*`?&@ #: . 㿈 !@  !@ 00!@0  "D V@?; > A!d   2 < a@"'a@"< a a@a@2 a0a#@ a!@| !@  aa%@r a      2 < H@2 < !@2  " 1  P >95#r    |H /` * ! > A$ <ad` <$ @`""`$  $ "&  D  T d $$ $ , d, E, D\ "$ , T, U$ $ t\ > 0aT "aTH 0/      "    H ``<` ` 2`<`H 2`<` ` "  s 1 a@! a@"8\a @0Va@pa@0N0a"@"\  !@a!@ 0?a#@ a%@07Y D\ RS T MN TK d 0 H /` * !  T ̐Ȕ 4 a   H 00     $ 좐$  읔 H 0 \  T   H /` * ! @    H 00|$ M H 00$ 4$ h   H /`4 E* ! E   2 DP   H@" 0  @t d0@  h $ 4\ "! 2 @b T .   2\``"\@T \  !    T    H 00 $ ܒ H 00NH /`  蛐/$* ! @ ` "`&  "@ <`" @ @"`@> A"!h @ <"@ x "$ @$ x$  Ӑ?$ $  H 00   -4 2 >7G#!@ "!@"ǰ -0!@2° - @" 2  2  `  2  @  "  8  !@ "4t!@"  -0!@(t - @2 @ @  "  //# ah@  @0tt @@ 2Z   !@t      2 t  2  08 1!@2x D Dm\  T Tf0@Q! h&& @H @U  D DQ\  T TJ dF d aЖ㿘@㿀H /f * ' `D  !4  a    H 00[H 0 &@’&@ ?0  ??&`,`4``,&`h&`4 &`,`,`d`4 &`(+&`0 p&`$ \  `0`42`,&`X`(2 &`8`D`Ta    `U   @U \  `x 8 '@Ȑ&`x㿘 X H h > A!d``  \  "`H`X`h 2 `<@ 2`<`  `<`2`     $ 㿘` 2` L \  "`H`X`h > A!d "3\  \  " H X h @ 2" <  2 <\ ` ` ؒ ` ?$`  \    ˒    $  2 \ ` ` 鹒 ` ?$`?. ,`20`> /, ")``"%`2H"X" 8>:Ȁ" 0" (2  2`@ 2`\ xH /` * ! %> Ad` ` 2`<` `t  @       2     g&  6  2 @H 0_  && d 2<2& Z 6H 0F ΐ 0  " t & t "`t"t&  a4 @// ' a1؀  `"  "`  "@ ` Ґ?"`  6H 0  'H 0xH /`   倐  * !  ? #& @ `"  "`  "@ ` ` ?"`   /' !4a2ؐԒ 6H 0㿘&&    !  & >47      & >4, @6 *`2``` *  * 2`> 0X(2` > 02`X* 2` ` * 㿐!>: ܀ > @>!\`h#\ ܔ  /  $ > @!\0[ v 7@ $ $ @>: #>:, c>:, c>:, c, H /f4@* '@$ $ ` &`@" &@ >`` * @  $ ` ` * @" ` > ` * "@` >` *` $  < (  `` * @ $`` * @"  < ( > ` `* "@ < ( > ` `* @$ H 0 & ?$  㿐 @> A  !d  " > 2  8 2  "  `   ` `X` `а `< 8 `6`@,'@  , 1 2",4  /# 2  > @aX4  `@ؚ   > @ @  2 0> @aX `@ǚ " ` @R 2` 0`& 82{6 > h >:>: `ڀ  e #l "X>: >:`ҫ* , 5 5`@0@$4@ $@?* 2`@4@5`: 4@ @  > @aX  8@r ߐ06 >1 1 l4@ @ * 2`@ 4@5`( 4@ @ n > @aX  8@C ߐ6 >@ 㿈` `  _   " Y / L> A!d`"`8  ? `H2 `8`  \ "`8`X$ `8 2`8`@R``@o`H 2 `8쀢 1 1'- `' '` @0`> "`8 0 2 `> 2  > 0   12   1$`8 $`(  @4`<㿘 @   "& (@6 < @  @㿘 @ j"` " Hc H @ H /f   '"@* '  `"  "`   "@` "` "  @ "`"`  @ "`H 0 > @!\.㿘` &` @h  , , >4  8$ 㿘` &` @X  , , <4  ($ 㿘` `` (2  @   X H   @@&& H 4 L'' 0 ' ' 4  <씚  4  v  ݘ  㿘 H & H㿘 / 7  /  @  9 >+020  ( `2'  <.02!  8`" 8  82 `````"  @6 `  2 >㿘 H  H@  @  `2  (  . .  (& 㿘@ ` @28 8 9?"8&@2@@ "  < 2@  .`.` &`` @q @` `< \ "`@ 2  4  2 4 B 4 > A!d 2  1d &@< 8 2 D" D> A!d  2 <  D 1'  DH("    >`` ( "`` ( `>` ( `>` (" "  <(>`` ("`` ( <(>``( <(>``("H  @* 2+  3 @   * . ( 2' <(`02! >+`02 8 2    " #"  2 (㿐@'> @X> @X> @.X7`  (@@ 7` >2 <2 82 (2 "X.6(@@ 6 >2 <2 82 (2     & && xxxxxxxxxxxxxxxx|||xy,{||z||yyzL|||z|||||||||||||||||||||||㿘>:"̀ K>:"bЁ㿘` @ , > @b$ "b$`?@ ` 2%`!  @* @          > @b$` "` # ` @ ` 8  @ @*  8   (8' _     _Ւ    `A b   &  Ȑ"   ?@& `( >. > @"$ .` ``" *"` "*  `2 *2* 22*a    2    8?쀢 : >.s   & & & @&  *  "*` *` 2`2`` "` `"` 6  6 . 6_ސ0_ې 㿘& @W㿈'L'P'T'X'H '@` $> @b$` ?"`@8 @ :  a 2 > @b$` ."` "@& & @U > @b$` "`  "@& & (!> @"$*  `" `( >#(*` P>".    A"$ <"$ 7"$   `#er`# "$  *` @`8 "$` "`< 8 >:"#  > @# * >:* ` * `@  0"$` "`>:" 2M/  # "$F/>:" >:"  `  # "$`Đ "`Ā`] @x/' ,' >:" ~` R"$`>: >:"# `o>:d# j /`h'  2  `  \ 2`X " `X&   "$d"$``  "`* `@N" 0J  >:dא>:"Ȁ >"$`#( `  *` @`8 "$` ("`>:##  >:c"` !>:""  ' 쀢 >:"̀ >:"> ⼒`쀢 ""\ʐ @ 0^yx    'ާ,   ?  "^a`> A $ad  H   \ " < X2 < 2+ Hؐ@ n ܐ * / "؀2P> AlT`^/"T~`j   H`B @:P`8 ?"`8 H $ a,@   ]J   `%` "@`"9  D 2 `` 5 ` %` $ $`    ( ` `@ހ `  4 `  ` * `  %` "4@* @ $  "`&  "&   ? @6 @ `]c㿘   , "@& & 4`@T"@4`  "@& &    @  㿐@kT@ba* &. . @ t#㿐: @  " `0)3>: b̰5>:Ѐ  b̀`  &pb̀ & > @"$ !l   *#\>:"ԖP  "+  4 >:@ R @' 0 '' v   P  PR>:#>cA F 㿘>: ɐ" : 2#X \ `   * $ >:`#$< l>:#$ #$*@(X`!'`< l` "X\ "\ H 2 4>+/  2+ X@ ޒ @    0 ' 4'''w v  ݚ > @ #>:* * ` * `@   0 "& \㿘>:">:> @" ]bĀ`?X 2 4>* А  @  @   ' 0' 4' v '[ 㿐> *c 2 "c  > *c* @. 2@ 2@?# W >:@?*?c" > *. * +`22`2  @`888888888888888888888888888888888888888D88888888888888|8888888888(0Px㿈' `1> `>#\ `#+m #X>a  $>a0 z> A>"Ha@#\   % > A>  aH#\  %   Y{   >)!P>:" *"@ *`" *  *  * " * "> @:*$>:b   $> A 2bR  " *"@ *`" *  *  * " * ":* b 4*> A"#> A>; D"b> A!d"!d"`>:# >:#>:"c!> 0!X@ ` @ "(@!X*`2`*2` `  * #  (@ ( @ > A(@> 0*`2`X+ 2` `  * "  (@ 2(> A>aX @ȑ!> A>a` @ȋ" > A> ap@ȅ 㿘H /f * ' > A` ` """`?"H 0 `@ 0܁㿐'> Ad }!> A!l $!l  !l\  2 `  n$`  @2` 2`!l`X a"`X <!l` Y"`  \ 2 !l` M"` ` "  ` 2    \ 2 !l`p 9"`p 2 ?  !l t `" ," t@   !l` ""`& !l`t "`t`@6 > Aal` "` > Aal`  "` >; 2"@ & & [>;" H@ `'@ " 6  \ 2P` 6 2L``< 8 2d` `    ``<`" ` 2`<`  `t 22&`> A!l|8 "|` ? ( "(Y0>:#t  > Al(`Y"(0@Ò 0`?@> A   [В 2 > Aal`  "` > A# " ` @2`  @2 ` @2 ` @"` 2` ``"2 4`*` ` *> Aal`` W"``* 4`*  3 > A!l'>:>:㰒`  $@@ d> A"H$T d 4$d `$" *"@s +@ $@  @` ,4`> A@> Aal`4> @ "`4 `  >:* *  `* ` @  0Y?> Ad=H4 \>:40 '>:`"#<`2< \"<X`8 `0`(2 <`  `2` 2H 㿘`  ` *`  " & .& > A # > A> Acc &@c" "c&` <.` .`  6` &`   &` y&`3 `2Zn` p `     `  逢 + `2` 2> A` ` `@` ` @( :`    $ 0`> A Z1`2``"2` @ "@ "@Xp` @`"``"``@"@> A$"H>:c?"c` `  4 2 ` $` " &` `  $ $" %$`  `  `` `@`@   p `? c * @  > Alh`@b"h^ ` -> AY&@#H'>:㰢?`$ #H㰒?$Y|2 5 `% `% @`"``"``@"@> A #  * @&   *  "@&    @& > Al`W"> A"H#`>:c ?"c㿘 "W `"  "` "@> A#D"H>:c? "c` "` "> A #1㿘H /`  > AĐ ($"4* ! > A#!> A ?  *> Al  `" 2 !> A"4``8 ڐ?"`8$"4H 0㿘#> Ac  > Alc`"# > A㿘 2l `"> A#>:#*` >: : @?> Ax  `-` `  ` ``  ? $`D"y ``Q֪%@`2Ҫ%@>:# "   />; L$ 2?`%@Ӳ   '@ %@ `2   ې@'L H%   < , 8 @ @ ?  ? ~>; `Pސ #>;T`L  H`L @'䔒 H͔   e,$” ꀢ`z逢w` 2  `` ` ?*` `j'I%@ ?   "   -$@W %$@  N>; L"  'H   =>;`P} >; L  /. 'ܒ ܒi  /%@` ``  >:#t @    ?  ?  $ . > Aal`P  "`P㿘> A"8?` > A`"  `8 ?"`8> A""4  > A$ , ,Ԋ"4> A"4   @ > A㿘  + @> c?2 >;> "`H"㿈   //7' r "D  4 $$2: 8 0  > /3 84 #`"+ 8` "#` 0  @2     `@­ 2   8 ?& 8 Լ  2``2` 8 ΐ?& 8 㿘!>; H  Tt   H&  *!> #& ? " **  `  > @  @ "@ > #"㿘  @` , ?h"  "`&  "& @* @@$@㿐   !   `' 2 `> Al(`U"(0     : $"4> A"8 " !> A`@2!> A> A"@"#`!> A"4`"  `8 ?"`8$"4  ,,`!> A$Ӏ"4"4`> A  } "" ` D8 T    D`@8V `?,` < @*>: 4 0&>:  ` >:# `>: >: @#4` 0  >: 4 "` 0   >:#   !> A4  @ > Aal`(  "`(> A!l`$  "`$`, "`,A>" *    > Aal`L  "`L x 0S㿐 " ?`>#*` `> !"|   >: ]#x3>:  Tcc` 5>: c>:ק#c&c _3>:c [ c T&c 3>: 0c>:cHc׫ 0C  > A! :  > A"  0  > A  &> A"#\   `  > A!l    #>: -#\#$x @ (@˂? hR  &@ h    hF &@ h ' @ሀ 2 ؐ@   /؀/X77ؐ///ݔ h  &@@ 2 h @  h &@ ,8D Pxx`````x|8888888888888888888888 Dh 444444444444,,,,,,,,,,4444„°X'X'L'P'T'H  ` @| @<`* @ &@R6`@> `*`*  > A6`&@al`8 "`8@.` `c ѐ '@ @ @`4 "8``@" @8 ?"8'@@    ,`,@`$`"`Q 2 u > A   lA.`< 8 2@"@`> A!d - l "*`<"&` 2< `@ 2@@2\> Aal`TӰ A@< lP`B :P@`4 2`0`< 8 H&`  @` < l'@G '@2}``2@@( @`4 "8``@" @8 ?"8'@@    ,`,@`$`"`Đ 2  y> A   lA.`< 8 2@"@`> A!d - l "*` <"&`  2< ` @ 2@S@2\> Aal`TF A@< lP`B :P@`4 2`0` 2`H&` `< 8 2x`!"6`   .`> Aal`T A T \@ > A" `  \ 2 ` > Aal`T 3 &"`T  > A!d` > A` 2`<`H&` > A!d` ` 2`<``t%`   2"  "` @y ?& @Z`  \ $(Q ̐' " \  Ͱ 12`ɰ  l@Ű (!6?" @6(`" @ "   X 2 ` 6`   䀊  H $@*  ?$ 䀊  H $@ ?& $"`@ 4@"`< 2 `8/` 䀊  H 2 6`  > A & al`x "`x6` @N6`  > taa,  "a, > xc`0 "`0!,@=@@4   (X > A l\ 8"\> Aal`L 4"`L@7  0,ϛ 0-  &!,@PN2 > Aal`D "`D@ ` `8 ِ?"`8P1㿐  `-`&'P ٰ ( "@s ?& @  l OC  > -'@#  & yΔ `  c 6 @ > `**` $& %?Ȑ*:`@4  @ 4  & "@ 4 4 P  G&& `& `䀊 `H   > A & al`x "`x4 @h4 > A!l H`" H`'% QK&   4`4`䀊 `H 24  > A & al`x "`x> Aal`< 7 "`<4 @14 `% H /f * ' aLaP"    > Aal`< 7 "`<aT &aTH 0    OK& 2㿘 '?`  @ J` 2$      8" ' Nc  7  $x`  6 & `> -&`   & & &@&    & yE    @& &  & y8    y3`& 4 㿘  , ?쀤 `  쀢 2 ,@`  4 y@$  ꀢ & ,@  `㿘`     2` >"̓*` `@ "  2|  `w>"P*` o.`m 8k i.`t 8e c.``h ]&`h ?Z&`h`h T&`h ?Q&`h`h K&`h ?H&`h`h B&`h ??&`h`h @9&`h ?6&`h`h"0&`h =-&`h`@' "%  2   "`h"`h " `h  ? &`h ?ߐ  &`h ? &`h - * hMϐd` ^>!̓*`  M '` "Q$  $ ` x; J M  ' `4$ >!P*` ,`m*`t(``h% `h 2 `h 2 `h2 `h2 `h2 `@ Lے ' $ `h  2    "  $ "@ - *㿘 `Mb`&`  `T MVP Ka`   E `&`  w̒`@ `$3`  "/` `  - )'  2$@` ?&` ,`w w$@` א ` ,& M 㿀@   5 ل  5  <&@  , 4 $ $, 4 `>#P*` "   2 > A$!d`  `H2`<`2`  U \@" 1$"  2  , "ݰ  2ٰ  8԰ , "ϰ  2˰ <8 @@ 2ð > A /' *ˁ" " 1 < !d`  `H 2`<`2`  U \@  @ 6  `@ ,` @` 2 @@2 @ 6  0*   , 5Ҕ    *vǒك 54 $ a ;Ґ ,` " X 7  T4 "Q  2M <8  "C `> A !d  H 2<2 "0 1  @   ,` @  2` ,`@ 2`@ 2  1,` #` ,`@` "? @&  ?4  -  @@ @   5@ 5&@㿘 K   &0  # -0+ ``"` @`> A!d`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘     ,  廠   ؿ 5ؼ 5㿘沐 K  ` 4 `@g*`4 h 㿐  @ +   " @ * ` 7 `  <c7 `   0 , 2      L0 2@ hdМddє\ddlрd㿘> A# 呒 㿐 )> A +>;# `# "` V' u`"8 @2J8`"(@2B(`` @2:`5沔 Ki  ".`h"`@ ({`@` L]” 2 `@K "'K '\ L`@ "'  '# 2 u`", `h"`@ ("`@G`@>; L`] 2 `@J #J۞|\z L`@   0      > AJĐ> A!l 0 4" 4" 0㿈 'P'T'X 'H'L h $`7  ?`#@6OG    ?`& &  J        & 2 mG 7 .`6` u.`  6` 8&`&` t " /.` ?#Jo- ( @ "`  `@ *@6`JX  > A6`> Aal`\ "`\  r H㿘`  H  DIk pd1  043m1 0' `" ` 8`    h  ?$ h I\ I ' "  h`  "@  - I 4㿐``  ޮ ``2 `.`>   "`>@!x >;  >;[~ ~> Ac ' w`t, u` "o 9Z; >!e #> /# "[ 1? 8U 1 `@2 'P "F 1C$ 8 = > /# 2 `6 1? (`/ /Y$ (+Zɐ'`   8 (2 9    -  >!I?㿘> t> A* c(* @d""$@4 4 $  tr!t t@I!t   r (4  @; (4 p㿘 |` @+> xb֒ 2,  ` Ԁ@H `"`& "@` Ԁ@" @3> t`H"ΰ ` ``@` ` " $+> t  `$ #!> t!  #   ;`BH; b>0JG"&`&`> t! #  Ȓ ;`B; H` @``"`& `@"@b`"$ `` " $$ 6@ " "2` J  $ 6` $ $" & & $ $" & $$V h $A `"= `  Ԁ@27 `  Ԑ & ` @  `$ `& `@"  "` H` > xZ@ L> x"    Ԁ@"`Y L   !> t! | 'L`" |'P'T'X'H'7  # ' '7~w't 2  `0l   L   @: >@!   2 g!Ш "0' < 8  E' ɐ܀ > 2 ?߀ @ !!( `" /"!( @  !` #"`& !a( "a( 2 , "> ta` "` >' @@LN   @: >ې!   > ta` "`' $ 2 @B @2  2   '' ' `2. `` > x' #h'嗖ت 2 ` 6> ta! @ ` $! > x'#h`2 `! u$!`"`D @`Dk>;Vh `'pH,`@  y@ @ 5> t // '/7/ '7  > th7~aq > taq    O` %`@ gO` `#\@ ܖ ?"<  `D> t T@*!>;@2 W 2   2W 2> taa ""aW 4@#d#\t#`#h@ 4   !>;!Vh` &,>+"> x2`@drœ:`8 #\@  퀦耢   !P" " "''Vh 2 T`7 2 T耢L@, TԀ2 T" T2 T@2 T X" !&T&L{"@ $ T"@ 4 T @* TVn 2 T!> t!!` "!>;!@4"@ 0" 4" >;!@$"@ ! " `` >`B ;`Y#`t" `h" *&t`*&`E&@24ː 2 >+"2`@Vlr :`ِ WJ 뀢 @P T L L"@ \ X"@@ 4 4A T> t!!  #! ԑ: &  B`; #   @E|G%W LW L   t >; `&t> x#T&tt L"@ \ X"@@ @ `& Ԑ" & Vh` &` `ɀ ŀ `p`> taxa"@ `"@ `蠏` `"@ `"@ ` @ =p   &&&@|Vj $tp& t ܒ` &&t5&" /> t`U">+"> x2`@d:` q%6h8t ` ` KJ.H.I 0>;!@"@  p &  6h &Ѐ@"@FR > t! ؒЖ <  ДB; ؚ`'# к?&&ؐ` 耢 L@ " P *  @ '@'t6耢 #`2"L`쀢 <>;!T" 4&L> t !Б:  !B`#!# ; " A` &`6ߠ?4t> t`!t> t &ta`` < B #`;` !  < B`; # &"'@"66  "Vh  " @> t`d" В@$ +> t! Ѐ  # В : ؖ B; Ѐ 6`Ԁ@1`t &t  #  ؒ < B; ؐEr "'耢 L `X" `` " $ &L&L"@ 4&L&L>;!&T`'`X@" hԀ@ @ h?* : `>"|*`  = 67 8> t6h `~" `>;`2Vht ˀ` > t} |`)`S">+"> x2`@d:` o6hz8t ` ` KJ.H.I,   >?&" f>;  Ԁ@E`@"@`> ta` "`276nH> t!` &` A>;n`Ȑ * :`@ .6n  p2 @ ( oT&$&0p&& ``aPB`>``@ R&aPVno@p$@$@ q& o& p@ @ ?& g쀏`6n Vn &6n $ 8& 6n"@ $> ta` "`> t! "@ >`B`;  # >;!@ޒ"@ 0" 4" >;!@Β"@ @24 ' 2 >+"2`@Vlnד:` $p n̒@H?# * 8 &  @   "@ & Vw   Vs "& S t" `h" *&t`*&` &&Vh "$   `0E/ 5`0@ >`   R>+"> x2`@\np:`@P )6h' 6h@w>+"2 :*"@ P.*`R` `@>+"2 :*"@ P*`I``1` @ @*` @ @#` `  2&@2 &> taa "a&&@ &&@ '` ":"6Vh 42 L>7a (6-ߔ ؐ" $& L"  ? ' H  @7 PD ?.D@ !@ؐ"@ 4& 2Vh`^Vh ZԀ@I EBt >; ` &t> x#T&ty> tԚaД & :``  B ;`#`  A9 BSV LRϒ L   `BВt`&tA`"A Vh <  RstԐ `&t&Vh "    (  >+" 6h6h 6h@T>+"2 :*"@ P *`Ql  "2 :*"@ P*`  t `~> t* :`ሐ  `t a@ 0]> taa  !"a>; >;> t!`܀ 6`3@t`@ &t0A>; >;> t!q`Ԁ !``   @  0` '   @  @u0| @  t  ~> t* :`ሐ # @\㿐\S7 "    H@) D@2B@ ">@V h 4:@`jv 24` 21@ "-@V h 4)@ t  @& t`@8.!K2@ $@``jW ``jS  "@V h 4 @ t>;!& ta`&!T&!L@&`@   `   㿘 > 8  &>Q! D D `*D*E " j  ?& ` b4"> t 8*8*` (28 28* & :(8"( 2: 2:`((282:<`"02j @88*`R:(8882l2l  2l2F㿐|)>;  ,t (`<`\ 2?؀ "` \ 2 l>:# 2  l` `(ӟ'  l?؀ ` l ?ؐ * `44**   ؀@* 8 @*t !4(?>;p*$t$d $`@ ks$ !  !.  * .  8 $ $ 4p t  t  㿘 | pb @ )`@: k`T@@k2>7a@ 8 P``T@@@nk!>7a@ 8 P`L` 2 l>;쀢*㿐>;!  > t > u Ԓ" "`!  > t> Ěa#\    㿘'> t 2 > t]> tZ"a> t"`> t!> t f J*`@  L@ jѐ & ;@! * > u@*` Ԥ@ & 8H /` * ! >;! S> t!!B:!  4 `" 8  "` ԑ*` *   "  "@$  `"  "`  "@> u 8`ԑ* *    2 9?$ " = `" >`8 ?Z >"`8>` 79 m& >;! f> t!!pB:!p`!  ԓ* @*`@   :  "   4 `" 8  "`> u* `ԑ*   "  "@$  `"  "`  "@> u 8`ԑ* *    2 ͐?$ " =o `" >`8 ? >"`8>` ˔͒ & 6 >;!*` *  &    &   2>+>aD >+" 2`@ iٓ:`a\ & a\ "`a\&a\& && "$> t> tX ``4B #`:XH 0㿘H /`4 * !   H 00 A>;  `̐ :& > t`B :@ޒ   6 >;* 2 a@*` *  &    &   >+>aD 8>+" 2`@ ib:`2H 00X> t!!hB:!h  6 `" 8  "`> u* `ԑ*   "  "@&  `"  "`  "@> u 8`ԑ* *    2 ې> t`?"` " <| `" >`8 ? >"`8>` ؐڒ H 0㿘H / * ! > t9 đH 0㿘H /`4!\* !!\ Q    4 `" 8  "`> u* `ԑ*   "  "@$  `"  "`  "@> u 8`ԑ* *    2 `> t`?"` " < `" >`8 ? >"`8>` ]_ 2 &!\H 0㿘> t`> t *`@ @ hr >;! @V* @> u*` Ԑ@&H   H 00(*    <2  H@ 2 @ d@   2 u* `ԑ* ` " `@"@$```"``"```"@> u`8`ԑ* *   `2 ~> t`?"`H 0L  ֔ 4 >   `$ 8 $ `$ $`N  2$`  H` e $`  :T   &` `ew   h!% ::ݐ` D t D &`t`2  2 .aK```2 .aJ&`t` `t!&`t@Ԑ  &`x@ 7; ~ `D%>+&aP>;`2`&`@>;`:`̘` &`&a6`h&a,&`&`&a&`g=&`Ԓ `85> t`"d`` "`` `p&a ``&``2``@`V`l:`&`&`&ag&``4` `Ԓ a"@ 4&a`Ԕ&aX``B :`` "` :Z` `" >`8 ?ِ >"`8>` 붔븒 00   @ : "`BS` "` :1` `" >`8 ? >"`8>` 덐돒 > t?`B :㿐H  *  % 2 H 00f  ?" $  H 00W 6 `" 8  "`> u* `ԑ*   "  "@&  `"  "`  "@> u 8`ԑ* *    2 > t`?"`H 0> tx`B :x " 9 `" >`8 ?( >"`8>`  㿐H  *   2 H 00q @"  H 00f``  `6 H 00W`6 `" 8  "`> u* `ԑ*   "  "@&  `"  "`  "@> u 8`ԑ* *    2 눐> t`?"`H 0> t`B : " 9 `" >`8 ? >"`8>` y{   D T L"@ \ X\"@d@ h ?# @4>;  t`'ܔ  '7В `#\hΘ " ̰ '   d !> t#> ta`B  : "&8&&@@  a h @`" @" h ʒ    8 @ @   cH cd&6 &&` 6`  `I 6&4&@ܐ !! 6&Dܐ ` `2( * * @<*@2   &?# T* <2 * * @2` & T* * < &&@. 2> t!Ѐ " 8) `" >`8 ? >"`8>` 酐釒 > t`B : 㿘 I    ` /8I / 2       (`85 7k  , > -#2`  `7 ` `8 `> -| 7#,`4@ &` &`&` &`@@  I  `  L`$` h,` $`  J4  f4` 5 $  <*@ * $ ` $ ,  6  , , 4  2 ,  ,  2 ` @#@$    @B ">;! D " @" I 2  4`44 @z4    | I  /`4` `t>: #,` I  />:# `   ј h`| @`t  a`@  >;!a,T`l" `p* $a  `@`t $`t `t*@$`t``"@`a 8>;T`h L`r ` `*  `` 4`j`  <`   R``4`j`4 $`@``p2  8 `  @* `L`T `\`X"@ 4 ! X@`t @ `@"MatL`r 2Iata@2` `2Bat`a@,=at? aI#* 4a*`Ԑ" " 6,at* 6(at`t2$at2!at``" 4at"at` "at@ ` <`4 8@84`j4 at  - .&`t``!$`  //ѐ= 7ΐΒ`  `t   @" `t aJ@#@'Բ `t ` 2a(2a(  a"a(>;aP@B` "aL  " "` a("`(  "i`tL`r  2 `> ta`l "`l`a@ > t! X P <B`; X # P! H D <B`; H# D 5  '> -#  5В    6< > -# @ & :&  `6b  &5ېF 7 `7 & ` E`@"?> > ta`h "`ha`x "`x``" > ta`p "`pa`t "`t 5'  > -#  5q    5ݐ > -# &  & & & `| & (`x 2 >;! ` `x    ?`t  `a@$`2 `2``4 "a`$ `Ԁ`$ В _ڔ `2`<**` $ , `T2 ?`p& ? aI#* 4a`Ԓ"@ & 2 = 4 ``"@` @ 8 4  , `$`at  2L`r   & *` 2`?# 8"4 L`r `4 2@``$```t `$`$`t`a"@ $`a0  $a>;!> t$a0$a4a` "`` 2 ```@>+"`2`@T`laq:`A`4 " `` 4`ja"@ 4$a` T`h  Ř at    >: 2``|  t*``| m*``|`H`  ` ` ""ad 7 (`p B$a  A`|@J?;  22`tT`h $`t04aF > x#T`)@8$ad> t!`@ "`@`t  `  "` $ `t`Ԓa"@ 4$a`t`Ԓ $aX$`t $`t槐`2+` 㿘!8* : V!:  :>!!<&V j>;!*` `Ԑ  x 4 x>+"  2`@ `ē:`唐V j  j`6 j㿐> x "P> u>#\b !  q !> x>b#\ "  g >;!  [">;!> xq#h@>㿘`x %`| 3A  2atT  > - & > -#  (`@  & 3   2at3ɐ9 at 2%   @4  4 , 8?$ * 2 ( 2` 2* 2 $ + 2  3  `# 4  >* <*@4< $ 4 4 $ $ , 4 㿘   | @ X T L \" " 4 !t H@2     2  ]> -#  $` (] ] `` $` $`]ה ("  44 $ $$ * <*@ $ $ $  , !I=@?#@44 4 @⡒ ?4` 4 @(4 4`>: #>:,`c `  ( |  㿘> u / H @y!$$ >; >4 pc84!( g  >",` ^`` >ʐ!xcU>;   >;  * :` * $ t4!:$ |4!84!<4 l4 l 4 l $!t$!$$! $!d$!`>: #,t$D㿘 | @V h  > t6 hc> ta`  "` a` "``<V!F 2@4 8㿘 |@> @@I t  ?& t I x " t2 t@& t!x CT$ D7 㿘H / * ! > uT H 0> ta` "`㿘@  ` "`$` "2 > x1"@  ?  *!J !J *!J* * !J㿘 DR`h   @`A!`3`@ 4 2aFR`j $2aFRaF "2aF4 8V 6C L   C 㿀`>ˀ` `  +>;`\.  ? >a#4 S >:# MK> x +   #h' ' Њ  `D  @ !@!d:  !`   t*@$ t> t  !h<$!hh $ t$!h $!l 4!p ]4!r  >!<O  E> x `' *`'  #h 2 > t`@ 5 `D 2  @ .!@* Ā&  !`\ A 3 @2 @̒   //7 ' #hl 㿘 D & ` p`4 2  pΜ  p@2 `X  ? $ `Đ㿘 Dΐ    4 qӒ?0%> u #> t Sa!> t@ ;##a@ G  $> tc X[ |`>@ :  |`<@ 5 !t   |`,@ -  |`@ (  `8@ "  |`(@  @ K> xP"0"P@&!P& 㿘> xcd 2> x @"cd> xcX 2> x "cX> xc` !> x @"c`#T >+"@ؒ $#T㿘H /` * !  t@ `H 00 & t(H 0H(> x> xX>;P*`> x \"P"H 㿘  ⠐? hH /`4 t* ! t  H 00"3 j |`"/ j!h ,* j p@<% j!p7!r* !n+ * & t7'`(!>:"$ P> x>̐#h) (H 00`*`:  6 j > t6 ja`$ "`$V!F  <) 0)> t!`( "`(!8V!:* : !< : * V j>;!*` \n !<* :`@ 6 l6 l`$>+ 6 l>+" 2`@V l\Y:`)>:# "=V j |"9V jV h 5V j 3 @ "-V j^ " !t 4 "!t X 2 V j!t` Ȑ@  //(ҙ'̠ " V j X  $ X V j $  ̹ |!8!:* : @6!:6!8 &!0&  ! 8  p2 @I ( [&! &!$!6 nT`"TH 0㿘H /` * !  t@   > tH 005!`, $`,!8V!:* : !< : * V j > x>;!!,"@`>;!P[  `0`$`0J <0 . r. rH 0㿘H /` * !  t@ > tH 00Va 4 # 4V h`Ca | @  +`*>+> x#\ >;!> xd!, "@ @-a 8`# 8 x   `? ' 8>+"> x2`@X[K:`0 >+"> x2`@d[?:` 8H 00 <`"<Ӓ x#\>;!!," >+"> x2`@X PZ:`ɐ0H 0>8@>>>A@@(@X@|@A@@AXAA@EEEFFFII0J<J<IXJ<J<J<J<J<J<J<J<IIxJ<J㿐 `  -I  .V = .Q9 H /`4`* !`  ` `8 " H 0` `.+0  D h`.`>ϐ \   8@ 퀤 ` " `T` 2` x4`` Dٰ >   π  4 h < 8 '   >  ْ  ̐   $ x* 7` `T4`;>>+"> t>; "Е2` ̒@  4 hZ :`ڐ 8h $ $ $!!$ | -@Hx` u >@a n0`  h d `?[| 5V`&HH 0` `H 2`` @"D `!2@  !D  :  6 #&  !E0*@ !D ,,!D``"@``"@@ 4 ~`-H 7?i`  , r $ , r  >"(  `  ,:`   H 0㿘 H /4`* !`  H 0 l 6 h,᐀ `    / +H 00P4 D F% *""  (  `t &`t ?&`t"  (  `$ `p@4 6`p,b 0 + ' " "   *`t "@`p"@H 0㿘` >;`T  > x>;!T>;X>: > xch `  "at2`h  ` ? 4`` 74`㿘 | @V h 4 o  T  D  <@P L@  㿘V h`>ϐ *` H6 h  6 h V h  |< @V h  >+"> x2`@\:`Xh P8㽈 `2 @ 2   `} @"w u rT" l g H /`4* !  > x'#h'/  "  D`"   @  2   5H 002> t!!` "!> x'#h D    @  ?' @ '?''H 0"&@T"㿈a ?`Q>ϐ *`    P  > 0!XԗF  E >  = 61>;! ' x 2*!@ > x" G 2&! `  > t!Д ^!  >; *#\!\ӌVhXWXWpXWXhXXxXXXXXXXXXXXX؝㿘>;!> x%#H#> xc'T 'L'P'X$c'H  2  ' /Ѻ`  /   @:>?"8   2 c` "`  c` y"`w " c 8$` i"`,OTm 'c 2 ?! ``("`(*"`0U @* `6c`*z"0E& c`( "`(`  "` р`2@ٔ  //7  @ي'//7'< 8 " #> x' d #> xccf  >@2]  8`" (@2U  (` ` @2M  <@2H `>沔 *[  6`h"`@ (k+`@ L< 2`@* > x)> xc`   "` ; L`@ "'  ' @  "  c2 >`> xc` "``h"`@ (#+s`@ L x`@;[ Lq`@  > x '#' -> x# $> x 6`$ $  '@ #A   $   #   M$  SV6   ɨ 0I' h" @ (Ȗ h"  2  !> $+ @ L; > x @: L @   0 c`  "` ); )5㿘 @2 8 @:Β L @    @:Ò 㿐>Ԁ`@!` <@ 8` 4 2>; \.  ? >#4  0" > x `' *`'  #V `@   @0#Ż 㿀'T'X'H'L'P ?`#@  (`( `8 8H /` * ! ī  H 00w u 9-K    ?`& &  (  T 7     & K 7  @״` / 7 `8>;' `(' `>7 a`< 7 7  /` &  2*  2 2`* 2 2 *2`2?# 8"7 7 7 `t> x/ `m/ `ؐ& (,`H`",`@`` 0t`&`8ěH 0(4(/㿘``   ``2 `.`>Ґ"p   H /` * ! > xclH 0  >;!>;9  >:` #|*`tH /` * !  ՔH 0d  ( _ 8H /` * ! ó H 0 H 7D  ( = 9H /` * ! $ 8H 0` ?%4`8" %8@# =  H    - ->"P 'j'e㿘H o*@ aǠ H 0㿐& @  " `0 > 8!Xv > x# k 4   *#\>;!ϛ㿐>;!'H'L'P'T 'X  ,  H> x `' " 0H@ 㿐#> xcؒ  $cؐ '2  c (`&$ (0  (    $ 2    />I"`(  c`&"0ΐ  'Ö2  c(`&"(0  (  c` "`2   >  @ڔ  2 &0 "` ">; \ 2% >;!܀ > /#" " "  ` 2` @"Kc 2 cؔ" :` B3  ;`> A">А"`D "@   H /f * ' `` @``&9&`c`  "` H 004$`&)"$0. Q 0$& ` 2" &@`&` &`>  Ho  "`>+!l>  *`QG H 0㿐  &a 2 `k/a%  > xa( a  > x,`%",&{ *z    ?`& &  %Ԕ        & 2  > xc` 7 "`W&<* @ *@@ $ >:4  c4 , a($ a B$ 4 ` &    &,   4  /@ , %> x&c`( / "`(> x#  # &a 2 `  `?쒂B>`  ?쒂B;  㿘`    *0>;ͅ!  > x#ؔ  08!> y >;a'L 'P'T'X"` 'H  , 2   `%#" 0|  `%$ 0r & `    ` 2 " `%"0Z & ؒ ` N"`@ @   2   $  <$  ////ܒ %ה  %Ғ &|   :  B;   % 4 @6   >9 0@ؔ   !"6  `$"㿐a% ```> ya ``2 > y @> y`"  `$"a    #  2  > y`"$r 70M7#֒ @4`  $N:` ?# @6 & ``8 $` > y$`$` $@``#```(? ; B;`(a  `<* @ *@@ $`>:4  c a, , , 4 4 4 a($ a $  //  %[& 㿘`    *0>;K!  > y  E 0H;j&. ㉘ `v  " : "" " 㿘 (0  3`+ +` `? @@ " > `` N@Z &@ @T`@?` N㿐'D`2*@`*2*2222 ///////*2@ `? @" / @?>;a D   @. @. @2 .  `.` @ҫ XX - . (.    `5ک` x`@@ 5 - @ :1V1 )   @ۦ4,Ą 0os@ @0` (`@Ȅ@=_㯨5 - @̄ *1 ) Є * @ 4,Ԅ ?Q@@0` (`@؄@`&ب5 - @܄ "=㯈 1 )  ?ք@㱦4, "W5㾂@ @0` (`@@"5 - @ ?fᓈ1 )  )P@㎄4, m!@@0` (`@@ =b5 -  0,@@ 1 ) @ Q 4, :m㪂@ @0` (`@@ 5Ą]5 -  @S1 ) @6(y⁦4, 9Ȃ@@0` (`@@ xs 5 -  0@ք1 ) @=5Cᇦ 4, V@@0` (`@@ *x5 -  ?;@1 ) @٦4, #J@@0` (`@@?B5 - !}1 ) gX" 4,?yN @@0` (`@@)/D5 - 1 ) =҆`4,/p@@0` (`@@ &߆ƨ5 - :I 1 ) 5;̆ 4,"@ @0` (`@@6u49 5 - 91 ) 蟆4,1+e@@0` (`@0@= HD 5 - 5ʿ@㗄1 ) 1*㧄4,4?$9@@0` (`@0@VքÄ5 - 5#3@ 1 ) 1?}4,4!aф@@0` (`@0@O5 - 5?9@1 ) 1(P 4,4ᡄ@@0` (`@0@=߄₄5 - 5/N@5 1 ) 1 ⻄4,:ᴄ4㑄 @@0` (`@@`@`` %` %@%`%`㿘    ,@  (,@ @ @@  @ ,@,@  @я  ( ..  @   + +   * *    @ * `@ *    * *  * *    +@   * ` * *  * *㿘`  =@  0@\##@u>   ?`  `@Y#$ <@ B $@@ە8 @| d@ d 4?` \> `Y?` ?` @,X "$8_4 2 $<  2  @@  : @L >b@%  8   `h "`h     B;    % =@  @,  > >#Hb >  >b" >" 㿐d'  "`` `  `@#$ <@ B $@@D8 @ d@ d 4` > `>`  `, ( : , p d`> 0" >~#`h<"`h ` 0?A> " <\ "? ?  `@+ 2 : @˘\'@ "&$8`  "``@B:`d `%` d@G p   t \>)#8$ <4  2 $<8    21` < 4\: @˩$@ @J Ȕ$ ( 2&% $ #>!%  <?: @˓$@ @4 d$  0 $    % >#X >ߐ#>b@  P>  >0L`? h %"h@`@q\@6`  T :  :D & @a`  ? `  ?  B; `d `%` d@ʬ< p\"" <0""0 H@Dd"h 2:& >#Pνb ` >>b" 쩖>"X  B'􀕀`@*  'd` $ $  '`  h>@ Fdp@i༢ :@ʁ.?  p@[@vE?2԰  2Ѱ @#Yt 2ǰ x@#Op 2 t *   (?0? ?֚l lB+ 0l `H@p  * ? `%@ 0? ?h w@h H'd@]>= a(@ c, @ "d"8    (@>;"( Ajl@@l@ >;b( ` '  `   @ >;"( ALh @h `- ` d@ɥ p 0@.` @ɉd< p8 :D` @6 Ah  (@ Al 㿘>;", " 㿘& @<@ 2@,I: @c<@ H @   *@ @ ?*@  > c@> `>  X  @0         >#>#  h 2  &    "!    h : " h" d  >#ؔۘ    ഒ :  " X `  l 2 `   P " `  `l  "`ln * "l`P "`P 2   m * "P `  l 2 `   P " `   l?  0& " l P?    ` "`P > >#X̟b > >b  ꌖ> ; 㿈 ,': @Ȇ @ȁ @| '  @ ?m ,@* ,L*@ 6@`& `&  &L 6Ô L*@ 6@`& `&  &L  @ ``: @@''쀦: &$ ``: &@$ G4G  0G%@F &0G@; @8   @18 " 6 L* 쀢  ` `H B&L 6,L* 쀢 6 `& `&H &&&L, 6 L*  6 &L 6L*  6&LG, 㿘 `\@̫ .? 2X`8`t :    @X``C .?  @J``\ :`@V @ʕ` `,@vc@H<  cL*   6`&cL  cL*   6`$cL  $bF`8㿘 @ "`,2  6`,@@6&@  @ .`,@`,@!   @ ٲ``,@"   㿐  >@4;    Ft.  :  @ :`D @  d@ƙD `      ? 0@ H"U`  cԀ > 㿘 cL+ `T'@: @#?@ `8@ ?`?F @B: >   8    >  >]  # H :< $ `: @ƨ`T?  8D* 2` @@ "U@  ` : ф`8#@ @ 8D* 2` @@ "U@  ` : #? *` 4 ?" *`  " `T?-  8D* 2` @@ "U@  `  * ** $?$ $dcLB? `0> #  :< $ `02`T@Ò ='`8?  /  4 - @ " `8P  T@`  @͕; `8 ! 8F* 2` @@ "U@  `   * @*`8`8 $"$ $d cL8B` @ " 8    : @ @ë ` lF+ 3` F+ 3`@*  *    * p   2,> #   :<$ C,& ``*@ /  : >€@" 82 @:>;N  㿘` .`cL  z   H > ;4  #  :< $ `: @~ .6  @U b \ : \. 0` ``:"     @"U@: \ @G  @"U@ " \ @7 2   0> ``>䯐 @"U@"  \ *:    *F > 塒`>䏐 $ 0.6  @U b \  +@* <?$ d cLB? @ 2 8T>   ;` @ ;  8B2(  >0 ؖ6>$!: @_ 8 @ >< > ! > "`   p >’ Ԙ!83 0ڐ\ > # H :<$: @k0  @`@U  `@  2  >!H٘>ǐ!p@"U@`@ o@ؘ - $U`LB  < "\ ~ d@ @ڕ;  @"U@ .`  X PAl * P 4@ @;  @;  @;  d@ @;  @;  @; @  ; @ݐDP @;  @; *` @ 6bU .`T8?-@@"U@:c`   " &  : :@ 4@ :?T >@6F$>`@ E* 2`@@ "U ` : @  >”E !H>!@ E* 2`@@ "U `  * @`*@$$$>` LB-< # @"U@:c` 8 " &  : :@ @  `@>  "U:``@  n$8" $$8 < L` < ## @ U $`LB < "\ H d.@@bU .`  XP@; * P @Ź.@@.d@Ű. @Ů@%@ũ@ P@ÿ* @@@ 4@bU .`TT@ @ "@ ,7ܐ㿘@㿘 ``,?@ > ! `@7h ^> #  H :< $ `@Đ @bU 6` \ `: 2  >!`L`Ҁ 2 >ِ"@"U@ \  +@* * 0@*$ 0 -` $ d<`cLB ;*"4  ?"? *@ @ِ *`@"U@ c``@ 8"4*  ?"? *@ @  >"0 O >="P" * : A&`,@+ 3` `@U c@``@ @+ 3`  8*`  " ;> >’c/  >šcp@*@  #`@*+  8 : @< @>"p >" :`@㿘e$l h * 2`@:   ` .@ )* 2`@:   ` ..)e$`p@@6``8(&@  . .  @&@,?``8 (&@ (>  @&@ 4. '.  '* 'e$( $  cP(  > 0' '|P'T'X@c<? 't 0 \>3"2" 6۰ P @   z4w @s4202 @ D  ` 2   8L20 8 L20 8L0` 8`@   @ @ 0> :ഐ (: 0 #\T\ ;`#h vP@ԐD< ` @|`ക,` (" \  %X\4 5 42ഀ` ഑-` (@: `P@E   \ \ ɒ0\3L? \5@0(;`< D L    (\0\3-? \50 \" < T\: #`#d#h #\~ "N0P@LE ഔ  2 0 (0DL  (ޖT: #\#`  \  0 6H \"0&"`<\@d@X < p\ <@ H\" @ക-` ("   %'pp@  ഒ'* X: ='x  #`T#\: 0^ '  05d'@:p<@\H 3"`@ ഑*  X"'x`% S ` `4 K T 8 : T#`#\0  &@0 `5 d'@r:p<@H 3"`@ ?* 'xt &'tX 33? 02 z H* @ : Fp@ ۘT#`#\: 0ﶔ W\&@0 5C d'@X :pH@<" @\"@p X* '39 3 4  \ "X 0?1 30 5 'd@Ԓ< p\"@l 33@  |xt?Z   `@d|x: 0 F 0  @x`t""@* 0?1L ">y"Ȑ X* `H'2`3#`<` <` T@ `h""`h %| `d<@㿐\#\  㿈`X $  ` ?%``  0@-"``8"`5`I"`T"`Q``"` `d"`$Ґ` $ `  `` "``@ :: `  ``"``"`D` "'``  ` "`` ::(`  `"``"`@```B =``` "``  : `: 0`  `"`H`F ?` %`e\aT 2 `e, 4 ```r2```v2````: ` @ǐ @1 @`* :n``@ D @ :`D @M@`x``* @`d@D     ?`00>찒 "` 20+  ``R @ > `x`R @>Y"`x@ ` H* `7  X $ @11 H'T'  < 2ذ    `` ``ð DX`( ` :  `8 2`( `  `8 2`(`8  `( %  h     ( p     g:  @z      Z:@ 2z@x   > @> 0> 8& H      4e0HFe08Z e4R    #\` E T " =:   : @x@x0 1~  `&    @xe<2 `P  m q: @    #\` E T " :   :  44`0`` ``P@HE      `8 2`0 `  `8  2`0`8 `0`L`e8e@     @ @ @x< Ԓ$ H@Ԁ " <0K `0: : 0`0 : E`P@ F C??`t @ :d?`tC?8: @ d?`0 '̑: 'Ț   p  P  X:   В @;   X "     Ж  :@?? :̚'̤       ( :  p < 82@8    ( "      p  :@` ՘  ` &           (  :   T ("   p  8  P @  p 8 ܚ``  ` `      X  :  T X" , О ;  P Е, ; ښ`   :     > 0  T J,???`t  :`@ c C??`t'7Ȑ : Є @ b B? ?''    X :  Д=Ȗ`d@Ւ@̢ #d#`#\@^ 2'@` '  X "     Ж :@`0BȔ 'Đ 6 ?̘?''̤ \ ,     ( :   (", p "F ,  p   8 4/`0`P *@   :` `8 2`0 `  `8  2`0`8 `0`L`e8e@     @ @ ږđ< @'Ħ<@8    . ( : . p 46`0 `P@F     `8 2!`0 `  `8  2`0`8 `0`L`e8e@   :    @ @    : 44`0 `P@ӐF     `8 2`0 `  `8  2`0`8 `0`L`e8e@     @ @ ` $ >ؑ# :  `h" '"`h $ `T:@: @ E +đ< '   :   Ĕ   :  B; Ę  :  &  @?`''D'' 'XԺ` X''ذ  ' t6 ࠄ?'क  D  :@n D   0: '/^`0"$ > 0 > .  `, "`, 8 HB`B ; H; 8`0`< `8$`0 $<`p>#0`1 ?.d"@`H"'t0  '`H30t6 `X, %t , `X $ @ -! 2'-̐t?5: B? b1, @: %`d@’`?#d#\#` D?N 2'@'0DFؔ ':` F?< ϒ@8@` ) ':@,   : d@ `;`D #\ 2''䀢 ڒ  `0 $`0-rd"ԁ㿐 `P @] $  @BD     `8 2`0 `  `8  2`0`8 `0`L`e8e@     @ @ '`0?*˚ - 0 " <e< H @ & '㿘8>;4/  @. +.`   '@>>>†㔀@p@2 8!/@/8/`/ 8`@ڈ  8    "#2 "2 $*@:@ ( ( 2*@:@ ( (  *@:@ +`? 8    *#+@ *+@ 2@:  @*` * **2@:  @*` *  *2@: @ +*@+@ 8     #+@  +@ *2@:  @* * *2@:  @*  * *2@: @ +@+@ 8 2 2 `?*@: *   2*@: *  ( `?*@: :  㿘>#P "@  㿐> 0 !> > '#,$#?u#а  >> )"`#> ?mb`  >ڐ!#Ѐ E@>>Ð"b >" #b`@  `?"`>3 #@@b`0#> /""` 2""@"`"`  Ԕ Y0 @ 0=߰ @}$4 0  l _ `$!>ր"0`$*@$`$`$ @ @L bL Ҁ(% $`$ `` @`$  $`$  %  R`$* $`$@ % `$@ L Ҁ  *@$`$ `$@0@q C`$@? `Y- ! [^ \ L р 2%`$@>>Ð" Ѱ "` %   `  ,  $#H   DC `0 @&(&&$&&,9͐ < " > ! c  "`$`$ !!`XĐ  Z \G u`$@@#`   ` 2 ?c ?_ ( a Y. Za" @#@ . Y Z`@@$ a Y.a@@ $ @ 4at0 l` `0`&@`$@"& L Ҁ,  %  , #H  `$@%  ?$%@  ?㿐D 2``@*b >:  \ ``  D7 "@>"`: @ @ @* 1@ D @ :`D @@x`* @d@D  0?` ' "@)>0 x@` H* @ `/ `  `R %`)װ >wx$ '  `W   C̐ [E  >Ӌ"`h ?Z1 " ( < @c ?'?ܰ   H@ 2 cL) 0x)0u$#LcP$#P `, /!`h`h#@40 "0)r e(%(@c@E0@Z``4?@ (cL`8`0`41$dH@ `d<@8C ?&ܰ ܒ H.)<`8ސe e$ $>`,  cPe$"@`,`>''''`><%\FT2  0@g h8   8>;4(  㿀 'L' ?@ ? > "` LVӒ`L  Bݚ LZV `$   LXӔ?  L`h Y9 " (>"'쀢? 8  쀢 ;>0  "0( ';>Ðb@:  &2찒 H H%\F!T@= @bh b?͢`>Ð",` ?2%' , L ѐ ?`$% >`$@>Ð"`?  %L>Ð"9  %L?    O !` h  %`%\F!T@ %` ` H- h h#@0 "0($'`@>L р 2 % $% ,  4@l %$` ,*    @)$#L 8@ 0 4/$$H@  d<`@ېC %찒  H-'ߦ' 8@@ݐ@%$ $&b , @ $#P%$`"@ ,@`&b&` "`  2&``  &` &``$%( &`(&`$ %`%@%` t%`$ d%`( 8%`,,````" @x"` " ,$#H : $#H Ԕ!Ӑ`+!Ԑ`Ԓ" @%0> z=aX 0 4 :    @ %0B? 8 <%0 %4  <%0 C % P   #L #H  , , `$@%  ?$%@  #L " 쀢  ';   LWY` `  &b㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:  :`>%0 t : @u %0 B ?>%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿈%\U-?  ĸ ̫=` $ (<  ȵ=  Ӛ' 'I Ӗ) !% 0<`8`==9#!#\9$09$89$@9$H<9#9#9$9$%\FT $4" ##" " $$ " " ́㿘6`$` `v@F @L Ҁ 2` %` `, @5   "#H., #H͒ ` " `Tc`` ? @m L Ҁ   `V{?:`#L   $*@$$$㿘$  ;` & , `@ @;  , ; `T`  V``W 㿘F aT\ "4>ڐ# &`0&`@>`8: @k@ B >`<: @b@ @ d@ d>` -,? >`(>`8B>`0㿘 <  ` 2` p `9ϒ  ` `V` 2&@`WF :u 㿀 L`Ѐ   L`Ҁ " '>Ð# Ѝ`>{#0'''`'>a:$ `` ~ 2䀢 2'耦` Sz` V: 2 V @ L`Ѐ @& 2㿐`@  & > y! 8- > y& ˈ @֒ >Ò H  ll$ 9`>;" bX$`$$ $@$ " 9 ː0 : @& @ @ * ,  @ D @ :`D @@  x `* @ d@D    `? 0" > y9$& * 8$@ x H* @ *$  R > y!$@X " 9n`&`    lQ * "l P 2=%\` Q * "P `  l 2 `   P " `   l?  X " l P?   ` "`P X $ 2%\ $%\F!T@ %,  `"`p`"`t &㿘" ` ( F,,`@  F@   2@"` lP"` 㿘 ` `4?@ 0cL`8`0`4+%dH@ <`d@C  %4  H)`@#`8#8 2`8&`8 ?`T`dc@"    `h %  ,`> c c ;  ` 2  !>6!"`> y>#\ cP   3 > y>#\ 8cX   ) @ 㿘`  ><   -0   -0><  ( ,>;",>;"(㿐   0@8 2 4@   k' @Z   <`0@E $* <  @/     ` 8  ` ` 8` (E?, ! ?  /=(`@$6`H$`H, "'     @ b 4P`8P "X"X  $   %x' ' ` ` `< "C >0B B>0>"       <`     d` 2  )` X` "#`  ` `p ` l` `e `" `0_2`>S#`Q#` ) ``e0 @M 2`<e4G`< `  2    @` 2  ` w ,   `    ? ` ' `ذ ``P@. ` e<`0 @`"* $?  #\  `= @  C   `8 + ` `8 #`8 0@  C : @  C:      @hސ '@h􀥠 @$ `P@E     `8 2`0 `  `8  2`0`8 `0 `L`e8e@     @ @ @ "@& HŔ  H@""`0   >< ,    (    *? !L    " `  $ ` 2-``@ "`  " `   @ 32@`@ `䀢`  {  @@``'@ @ b $`<``@   `   㿘 < 2   "   $@"     `?H /d * % p n  0*@$ 0  p b  0 @X  0  >ʸ#"  h &L   0@> .!$     0 $ 0,x$ 0 $ 0H 0`  |0ǐ KH /d * % p  "  #>Ô :e H 0o $H /d4p* %p  `jH 0   ด `? 㿘  @ ``> yG 8> y C$  㿐 `"     "@        #\ @  P'D X \'%8@@?' "`"D@  @ f'   ( -` ( :    -` p @ >@〥 6`,     -` ( :  -` p   * `p@@B@  0 * `(@ @:B@  `%E  2`  0  2     X*`  : 0 `Б* @a  | ' 8D   `0"2$ (@U`0 > .>`p &`0 8 HB`B ; H; 8QC> 0 ` ,`"",  `H*@`%: " : `%E $ 4@(   -``H ?,    ? ' D   ````"((@ >??> 㿐 X"'`'@ ` 42h ` (e    F?f $ @D  2@(@  >D@ e@ `@b>D d "&>& #  $ @ @@ >&:& D@@ d ڒ`2'@ 㿘>+"> y  0> y> y"a"> y> y ą(  @222㿘> 0 > y!> y@ ađ* @ "  @2 @2   2? > y0 2  㿘  l   n> yȔ@> y !đ* @``2 @`@2@ W  `2`!Đ * @ @ &@ " "@ &    2   㿘    `X   @ 2 O "L   R` $  X9  $" ( 43  X $ 2. @ǐ 2 ?@Ȕ  @   @?     :p `  `  2   & `     `    O `   @ 3\㿘 %ؐ   2,@ p ? '` '`* @ ` ''$`'&@     <   `<  `Mq @   X $ @?  #>  ''耥 '䀥 2 X "X`  ?'X " 8?     ;  ` 82$  `  ` 8 2$ ` $   '$   ;   @ J> .8`B :8 '       aB 2` * @ *    "    :@   2 H?'' H   >< 0 @  >Ô@  "" @$ E*      ?"@`@  ''2 쀢' '@   " ' "  `2  `@dג  "z  @$      ܀  '$  /  2N` "J`  E`LT       aB * 2` @ *  $ $  쀊a$  $ " $ @ $ $ , >$ `ؐ(` $` Mr` $`N?`@ @#oB $  $ > .0`B :0     ` ? @   `8 / `  `8 &`@8  0    ?   : >Ô@       ?   :   $     >$ ^  Y`K  !"$ $   2X/ɐ&@   `  ","' "$`   p  `  ` p    /ư 0`'&@ 0Ԁ+ (`KF |   2Xu   n&@``($`f  L` \$`0 Lt` $`X `  `HԔ B`*@>$`؀/ ,HÒ  "`/b0-*@   2X/&@  ؀    L/` $`&@`@@". 㿘 >`X# o  0 >Z 㿘  ""  @ >Đ ? @ $>O      >E  @   J `@  J   㿘 &`.``  X ( $ .   2 .㿈   ` V !" > 0 #\;  "  "  ":   :   ":  :    $ `     @`"6 Xb@`8  H @  K `   `   ` :  `8 2  `  `8 2 `8  :   :   :  :    :@  "  ?   "@6  @ &   ` `"@    @@@: 6>? H66>: `6KQ ``7$  `3    :` ` 8`( `  ` 8`` ` J  @:   @ ``G㿐`  "@   :`   @ 0 "  2`"`X`?&``  ``?2`` &``X $ @  s   $ 㿐   : @ %"`X ( * `?&``  ``?2`` &``X $ @> J  $ `        2C >` ܐ  #\#`#h#d#l  E= 2/ ܀ 2+  "' `" 4 M  .2M  @"  M .2 @   D4 @8  `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# ,ܔ X `찒 <   #`#\ #d#h#l   Dɚ  2> x܀ ,        -  㿐 `   &@㿘"0`D  `0`4&& 㿘> cd  E"cd 㿐 `` )&`  ` 2     `` l  &` P,- F&& /D///D/D//D/D/D^|^^^^^^^_________㿘 >7b* @  @ 3 "   q  㿘 >7@b* @`  @  " #" ( "qҒ   "`L"    ::p+İ " <- $ `  `d  X  2   `"`㿐   D `da  (  V  &  "`    "  ``B > `  ?> #  ;"  "` #"`> #  0" 0   &   :  :      :  : ( ``B > `  "    >    ::0  ?&  㿘  ``<`> #*` `X $ 6  21"      d` 2#    X` "       p    t  /`<㿐  c   (  V  $  "`    "  ``B < `  ?> #  ;"  "` #"`> #  0" 0   $   :  :      :  : ( ``B < `  "    >    ::0  ?$  $` $`    /$` $`    p $`     t $`    ( t$`L     <`      $$`,     D$`0     ,$`4     @$`8     4$`<    $ H$`@    d X$`H    l P$`D <  (@ X 8$`(     h :3`+  +`   2`*  *` <`P <$@ `<`X 㿘   @    `?2V `?2R `?2N `(?J `L?F`T?B`D?"`H< ?"y  X $ 4    `  p@  `  @"`] `      d  > !   X > !"|   1 5`H   d X  `H?# @   ?d "d?X "X ?` #`H @ `d  "`d`H"`d `X "`X  $ `H` ð      d`   `  X`  ` 2 X`?"`  X $  `@ ` ?2 `$?"4`,      <   "  X  " X  $ x  @ ` @`$ m` 8  2`,`$(`, `,?2 X`4?"H` X $ 2U    `  p@ `4  @"`4~ "`4`` ; DM 4`4?"`,  $ `,?   X $   "  $  ``4`, `   X $   @  n~㿘      p@   @" ' "? "  < b" 4 O    t  2 d" "   @ 02@ o  @2@  $  @ "     "2 @Zg 㿘   `  ` p 2 ` `  ` t `  ` p` @ ` p @ ` t`    2`  ` ` ` t ` ` p ` ` h:  " "`& 0" t" p%`  `" `  `"  G ? 02 > 2`` $`  `  `@ 72@2  .`  `@ ;&2@ " t" p͐`  `" `  `"  !@   E㿘 `<  $`   d X` 2(  `   ` d` 2    X` "     G` l  l '0&&㾐   <  C X X@C   @+ C|0t `   `R c    R c CeW   ` d`   ` X` COA ` $``  `` 2````$`      "`?$``  ``?2`` $`> .ɐ# "l[ lV CA &T㾈` ` ` `X'``' X@  C X@ B耥&J&*耢 &$BӐ&;&90! `  ` d X` ְ  `  ` d X` ǰ  + <  B%%& ? %>  %"” %B ?)     R c   R c B y   d X` `   ` d`    X` Bv T   <  0@< : ` A`  耢  ` @` BL *  @J .@  `   B/   $` "k4     $  ` 2``$     Bƀ ` @` A`2+ ) %$Ő`   "`%0@2>$ В!є %   2w`@>  < ;`   `R c r  `R c j ` $``  `` 2````$`    `?$``  ``?2`` E$`  5 4`?$``  ``?2````$`    je $i`@>@> @2` >! `"2 ` * ""& ` `"!  ` p@   @    p ذ    Ѱ    <  0<   B``  B     2  2s  2`?$`?$$ 2  `  ``?2`` $`  `?2`  $    @` f i #萂 i # ? %>֐   B#쀢 2  "`>Ð!# 0^">!  > .+#``  ""0 $``  `2Ԓ " <$``  `2  $  ` 2``$    2j X (  ><>< 4`"!: Lؔ `''` #\  "  2G`   `":``  $`` `  Ԓ @T А`HV `     ? ?а  VԔАi 2  "`h, `"@?$  `?2` $$``  `2 ` $`"> .v#"㿘  @  " @"0!!z  n   j B` 2` a B ` d X` T      d` J ` X` A `$` $     ` $`  ,$ g m`  ``?2`` $`   `?2` `$ X $ @ @? @@ Ig} !!㿀 (`  @ ?  "gd @ X (@6     ( <`: p P   <`:  $   #`#\  #d#h#l  9P !3㿘    !@| "@$" "   <ߔ 2N  "J > >A!8  #"@@ D  4(    "@ < s, "@ " @ "D @42 8$          2        2   8# #㿘 ` `    `X ( 2  `    h:  "      2     ( p    <9 㿘    r l㿘    `r l㿘  q l㿘` |<? >!X p h@25 p t l@20 p  h  l p=5 " p 0$ 4($ 0H /d * % 9H 005?2  p t?2 p H@ <$ @ p?2  t?2 H /d * % H 0 >8  ` $ D8*` @ 㿘 >7`> /`"#*` @㿘 >7`> /`"#*` @㿐   D d>7X  *  "Z>7  $  "`    "  ``B < `  "C ?> #  <"  "` $"`> #  1" "2>7   $   :  :      :  : ( ``B < `  "    >    ::0  ?$ >7#> /b* @@ > ,(      $ "     㿐  `  `h` `    #\ % 㿐>7 "P`  `2 * @`$$ <> #L*` $ 8`  ` ( t > / b& $ 8 $  8$` -`  @ $ @X`` <``* *" * *" *<``&㾈`<&  `   > .#0 `&" p `     `  t   "`t `  t  "``    `"  2   "`> .#``  vt0u $``  `24 >7"P `<  " <$``  `2 ` ` `$2 ` `$"`` ` t z 2`z " ``  `@ ;2@``    2>Q 2@> .z# &> .q# $``  `2 ` $`" < P >< 2 ><d 8><t 8 8 < "   <2  2  <`@   3    4      #  ,  #  @ `@" "  2   , `@  " "  @  2   N㿘> z  6@ @ @&>!p.`@㿘> z س6@ @  &>!.`  .㿘> z  6@ @ @>!.` @ 2>{!`"   > !h €   .` " >e" "   * "@  $  .`"@㿘> z  6@ @ @&>I".`@ 2"@>A"8?@  +  ?.`"  * "@?"㿘 &  &     " @~ ?   @ 0@ 㿘? &@0' 2    ?&  2  2   " @M ?   @X?0@S?㿐>6!!> y#\>Đ!̒ ,bX  l !R㿘> z ؀6@?6@#> y `a̰ "- qo* 2  * && & & & &  bom &  bof  & o_ b  &  p b p ba̰    @P?*> y & $ $"`("& (㿘 o b o b o b ?"> yo b> y!㿘 > z $ؐ"  L2  P@` 6@ &`` ?@  ` ?@ 6` " @ ` $ ` *  " * ? ""$` pܑ,2 `  ?  b-nܔ  2-` o b?$` - b nϐ b nʐ bnŔ  ` 2` os b`on b oi b\ % `*`` 5*`$`` * .` *  @O`$`` * !`  * @@O~` #$`` * ` * @Oo ` @ $` " @& ` $2* *  % ?%" b$`o$` o bo b ?o b 㿘 P> z $ ؐ"  L2 `  2`, @ "  `> !h € &`0 `,   L@@6``*` `> !h €` &`㿘  - $` ("`( ( $"   , @ * @`>` 2?>"` "`@   & && 㿘`P 29"+`$> z``$` " 2 ! , @' ڒ@@  Ӓ` @ @* `$`$@@?`$` &`L"@ &`P`8 ;> z`8 ?&`8` ``$ " @?69> y `&!̠ ", o|.2  * $$ $ $ $ $  bmz $  bms  $ ml b  $  n! b n b!̠ b`P   `8 &`8$0S6! `L*  * @ "   `"` "`  "   * "@  $ &`L * "  *@N ? &   ?&   ? `` `$"  ?`L@2 `8&`L ?&`8&`P> y $ $ $"`("$ (㿐`P j- @* @2`>Đ" $U4 2Q( (Ho  "`>Đ" @   #\   @1G  `  `">@>@8"@-` (?$`"Ho  ?"`@-2 &㿘> z ؠ6 2 >" " " 4 >" 2 @   &``"&@㿘  b* l_  & ? &   8"`"@㿘  @@* ,` `  8 @&@ 8 $ $ " & .`$8 $"  @@ە,`` - `  8 ? @R@>>#  `  8 @$ 8 $ $ " & ,,$ 8 $"  <>#@@ @-  - 8 $ " ,`,`$ 8 $" 2@@@@,`㿘 6@9  5   * -    , @&!  *@"@  @?  +   ?*"    * "@ ?& `? #`@ ̀8> y" U  ('' ("$ ( $ ' $"`($ $ $'  ( 6& *@ * @ @@ $  `@$    $ /    & 쀢`"`("@`"`("@ " (㿐>6!#\!> y>Đ" cp   > z `&`"ȓ:`㿘> y"  & & && 㿘 - 4  @C $   " ( 4$ ?$ 4  (Ho  "`0> !h €@1    > z``p?"`p@> y"㿘  @A˒ & 4( (H "4"4 㿘  @e ")   ""    @A  (& Ho  ?"`> " @> !h €@*㿘 (>` $ * @ @ >` 2  2 > y #P͒  &" $& > &   @K @㿘`  < >Z#x>H#` @. @  `) * @ "@   " ?" `"`"> y#PE 0` .`@"@㿘  @0  ( 6' $ $,@`" , ` "  @@ > z``p?"`p  , @> y#P  & $ $jh c> z 6  , @ "  @@ > z``p?"`p  &  jM c> z 㿘> z  `  . 6>< > >#ؠ#h $ ?$ $  "` ><> `#h>   "> z   $ $ $ ``'>< 6` @ : ! 8  c` ( $ $>v @. i> c $ >l h`  ?$ >< $ $$  $ $ >  $ , ,"`0"$ 0㿐> c  "c> "#> !>6!"c> y>Ő#P` X   #\> z>#\ ` 4  ֘ 㿘@ " 㿘@㿘 ??? <&  ,`" 0 0"`0 0 ,"@  &  (   (Ho  "` > !h €> z @  @i@/ `2 (  & ɐ㿘 `  > z ب   * 9: 3> z`  8    +@; 8D  ;`   @ 2 (  > `  * :  > z  ء:`@d2`*  *`  2 @ `  ` `" @'ɔ{ > z t   $@n ` 2k $` e В :F4 @' P` "  4F>ŀ C> 4?> 4 2> 0 2:> !h €@(:1  4 2+ 0 2' (  (Ho  "`> !h €> z @0 @@./ ` ``4`{` 㿐d@   z  ?k@'& I> z ؒ@`   ` @  E `* ` ` .`@ * #\  @,  (Ho  ?"` (Ho  "`  ( !> z  (Ho  "`&> z Ш  :D 'ɰ ǰ     2> z"> z> z ؒ@v @& 2" (#\  @+  (>@2 9Ho  "`- ! (Ho  "`>Ŕ" Ho  "`&  S> z` "` @ m `* `` .`@`2@'$ (@=   ( ( ?Z?@=  (Ho  ?"`@,0Ho  ?"`> "@&> z Ш  :DD 㿘> !h  €> z @ @`&@@,      s 㿘' @=c 㿘> #`G@ "`,J0G  㿘  @,  (&?  $*@" +  6   *`@-@ " (&  + 2 < $ 6  , @ 6  @  2  &  㿀> z ؖ .@  : ' #\'#`#d  ")  #  @<ܒ (Ho  ?"`> " @> !h €@%> >  㿘 > !*c * ` @ Y>ې"T>ې"؀PN "!> ?D> z В :F !> #`$ (`@2` ` (`` `&`>Ő"0 !> `` &``&`` ?,&` eF #``@2` `e !>  >< & &&  & &  & & & ##`&  "`$$#& $ " 㿘  ? &     & >Ŕ "ޖ   ` $"`$ $ "  e  㿘 8( \ ` "R  g6 M  > !* c* ` @   0&@ @  B >  < a$@  > g >@0!0' > z Ф :@ D@ ,> z,?2   " f 㿘 & &   2  $ >Ŕؐ  W    f 2   $   @  2  $  ` 2 g+`  $ "@ @*&  `8 "  `( ` 2& g`&   & `( `8     a   8   > ` 2>f`>@0!@   f㿐> z  `"    > 0 !<b@  "b@> 0 !<bD "bD    4  T "3#\ ( ! (Ұ Ho  "`> z``А "`   "> f) > P> f! >Ŕ`" +     @(L  > z f  > z``>Ŕ"`@/!p   e > z`"@:  > z  `ؐ $` eǐ   @"`eݐ   $`܀J (  (2 (Ho  ?"` ( > !h €r > z e > z``԰  6"`Ԁ "> &@:c ?&@) "&  e ! "@@#ܐ  "> z `L ` " > z  ez 0`` "`> z`'LА `"` .@ `?''''D '@''e9 @+܀ eM   $ܒ"@@*'`8 `(e< '  '耢` < @/ H 'HL H 'HH 2 8 (  e (@> z`` "`P  ( D d 0D %T>< *` * > z ؒ @#@2 8 $" 2 ?@ ,@ #@ @  'D      L$   T N `K '  # .  "  "  ( 2  4 2  0 2  > !h €@" &.  > z ,@   0$B:`@  F `    ,`> z ؤ$,@  @P  @> a,T X?9"@ X XX/"?@"@) `%> z`4 !> z`( !> z@" > z  > ؒ`"    H   0`8a$@> z в`@@  `  `  @#`#\` @LX "  k`2k'L> z``X 'P"` 0$@8C  #\ @ T #`#d PP D'L @@  1?/@+'L@"> z``>  "`8 H   08a$@(Ho  ?"`> z в`@@Ȧ`'L`-`@#     4`^ 2 Z W#\     @% 2 cn >@-! @"+> !h € "`4?"`4" (Ho * "`@!$(%Ho  "`(Ho  ?"`T> z  P> z a $a   #\   @%K  2 "c   h p 2``̰  $`>Œ`$`@,!@!(Ho  ?"``Lܖ ` &#  ? &   `"   H ؘ0> !$@8@܀ b > z  h p >@,G!PL @ (Ho  ?"`@ 䀥 ?'L    8 @ L  > 0 !<b@ "b@ 0 !<bD "bDbo %> z`  "`'P 0" @8C ` #\  T#`#dLP  Ұ > +>Ő  ~Ö ؠ `$ b @" b/   $ L ( ` `L` B" ` b  `,L`( Ll L(  Ԑ `" $€ @ F L(Ho  ?"`؀{!> z  "`8 2L4 2#\     @$ &LL`( L$ L(Ho  ?"`@La  >Œ`"@+>!G@ f(Ho  ?"`> !h €LL`( L L(Ho  ?"`L    @$ߖ @$ڒ'L L#\8@?    @#  :LL`(  @LL(Ho  ?"`a7  > z  p h@ > z``̰  "` >Œ`& @*!؀?+> z`a"a@ؒ  > !h €LL`( Lh L(Ho  ?"`L@A `a  "a `Lܖ ` 4# H ؘ0> !$@8@܀ &L( (2(Ho  ?"`` > z  h p >@ @*K!T؀ @(@(Ho  ?"`> z @~  (@ݐ( (~(Ho  ?"``x  㿘   @ 0> z Р  㿘 `7@`O㿈@  _@>!!!, P`$'`$@:` H > z@q> z ><a0  2 2: *`" * > {!x @   @#@   `2: 2??* > {"@x*`*  * @ "> z@> z в@@ > 㿘  > z Ԣ%><@8 @_ @_ɐ`㿘> z Ԕ@8@  $ F 㿘> z Ԕ@8@  P $㿘a<&`$@3" @ $&`$" &`   @>2   `ʐ"\@{㿘@ $><!@!<&!<  `:`0  88  8  > z8( (` : P㿘> >Ő   {ז > >   $  02 J 5 8 4  ><    `8  2 0` > z  (  8 㿐> z Ѐ 2> z>"0  @="$> {("at@@@@b]@%B @  @Z㿐` ` ?@@ y =#@r -> z@$@  @ @ 8      `Y+><a@   MЀ J 4* *@ ? $8rהa$@  &>Ŕؐ {   ^ 2 &a@@  a` ^`  @    `+><㿀>' > z"b!> # @>  ,#@$#E#'#`&  #\#d ?@ǚ? #>#"P#><"!㿈\`@> z #\#' . #`#d ?@? "@>"&@b   @@G 2 @>"@J$@@ >"㿘  *@ > z`( `(Ho  "` > z> z ؒ@{ܐ:@!ې> z В @ :DאԒ㿐Q> !,>  , B> z ><a0  2 2: *`" * > {!x @   @#@   `2: 2??* > {"@x*`*  * @ >\#@!> z а > 㿀> z  0## @ . '#`#\#d?@ښ? f 2d` ><!  0"   "S #\ @v  (Ho  ?"` ` >> z  h p  >@@l $ @&#@2 > > #  8 > z!$ 8 @ > z В : D 2 㿘> z Ԕ@ 8 @ @; 㿐 2> z & >Ŕؐ  yY    \ 2   & > z Ԕ@ 8 @ @ N { ]+  @  㿀)> z  '> z$ 0`@ #'.@ '#`#\#d?@?  ><s & @ l !`  0 "@\$@ "( (>T#PHo  "`>Ő x"x 6` #\ @ (Ho  ?"` > > 0 D@>@%Ԑ#`!$8 @  В :@ D&@  `$ @:Ô&㿘@ 㿀> z`Ԑ 0c'> z@ '#`⨔.@ #\#d?@?  㿀> z  0@  4.@ " @> z " 0#''#`#\#d@c  >Ŕ x` > z㿘?Ԗ?㿘H / * ' > z ЀM`?H p@㿘H / * ' > z H 0㿘> z"@O !> z"  > ! & : ($"($""   $""* @> z><> z`Д !ɖ > zⰢ`""*`@ "> z> zb"""">0#W] 㿘>0>Ő#㨒 W 㿘 `> z"> zb  > z>Ő" wŖ  `><> z `  !`Ѐ` 2"!> z@O"> z> zⴐ""@$"@O#"> z"" ʀ`yz ƀ`㿘!> z@Or" > z"" wǘ > zⰀ > z""""Ⰰ`2>> z"> z"@> zySⰀ` > z>ŐbȔ (w > z@OW"㿘!> z@O?"> z> z""Ⱂ`&"@OG#"㿘  Xx @$㿘&   & x>& 0& 4& & c& (& ,& p& t& & ZՐ & & |㿐  & >Ŕؐ  w"    Z 2   & @ Z  @  x" x㿘 x?  & x 0 4Ė @^Xђ 㿘`@L "` "L$ `2&$` @ $`@" @`$`` &``@@2"`"@&&@$`@א` &`@ѐ$ $`  $   $ " @$` $ @2"`"@&N$  " @ 2@$ $` $ L2&$` ` $@`" @`$`` &``@@2"`"@&&`$`@` &`@$ $`  $  $" @t$` $ @2"`"@&$$@c `$ @]$```"` "V`" 㿘!2 ` 2'& &` ` &`" @:`&`` &`@@2"`"@&&&`@) &@#$ ``"`   "      2+`  2$  &   & " @&` $ @2"`"@&$ &@ $ @&`` & &`  2" ` &`" @Ґ`&`` &`@@2"`"@&&`&" &` @ &@" @`&`` &`@@2"`"@&&&`@ &@$ @`"` ` "  ` & Z"` 2+`  2$  &  &" @r&` $ @2"`"@&$&@a $ @[&@` & &`  2" @ &@" @I`&`` &`@@2"`"@&&&`@8 &@2$  " 2@2& 㿘@2`G` B  " 2 $`" &@2$`$@@$`" ``" &@2"`"@`@$ @" ` 2" `@ِ$    0`` $`" &@2$`$@@Đ$` o㿘@   `  @? @ ` &` &`&`  &@`6$ $@$ $@  " `  ?@ &  " `  ?@   "  20"   " " "     2 0"   " "  `` 2  4`$ @`8`  8㿘&`&```㿘Ԑ&`&` ` @㿘` ` @ Ӑ Β㿘 >+" H> z* ')> z"$ h '   >ݐ#  ``` `> z @y `?*$@,* > ><" Hya >ϐ > z`aP"$  "h"aPH 0 . X! > z> { l   . X" . X㿘 X  H /f * ' > z$h> z& `aP"h?"aPH 0 0 > { l0> z"㿘ǔ X㿘`$` 7&`H㿘 > z $ ؔ" 2 L, P㿘 > z $ ؔ" 2 LH P㿐><!H> z>ƒ"Đ H"`"` "`"`> {>Ɣ@"@ h"" ""> {>ƒ,", "`"` "`"`> {>ƔX"X "" ""> {T"T>" #!H`" " " > z"""" #> z"$>  h`H " h"` `!>6!> z>ƚ`#\# Ȕ   #> z>ƚ`ؐb#\ `   > {>Ɛ l ``#\   br㿘k $ $&`( "&` `0@ B >`0&`  P  L `L p`& p`$ `$ " "`8  V (0 `( €㿘.&`$$ ` & ( "`P 0@ B < 0`P `LΒ LT p & p$ `$ &` V"`8   (0 `( €㿈`6  06 d  ` 5   `H `    @U`?`  $ "\",  2\ $>Ŕؐ q͖   Uk 2 $\#d#`@#\@  > z  U bĐ "bĸ  ?  ><!  0@" o`$@@j@f`(b"`8` `0"@BW@U`8 P`<L`@H`DD`T@`H <`P`@ 4`V " > { U:0> {a@  "a@ `"`$@`$$`$_t{$t2y$> z 6@p"`@ @` @> {a, "a,s@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8 8 $ 8$ <$ @$ D$ T$ H> z ؐ *   $ P$ L$ L$ Pp`$p$ `$ $` "t $t2 $> z 6@"2`$ @:$  T     > {X X @  "  p$ (  p> {T T". 4 `  ,`  "" @*$@   (  @* ""   2$""  㿐@?\' @h)  ?@ @uא'&@ 4@          㿘> z Ѐ*#c    @u"6W㿘 $ ɰ >* > z԰ .㿀0'X'HX ` d@ 'H4H@0@0@ @ $'H4 @  $'H@H4@ʀ@ Ȑ "$ :$˰ #\ HW 2$ '  H $@ `"`$@:$:  `"$`*$ $ * (: `` '􀢠`$H@ *'H#\H  2b 9?`^`$'H#\`H "`L%?`'`"`*'*$'H#\HӚ ?) $'H?`@fH` H@@tX'HH4@@  "$ *۰ $H&`A#d#`#\㿐 0@* 48@8:  @Z 2  &       & 'p& m $y $    "@ ( 2  H $> z 6@"@" H  8`2,   ` R $ @Ve  " ( ?2 >  $@U ,><! 0  $"@  ("  8$ ( ?$ 8 @U $ 2 p &  p& p  "  " t"& t$ '@` * $&㿘   P W 8  J (  "   ( `" @   2 P㿈> z  0@  * ' #` #\#d `?㿐h ` 2O `$2K `( 2G `P A "'`&  "& ` ""`< &"  p?#& p``&  2 p &  p& p"```"` 㿈0'   @'   '  & >Ŕؐ  m    Q; 2   &  ` &@` @ &   `c   '  `` `$`8 ` `   ࢚`8 :`` "$@` @' "- $ $ $ ` `$"@ $ $ $ $ (`$ (` "€  0@B   < 0` 8$ 8 @ <$ < @$ @ D$ H$ D P $ P> z ؀4@ L $ L  $ L쀥 `' T$ T% ` $   @Ƞ `  '`   @f``2%`      @Pa`?`  &  @     2 P  ``F`" '&   *'& ' )  & `$@S`  ' p?& p  "  "$  '` @߀  "   2 PF   `P= `` 2A   &>Ŕؐ l4   OҒ 2 &@   P       `P `7` `@Ֆ 㿐 2 0 & >Ŕؐ  k    O 2   &  0@* 48@8+ ` @M`$'`"! ` 2 `$ `( `P 2 `8 2  "`8 " ( :`0  O 㿐   & >Ŕؐ  k    O( 2   &  0@* 48@8Ô  ` @  '   2^ `@2Y `@ " ` *`8 G  `<&`<&`@&`<`<@" 8 ` H `H?&`H>  8`<  ` ` `$ `H 2` 2` `$`  @͘  2 `@" ` *`$ N 㿐4U 6 P  2 0 & >Ŕؐ  j    N~ 2   &  0@* 48@8   @ :    k$ D "  * $ 2 N  㿐 2 0 & >Ŕؐ  j    N, 2   &  0@* 48@8ǔ   @    4 6 $ T 2 NB   "  * $ 2 N2  㿐 2 0 2 0 & >Ŕؐ  j,    Mʒ 2   &  0@* 48@8e  2  2  M    @y  ~  $@:    v  r   " * H  H ǒ   * $ 2̰  2Ȱ M İ 2  8 2 "  <  ( 2     @ $S H < `$ H $!  @"  ` (  ?$ H    $8 H 2|  2x Ma t   "  * H  &  M    @  H 2  $U < " 4 LL 瀊`& k ?$ H " * H  H? $ H 2 H 2# M  瀊`& j L LLp 瀊`& jܐ  㿘 ` & >Ŕؐ  h    L 2   & `` , @"  `H ǒ`@2`H `& L  `  & 2  , 2 L   @  `< " ``H 2``$` " `@ 2`<> z   2  H@ @(   2 L   @"& `<`"``H  `8 2`H `2` `( 2 `H` `$ ۽ `H &`H`@2`<  &  L  , @ `H 2 `` `$[`<`@"`H"8 KK 瀊`& j  @  `< "``H?&`H`@ 2`< ,@" `< " ``H? &`H`@2`< L  瀊`& i K 㿐 Ka 0@* 48@8H 0Kj ` `8 `$  `@` "`KR `` *`8 ` @ `P Z`( W><! "T` `$&@ "L` `LU @> z ; "# 41>ƀ .> 4*> 4 )> z 0 %> z (@> !h €@> z 4 4 0 > z؅? $ݮ> zϐ > z Ц` `4&@`$$ `@ "``8 2`         " `` @ z@J㿐 @  @" ` @*  `< 2 `$@ ` 㿘> z ِ#@ 㿘 @)% Ȁ@ p`@Ni @M &`& @^ؐ $"`$ $ 㿘 $  @& $@^@i㿘 $@b 2S  2  $ >Ŕؐ  fĖ    Jb 2   $  `$ J  0 4} @^ 2 ( $ >Ŕؐ  f    J: 2   $  ( $ 0@$ 4 Js 0  a & $@^@㿐 ? 2&  2 p & >Ŕؐ  fa    I 2   &  p   0 4X   @MX> z#&㿘 2 $>Ŕؐ f-   I˒ 2 $ 4 0 Δ (,@`8`" ` >f! 2`D>`!H 84` 2``   B Qܒ P $ H  (`"  p` " p€  p ( & p$  ($ " "o`) P   (`"  8` " 8€  8$ H $ 8 p ( & p$  (`$ " "`P "`H  `H    ߚ `H  `P "-`ٶ(` "`@`8  `@ " `8> "`< ` `$`8 $`8 @  > b < $  `@2M`8t& t ID   8   , \  D       d d   㿘> # @k  2><> {@!h><! > `2  : @g 㿘>  `% J`5   "`  ` a 8 `` 8 `` X@"```2J`5  ><!$@0("@*` *4 $@``=#'`` ` >C!̓*` > {h @ 0> z !T>6l `Ę bk> z  X'aǘ _ \ ` _W T*$ X@ir d$ LN > z  \'a B X `  _: 7*$ \@iU d$ P1 > z  `'a % X \  _ *$ `@i8 d$ T >< ! > z"a -㿘 0@&Y >  "(> z0"2 J5`>C!*`  ><  6 !  :   6  620> z``& ,`` `l"  & `l` & ` `" & `& (& & & & $        N N㿀`` `@@ '^ ` 2+@   k Q` ('    2 $' $ @  @ `2' > z Ԑ@ * ' $#`#d#\ 2 $`   @ (& @ > z& ` `0?"`0`, ed`0㿐> z  @$ `` *  8   2 ! {`FÐ `b: `"b  \ `$@8`8 "`(`(  $ 2`( ?/( > z Р 40`P/  Lǒ$ `  /`O ` `0$ @ C  @  / > z Р Ԥ '@` *`$Fn`渔`` @`@` ` '#@2 ```` > z Դ @8͢@d  " `> z"`Ԕ '8>@  ΰ ` d $ @'@t*H 2`0  %`0U`  `(<` @D  @  @-  @`0`,?`%`0d:`0? < 2`` ```   `` ` `  Q` @   G` B`   :     @2`"> z` ` $  * b 2  ( ! #\;`  d$#h#l@ `&` `0`,?`%`0c`0㿐`@`` `  "`> z Ԓ 8 @ @ $ `@ "( 8`"  $ E  $ "@E"  `  `@㿐`@> z Ԓ@ 8 > &@  "K 8 @3@ >@/ @ *?  $ 2 $ >Ŕؐ  ad    E 2   $     E;  O E.     㿘`@  `> z Ԙ@ 8  "@  "  8 @@  $  㿘@`> z Ԙ@ `8  "@  "  8 @8  $@  㿘@`> z Ԓ@ `8 * #@  "$ 8 @>D#,*   $6@    $@ Ö    $@   㿘`@> z Ԓ@ 8  &@  "# 8@> z   4  H@ @ #Kh     $@ Q   㿘`@> z Ԓ@ 8  &@  " 8@ K>     $@ '   㿘@` K! 2   $Qd   #㿘 $ D  㿈\ ` Ӯ > z`  :  2ɰ 2Ű `2@@ *  &@@  l1@@@ ?,#8/??`@ ?`< `?@`' # @ N ` ?t   `? `?c  ``< k i 2/ / - ` l#`#d#\ I 2 J 2  % >Ŕؐ  _    C9 2   %   > z `` 6`H  Co  @@@ :  " @@? 0  CY   `@㿘> z ؤ!> z"$@`ђ `@ @  X*` H /f4* '  2  2  $2 H 0 0\($" > z 8 (H@("@> z (+  2 > z @" > z H (H@("@> z > z  0"0 0#" 0> z"4"  > z ( H "> z 㿘 (@$`"  "`> z""8 "@ (Ho * "`> z``?"` (@? @"> z> z&"<&"D &  "@"  (Ho  $`> z``>  "`€ ( > #ğ@ Ho  ?"`(+  2 > z @" > z H (H@("@> z 0-( (" > z 8 H "> z > z"4" 㿘 (H` "> b<@㿘`(H #> D€ 8> z><ؘ a0 02 8*` (> {x   :`  ?2 8 2 ?* > { x(㿘  > z"$- -@@ "  "$ > z"b4 " > z"b< " > z"bD " > z""L ,@51 >  X$ \$ X$ `"X" > z><!0`"">!   > {!x @  !0"@ > z`  `Б,@b`P,, @@@ 3><a0 V>  > {!x`@"@( `>ƒ$@{!>i!,`"> z@ؓ*` ` "(  .$ > {!x`" 8" <" @" D" H1> z `5@@ ` 8   `" @W Ш @ פPa0 >  P> z> @*@&T!> z><*@&4"l "P  8$"l     "(","`"\"T <$` "X"L㿘> z Ѐ  #  А ">!` "  ` Б* "㿐+> z`)><!8`,!> #>  P@6`T  P%!8`T8  @ $ P$`T> >  TP">Ɛ">"(, "P@Ր 2> >"X# `В 㿘#><a0? , "*  > z"\ %> {>"x  2e @  @-   @(> z ؔ *@&@    `#@ # a0 2?>f"|$a0 x@ ڸ a0` u   @ 2.  (> z ؐ* &@ ? #@ @ U a0 2?>5"K$a0x@ ڇ a0` D 䠄??a0? 8, "*   %> {x   &> z ؒ *& @   # a0 2?>~"$a0 x@ K a0`  䠄?І 㿘 =     㿘> z Ѐ >~Ɛ"؀ >Ɛ#~ ><>~#(0 >#H>Ƙ #  >#0^ > {x  2>< 0 `x  0><0 `?` >~#  > {x  0 `x 0- -><"@/> {0*`x@, "* ?x?ٽ 䀤$@$`$``$` .?$`$`0`$` %0@㿘><!0   > {!x   @ "   7> z,  &, 7> z$ \9> z X,   ;><,` @ 8 @  a ፖ  >" 0g   "" ` H /f * ' $?" `" X`>" \4`` "` %` `"@%``   @\$``` @`X*`  %`  @[`` `X, @`"@ @[` ```` `X *@ "``2`H 0>  X@aݔ㿘\+> zbP@2$> ("0> z ;`> .` Ȥ@ <b 88b  2@@ > z@:   @  ` D   > z["d   !> z ? Ж !> z ``,4`(`( > 0 > z"h@> /!@     ` +`4*>> z> z"$*@+`@ "@+ @ @> z0"$-@+`@ @+ @  @` Հ`>ǐ X}` "`" "@ `?"` (!``$?"`$ (! ` "``  "`@1bP , I & (& ,> & &  (&Ho  "`F` B  !> z"$@Z  `  X* H /f * ' &  & ""H 0 &   ` & ` " "  (Ho  "` ` "`` (Ho  ?"`` > "<@0@1 bP 㿘  K> z !> z @Z"$  `  X* H /f * '  ` "` "  "@H 0  `"  "` "`   "@ (Ho  ?"` `?"` ,&  & ,`G!> z ,&  & ,> > z ؠ"$@Z;  `  X* H /f * ' &  & ""H 0 &   ` & ` " "  (Ho  "` ` "`㿘 ( ` 4` (Ho  ?"`> z !> z @Y"$  `  X* H /f * '  ` "` "  "@H 0  `"  "` "`   "@ (Ho  ?"` ``?"` ,&  & , (`" (   (Ho * "` "&  (@"# (`"  "`> z""8 "@ (Ho * "`> z``?"` (@+ @ `2   > z ""@`"  "`> z""H "@ (Ho * "`> z``?"` 0 > z`& 0` ?"`   2" (Ho  >"`%> z@/rP&#> zb$*  & *  "@* "  (?Ho * "` (@Ho  "`> z```$ "`><!4b$" <@/DP㿘 @?,` 7?"6` (  Y  (  (    `$€ !`Ho  ?"`Z `Ho  ?"``@ő,`㿘%> zP@.'> z  $ @.$`0UԔ  Ԕ*> z"$@ @ 2> zb$`,@."`<0=` "`$` "@P@."> "<@ (Ho !"`@.P` $`" $` `$`$ P$`"$@."> ! %> z W$ WL WL WL WL WL WL WL WL WL WL WL WL WL WL WL WD WL WL WL WL WL W, WL WL WL WL WL WL WL WL WL WL WL WL W< W4㿐> !,>  ,> z ><a0  2 2: *`" * > {!x @   @#@   `2: 2??* > {"@x*`*  * @ 㿐!><> zb!`#\@ v > |"a> |> |"`!"݋@> > "``"d> z""""` ><, !<    ><㿀  '> z .@#> |#`a'#\#d ?? %> 0 > zbh> d > >ǐ ` ` "d'> |  "!>a"Uږ '> z > a!$  8@Р@㿐'> z > ````.@ > " dW 2'#> |a 2a $ >Ŕؐ  U    9B 2   $ a枘 > |a aWj"aa` 9u` .@ >  ,@<@  " 㿈`'X X` @$ 4 ?@?耢4 ?쀢(?)> z В@@VÐb :  2  @ ( & & @@Vb*`&   & ` Ц  < `B(r` j(@2.( c`2)( ` (> #ğ@ (Ho  ?"`(Ho  "`( 7(Ho  "`> !h €`2?&* &@ &D` 4 ``耢4```㿈'XX`` ;`#\`  &'@ &   `@ ޖ  2 N L `E@B 0> `9@6! `  `(@> z` "  @U`  `E  ``@ |`@ w`  '@&@ a㿘 w @n l 2@ (@!"@  "  > z @U    @`( "@Uؐ @(` $@"(Ho  ?"`> !h €@@ 1 `$€ ) (Ho  ?"` > "@@> "@@@(Ho  "``㿘>U & x& > z"  &  "@" Ut?܁㿘'> z @: * 2  2 *  8#:@ ` 0(  4`"  0 2     H,@,$@  H M `(Ho  "`2( @2> )` '> "@ > "@(Ho  "`(Ho  ?"`ƒ  > . 0  > . | "> .> .!,s $>Rl*         㿘 H /d * % > z>b$ 0  D@>wA >+": T @> z Rʒ"H 0㿘> z ` @W `: @ $`< `, @$`<$`<`< @W, $`@ $`@` @W $`H㿘> 0 > z""hH o@> z > z>ǐ"d"R )> z    $  @WZ@ $D`$D> ("0> . ;` @ @b 88b  2D@ D  @O ,@ > zT*> z㿘H /d * % #> zb b>ǔȐܒ"R1 b$b$H 0'> zЀ% 0@8  : "@# H /* d % x@ H 0`> z `, !> z@)Ԑ"P> zSҐ"d@)"P0S͐`0p> z @:@:@-5 *`2 2`* `#2`p*`# p'  ' Ĵ    !> z"P@)> (#> z> .`"0̐`"@ @)" `@`*`@   `' #> z`! >  $! aD@'耢 "(e!, $!, ` 4(?$4Ho  "`( 2 !0!$  $!$ !0 [$!0!( $!(( ``p "`p> !h €ڐ> z`a  @"a>%`@@ * @47 "0(hp  )耊""(` h l 2(" (  "(@ o " (@" (` @R  ( @@ (Ho  $`> !h €#> z`` A"` " `   `@ 9 % @Rj Ȑ`. ` @: '@  2 Ho  ?"`.  '@ % > z @R? Ɣ@  &''  "@@@> z5'' > z !4 $!4   ;`   #\  ` !8 `$!8 $ (@"ged'"W'( (RM(Ho  ?$`(  Ə%> !h €'Ϩ / `$€' ` '耤`> > "@ > "@> "@Ho  "` 耢   (@'耤D `B㿘%> za!> z $a@'ߐ"P> ("0> ."P`"@ @'$ `@6aa $aa  a`d > z"<`> z"D > za  > z`d > z"<> z  "@D "@lh@ > zp > z "" > zs"4 o `  2 (`2 ( 4 (?$ 4Ho  "` (`2P`=@" (   " (@ϒ   (" Ho  ?"` (@> z @P   q @  (Ho  ?"`> !h €> z`a< "a< 4 (`4 (㿘!> z  9> z6@'"P ( ,  g /><0 > { `!x-> z  6@ S6  O *  8 @F0$@* @*`  (@@"6`X (2    "* *`@ > z"$ @"` "@`?"` (!" ,`$?"`$ ,  $ ($ ,$ $ $$ "?&  `@Ơ P0 `> z @<@ > z@@ D > zP"d@&"P`@㿐#> z`Ѐ`ж "`.@@T!Ԓ`в@T\@   L̰  Ű  > z'@&UbP` ( , @  ><a0 > {[!x > z  6@ L6 H* ** @8?@Sڐύ5` > {!x3 " 6  $, * (@@`Ѐ 8@  @   P(@@쀤(> z><a0 `6; , * $[ (2    "* *`@ > z"$ @"` "@> z `?"` (!" ,`$?"`$ ,  & (& ,& & &`& `"'`?ϰ P > z @<@ > z@@ > zD > z> zO"d> z@%bP㿘%> z@%PI` "`&  "@ (?Ho * "` (@Ho  "`$ސ> zb$*  $ *  "@* " > z```$ "`><!4$`< 2@%UP㿐> " l> z> #Ж#> z"4` ""> '#,L ">>p > !#\ \ f > "`h>p!> |>ǐ!a@#\   l6 > |>ǐ!ȚaH#\   l, @㿘> l  "4 "$ $  $  $   "` " $ ll $ l "`"l$ .Ԓ \&  &$D &$H @2 $ "$D$ > z``d "`d> l) "! $@ 2$D`$D@ $H "dH$H@  $D"dD> zd d  2$@ 2 㿘>  l@  "$  "@ .{ \ 2㿀>  h #`#d#\   fӚ ">oې!P&$,&$(> l " $( &$D$,@ $D 2$( 2 H`+><aL/æ@  > z!4 &5>  l `,```#  $  :> z@Mؗ* 2`  $  $ `$$ ݦ$Dd` `2`&ϰ 6 ``2@> "` ٕ  @ ) >ǐ!`$Җ "@>oS!p    $Ʌ   D'''''K @ ~   ( 0 2 < "~ > ) z"bd` \ ,     d0O`В \  \ ,̐$ \ ,ǔ  $ $$@<` ?$<  6$$d \  ,$$$$$O ">nА!@, # < 2$6Q$$-E \-B \0 2     @q.ԐaL(-> d@` @``Ғ  <   4  > !* "@*` ``@ ?" ``ޒ `X+ 3`    ` 0 `X  8&dP&dL< * 1> z2&` А@ @L* <  ?   ><m aTd4 "aT>ǔ ow #\ ? \ d) ` &d0 dٖ  "`>n!!`8> .# X 0 2   @L   Й:``3`+ @+` 8;@ < `@Lr  &d0>m!Вd  >>m!n" $>ǐ"@nu`> z ? &``&d`h  "`h```@ 㿘`d( d,&`P 2 d(d, "d  d$@4  "d@` 2&` < 54d؇d@> d@"`  `@ > z  h d" " hVd@ >m"`} > d( d,eR hcd0, \㿘>^>##@ .㿘>^>##@ .  㿘 p2* @ > z @KǓ*   } 2d( 0 (& 4& 0H /d * % H 002$ @KC< d@* 2` < ">ǐ"m# H /d * % d@ެ<> pH 00@㿀H /d * % 9> |!iY H 0 % % % %% >`<4,  ,  `H &`@$L$@: '@K   䔒  耢? `?>l""$LH /d * % % < @K& `ʂ"4H /d * % 7> |h H 0`0 @=`  $ 0$ <$ 8$ 4$ H=`@ B < p`,>`!P!Pc!$ ,$ x$ $ |$ ` 2`<$ $ `""@$ `<`""@@8$ ` 2`<$ $ `""@$ `<`""@@8$  t$ $ @H /d4 * %  !   % }$XW˒@<H 0 >DIH /d   iA  * %   ?`%  `"!`0&`4(&`0!i(ՐH 0㿘  ! $$P&  &$|&$0@|`t "`t $$P6 $|2$  ?& 㿘   < @`@"@ " $`@ ?$  4 2$  | > |> |!hݒ  "`@`0($`0 $`4  2 2> |!hȒu 2   2 > |!hf$㿀'> z d $] >  l`"P``"G`   "?$D$ $ 48$D$0   #`#d #\ bN 2)$D$D`@ $H$`"dH$H@ $D"dD$$D`$$H` 2`$`"$D$`$ А $$ l "l$($`2 ` `2` ` & 㿘H d$"d$㿘?:$($0& bۖ  >ǐ"l$ > z"$$ ``l""`l㿘@?@& 㿘!> z t 'D"t p?"p D@     `p "`p㿘+> z`Т >`6@Hҩ62` *  @? 2  A " H /d * %   > 0> zbh  ` -> .f,H 0`   `> !P !&`0&`,&`>`p&`H&`H /d * % !> #А&`|H 0``.&`8&`<&``.&`H /d * % # t`" tH 0 > 0 > zbh`02`@ @@>U &`0&`x? , Ґ`02` `H /d4`|* %`|  { ,`| ",',g1H 0㿐> )"h>k#0Fӎ  \>j#0= '$  \'  $ $$@ [$  \ '$$ $$>$#0E ">>iƐ#@ 0`   Ԃ$@$(= \(: \0` b㿀> z   $`@  . `  &  ('`$87 ` * ` *  +' & ##`#\#d ?? >& j[#X `& 2  @"@`" 2 "@$  㿘 $@ > z >* "@@"@  2@  0@G>`2$@ ($p`$ ` ( `, p 8 " <>i'# 2 ( a8@2^  ( "   >< @"T  =#M $>@ 8 ` > z  ` *@ " *@ * 8  *` #* @#@ aH ''' #\#`#d#h#lÚ    D#`#\#d#h#l믚    D& 2 8㿘 >h# > z Ԕ@ 8 @ ! 㿘> |""> |>ǐ"(cȁ(   >ǐ#i  & >ǔ"E0  > < 2  > ! `*" * `@ "  " <  ` ` w&  "s> | & ( ("`,"& , "e&  `%&  > ! `*" * ` @>0  `h@  `  @  ( B@Fϐ  > 0 ` "  ><  "& F& & !X& &  & &    & & > `& > | & ( ("`,"& , "& ҉ Fw " 㿘 ? 6&  @  ?` & @    @ Ҿ0%`&     @     & ""   (`" , ,"`, , ("@  & F9ҙ㿘  ;  ?&  `H&     @b    & >Ȕ "D9   2     & >g " &  (`" , ,"`, , ("@&  E㿘> !h  €`&@뉐 `"    " >gY H  b"   (`" , ,"`, , ("@  "$ Eǐ$  `> z `@:* 2 ' 2 * #p '  '`'"'`  8 ;    ;`D    ; @E2d2`*  *` '2 @ ` `Y   S "/  N ܀` ( 4   $  (2  $( Ho  ?"`  %   (Ho  ?"`> z В @ :E "  '܀`` 4   $ր 4`2  $ ` > z В @ :E ŀ`" ( (` ` ( = ` :` 7' ` @> !h € ( > #ğ@  (Ho  ?"` (Ho  "` (2 ` ``E (    ``k` (@2 0 2> !h € `" (  (Ho  "`> !h €Ho  "`> !h € .7;`2`''#\̘` ````   ֑*` ,2 @2     .@  ,*2 @2   ``Д```w`6``( `(C`(Ho  ?"``(   W Ho  "```> "@` (@: 0 27> !h €<-`)```( #`(Ho  "`" >  > f& >f# '> !h €1``   f 4a ]  "   & >Ȕ "A    ! >Cc   >& 㿘> @4 > $@>dȐ!@@  B > z? 8  @  ; F;`  @    8   @ ; ;`F  ?㿘@ 㿈d`@A    3  @?#ƒ '( !" (`> z Ho  "`&@> z д :@ D Ҳ`'      @ 2> z/`- ( !(Ho  "`>@"@ɖ @Ho  "`&@ U '#\  \ '>!0@@ 9> z  @@ `( Bj (Ho  ?"`0"(Ho  ?"`> "@&@> z д :@ D o` p@6   &> !& H "@A    4 2  $ @?  2 2   &  %> z 'г.@ D 4  $   $ $&@ >? 0''''''   @'`s`<  `͔  `Ԕ   @ `> 0  `耦`&@` @ Ѐ   . "@ђ  ?  & `A `  㿘   "   `& ̀ !> &  0 ꛒ  `  㿘   4  2>  $( >   $ > 㿘%> |"͐#> |b" $b> |" #> | "  X2 (  2 (   3  $ bb $ 0 0"`$b ( 〦 > |" "    K 1   " (`" , ,"`, , ("@  =$  0 "㿘 ><!><a >&`&@&`!X cj/㿘`2>bN!p  .@     `.@ `.@㿘` >b3!"@  @      .    㿘 | ">   (`("`  ` `>c!.%`>b!Ȱ?آ>b!Ȣ?0Π >Ȁ >>b!0Ð!b. >+  J(8  J  J  (8 " J   & 4 & 4 * 8 * 8"  ` ?2  " @ ` ?  2  2J  J@ `2J   #+ 0 `**   "+ 2# + J@   J@J`  㿘  `"@ J@  "@ 2N@@Aܐ  @ *@`N &*@   (+  2 2 " 2+J " ?2J@ "J`  2J@  @(*`  *02 @@@ @  "`"     " * @ @ ` ``z @Z( 2 "" 2 @ 㿘`> aL! 㿘>+!l  ` `?@`> |`"">a2!0` `40@” &`0>Ȓb@ݐ&`D>! "&`D`D> |%> z"">Ȓb @P`0&`4@ 2 *@&`8 <- '' @#\#` ?  >><!@ >_"0 8 &`@>  8 #` @>`  -> z`    Т@-> z@A`@* @ `8@A* ?А$`0: ? 0$ І$`@ :`@>` 2?`  ?&`<&`8 H `0" `0*` ?  "6 `0 <"``0" H 0 `0>@"`82`4 `2`s3 a4  >Ga 2'a4 ''@b@@c >kp'HX @>ȁ> z > |2@> |*```< "0@( 0 0 > |`<> z؄"0@( 0 0 4@㿘>+!l   ` `?㿘  >Ȑ"& ">> _"> 4_">+!l  >_# 㿘`> _ې" P!>+!l ` 4>>_̐#`>oG"@!l ` >>_#P0_#`a4  >b 2'a4 ''`%>Ȑ@Œh $`@@ &`8 W  &`4>Ȑ#p^h@`@'>N %@x >Ȑ#_|^k@  @ >m'Gq N `4>Ȓc@/ 2@U >Ȑc 2> !` "`@ >m'G; @ >ȁ㿘` >>+!l >>Ȑ bR  >>_#P0_#`1> |"  >o$ Ȕ  &">]#>oFM"8@㿘` >>+!l >>Ȑ b"  >>^#P0^#`1> |"  >o$   &">]Ɛ#>oF"X@P>+!l ` $`>^#P0P0`4 @P &`0`@< @J &`45>Ȑ@ϒh $`0@?ǒ &`< a  &`8>ɐ ]h@`0> |>" 8^ `a4  >ebЀ 2'a4 ''>Ȑ"Ƞ#>m'a4 'F>Ȑ"'a4'Fw 㿘 < 2`4>]V H? ? -   ="@ <  8 2    * *  2  &`0P2` >+!l 2` ` @r> ><2} > <@@"t ` >+ al''`' $> "P. '䀢  ?@> z А@  ` '`'?'` '8`"' >Ȑ bȀ  8>b  2'8>b 2'8 ''@'   "'耢`">m@'>mEര 㿘i 㿘a 㿘Y 㿘> "d.  >+!l*` `8@ǐ@  >> |" 4 \f ` > |>]o x  `B < "*@ `" 0@  @ 0 2㿘> |"`?>\: 2. >\5 @ "@0 20"0> (!.`   8>o"x@02 8   2>o>\ "x" "@ w 㿘>+!l '> z`Ѐ"`?`  *0 ҃`6` @ 2 `?*@`> z ԰ ? # @| 㿘> z ?@>  ,@ 㿘> |"Ȁ P> ("8 )H/` />+!l > | ?8` **̑H 0 02> | "?8`**"> | "?8`**"̑H/` />+!l > | ?8` **̑H 0 > {!h>+b\(2 > |">* 㿘>+!l "  > >M!`?G!   >@!(  㿘#>+al !>> !0`  25> |>'! > |> |"д" 2/>ɐ ,  @ Ԗ '&5> |Ȁ #>ɐ ,?8 @ Ȗ al ?8 > |`  > |`*&> |>p"a\= > ("8 ">@ >\!8H> | > |( *(H> |̀ > |> |Ѐ" H  * *H 㿘>+!l  > ? > "    8@ 㿘 > ""В   @ Q0> |# > | *`* @ *#bԒ@ @ > !"#m #> $c5> |Ԓ *  Ԑ *`   #  Ԁ`* > ##>ɀ`!`>!x>ɔ![ 0 c` >ɐ`$c[u!㿘>+!l  V` > ? > #$;   v 8@ 㿘>[R!  0@ %> > "b"㿘>+!l 2> ? > #L "   L 8@ >!H`?㿘%>+l  > !Ȑ? 8>>@?aР>ɒ[!>ɐa耢  , @ !> #> !T`,  !T&`,  , @ (> aT>  ,  l > > |? c> >  "c" > ! *  *`  *  > |##"b㿘>+!l  > ? >!X   ˒ 8@  >!" >ɐ"x`?㿐!>+!l   ?* *   @  ?   @ 0? ?> |> |"b"" !l  ?0 @  ?   > |!> ""$# $#'$@ d@6>YJ"#> @: @d&#> #>ZK" 㿘H/` /  > `p    "`p > `p?"`p`?H 0 > z > |" > !T >   , > |>+lg> | `* `*  `*  `*  `*  `* 㿘> "Ѐ !!>+"`d>Y"8 d> "bВ d$"@:c"@!> |>+"b "Ԑ * "Ԑ *` "Ԑ i*`%>+"@@<1  >ɒYѐ"h d$ d@:@>+"b #> b̀ b$bb̐@<  b>ɐ"Y d$bb> ""@:%3 > : b̒`d  ̑:  "!>+!l  >+" > |"ܓ*` > |""+ "!l  >+" ?`*`  "* " b> |: !l#`"B!l : 㿐H/` /> "Ѐ  > |" ` '%! 0>+!l``> |"'`? 'H 0 㿐> "Ѐ !>+>X,"!l  > |"> |" ' !l> |"ܰ ""  "`0" ? '> "-? > |" !l  > |"* "@!l * ?"`  㿐> |"Y`?!   >X" ư!@ > "Ѐ @G>   ' `@,' '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '*@ *`@ / '2 '* * `@ g7 ' `,'^> "b> 耢  >"耤#@`蒢, "@ `>ɐ#8X>X#@㿐> "Ѐ  > b耢 f> |"Ԁ bb@utb耢 [> |"`Wb  g  ,g@9x , @: ,g@9n , @: ,g@9d , @9 ,g@9Z , @9 ,g@9P , @9 ,g@9F , @9ߒ ,g @88P* xP@:r ,g g `,g㿈@*/////7㿈+////P//@$/> |ԅH> |Ԅ (  *@`@ Ԅ (H > |ԅH> |Ԅ (  @`*@ Ԅ (H 㿘> "Ѐ Ԑ0=H > ""& & H 0 > t@ t  > 4> tct&c`"? & ?/! && > "`t `t"`㿘>+!l  =  e9 %"8@o .1> "    % `  " , `d"*n   @  @[㿘#> b` 4 + !> # "@ @N* :  .@>+"@7j 2b>ɐ H2 @N* :  ܴ` #  㿘#> c  !>  $#>ɔH!2^ $# 2!>  $c㿘> > #`"#"4( 㿘>+!l   >#`   㿘  0@3 > |"b>  >*V#h㿘> J#  > |" В`"@*㿘`W `? &`>ɒc@  &`X:   @2` &``  > 0>!>+!l  0 >#>ɐ#> "cȒ@U`>ɀ`#a`@@T> |# `` (@hat`@Ӡh`>ɔ dVT>ɒV#> |>>  # VG> |"J" ">>V #>V #a "`@/` &`0>!ءH/ /a@0H 0㾐'pdp:   &!t> | "c㿘>ɢc>ɠ!#Uϒ     >ɒ#>UÐ# $ > , U: >ʢ  <-> D (U: %>ʀ  !`&c>  @U:` >ʀ`&c l :` > >ʔ    s h> U p>ʢ  T> \ : U`>U{ ȁ㿘>    Tb  !""`l0= . 08"!>&"`T"`"` "`"` "!"!"!"!+"! "`l"!  "` "`"`"` !("`l"!  "` "`"`"` !("`!x"!x"`l"!  "` "`"`"` !("`㿘!> |# #  "" 6y # !?00 $}0+!@  d !& & & & !& Đ!0  "_^ @ !,! & & & & & b@ !$ @! & & & & & & & 㿘@>ʒa@ & & >ʒa  @& >ʐa0@  & 㿘`?!>ʐa@@@$`&!>ʒaP@ >ʒa`@ >ʒap$`@ $` `  * & + "@>S! * $`l$`>$`a$`@Δ !x &!x㿘!x  >+! @& > |>ʐ"T (㿘`!>ʒa@+& >ʒa@  2&  & !>& @!耢 y%>ʐ@ t> o!@ & 4>ʔ b@& ,`  ` * ` * `"& 0>ʐ" S'& 0>ʐ @ib8 4& 8 8& $@^ & L>ʔ bP@X& D`  ` * ` * `"& H>ʐ"hR& H>ʐ @:b& P LА P 0& < H 8  ,&  D@ 8  $& 1 >ʒb@ & >ʔ b@& `  ` * ` * `"& >ʐ!R& >ʐ @b &!>ʐ@m"Ѐ 0"@ & d>ʔ b@& \`  ` * ` * `"& `>ʐ"R& `>ʐ @Œc& h d[Y h& T >S#(㿘@ Ā Ġ㿘@@㿘 ւ>s!x  @ & &!x>SQ#P   &!x>s#Вc&!&!   & 㿘 >  #@2 >S1#h@, 㿘 &   Ң @|㿘 H:  @&!& & & &!l&!&!&!&!&!&!&!&!@Z&!&ƀƠ㿘 ?>ˣH` >˒`@?`4`` >˒`@??>+<` >+!l ? ` >˒`А@?`4`` >˒`@?'> <`# `!?`@?>> `@ܔ??>> `А@Ҕ?>˒`@̔?> ")>+@!l2``?2``?2`` ?2`` ?2`& & & & `` 2 `&  2 ` &  2!l`& !l 2`` &!l`` €`"! 2!!l !>ʐ!0@o & @!0@g & ! 2!` &!! 2!` &!! 2!` &!! 2!` &!! 2!` $&!! 2!` (&!! 2!` ,&!! 2!` 0&!! 2!` 4&!! 2!` 8&!! 2!` <&!! 2!` @&!!Ā 2!` D&!!Ԁ ` H&!ԁ㿘> !p`!p` 2``?2`` 2` `@ 2`>˒Qؐ㿘> c4 " "c4H/` /  > b@``@E"`` H 0> | "c㿘>+!l 2    ` >ː!E`?㿘>+!l  > |#Ȁ 2"`>PJ!``2 > | 0 @ > |"#>QJ"㿘 >"0>˒"8>>˖@Q9">>˒"Q2> |#Ȁ`>>@"Q(>P#㿘>Q!#>>˖@Q#(>>ː#xQ`>ˀO#㿐>!€` `>#P2`> c`> cd  >  ?> "h#c`"d㿘 + #`!>PҐ @> ch "ch>̐ Pǒ> h + > c` "h"c`Ђ$ Т@  㿐>!€ ''|㿘 4 > |#ԡ. @  `@$ ` " 㿘` Y "$ >+!l 2  > z>+!l  > z >̒`@?V`  `? В  v& 48@ 㿈`> |,#@ @P$@ 2 !0@ @"!0>O/ `>P9 0 >̐ P2  ```P`0>̐ ؀ '耤>̐ '2,>̐ ',,> |c@> '' ,&&&& p7> &㐒 &㐒  > @&#x&> #p  &.G.J.H.K @b >}7 2 @ H /k * , @G H 0\\`\> | > >  `"|"> cȐ @> ` @  `0 `0>N Ho o㐢 @  @  H 0>+!l > a@  `0 >>~ c$ T$ P$ X \㿘`" >Oh!( >Ob!0 㿘>     㴑,@  @ 2L |L آ@@  㴀`> |  >+!l "`  0 㿘> |c ( "cH /e!> * &!> #   #. @ #@` #H 0 㿘@d @`   * 2 :@/b 㿘`2  .`@/W 4 @/P: 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  *H*K*J *J*H*KH  㿘*3>+al "  al " ߐ  㿘*3>+al "Ґ *al ʐ 㿘>+ al "   㿘*>+!l  㿘 >+ al "   㿘 *>+!l  㿘 X !>  8   :  8 $ 8& X 㿘 X  > `8& X "`8  $ 㿘> |#>+!l @  g  2>+>N !@@'㿘H/` /#>+al  M  "#>+al  C H 0㿘H/` />+!l  +  >+. % H 0> |> ?w @( `(  " " 㿘> |#́㿘> |#ǒ`> |  " " 㿐#> `   Ho o   `    `H 0% H/` /1>+!l`> !  $ *` P!l`> !  $*H 0 " 㿐`/H/` />    0T@H 0>  3> ` `|`@+>̠€a ??`>M!0=x a@ " >`@ 2>̐!L0&>̒`€ > a@>ǒ`؀ Ox `J@ 2`J@ :J` ` z$?@%>̠€ >L̐!Ix @ " >@ %>>̐"L0ݒ@ې>ꇒb@ > " $ @ϐ>{`؀ ?Ox `J@ 2`J@ :?J` ` z$?`L`HJJ@ >L~"H    $ ?>̒Ls"x@   > |> "cР < >  -  >La"Ò ,`>LX"0,  > |# " > |"#̐@&`|`| @㿘` 5 % ` % `. 5. % % 㿘  Ր p Ò 0`` 㿘 0 0 雔  O U    |  x  s   n  j  f   a  ] Y U Q  M k h  C  ?  ; 㿘`0  8  L 8   @@  `€   `@ `1 8   @@  `€ "  `@ 㿘 0  N L " ? . L `@? \ * L * L * L㿘 ה  Ӕ  $ $ 8   D d " # #( # #ԝ㿘>+l    " l l  l 2>>""@ "    3 ?  㿘`>K # 㿘@#  22?@ 2-? " d@  2#?@ 2? @ 2?@ 2?  @ 2?@ʐ ? 㿈 2&`h80 @] &`h`&` &`&`&`&`|`|&`>̒ J#`> )""\>`T&`Ԕ @N >J#00`> +`ؔ`Ԗ?L>!&`0 `0 @&`4`h 7&`&`&`   7 *` " 2 7+ ` &``h&``&`&` X&`l >̐#XJm0g`  @ @X >J_#p>̐#J[4`8 7'>+!l >>""& *>  " #` 04    >  <@ >@  >'>`a+>aXa+'>  '>t2   ' @爒 㿘$ N   *@ *J &  ޒ & @ @  #4 6# Ѐ 2a-"@  2  @ 2      `?   *@  㿘>a+H`%>a+C " >> 0#  I?I#?&` l&`&`ȓ,`" @  @ @> !Ȓ`&`&`L:e`02&>6!  k&`㿘 D>  `:N ᴑ*@H  p C   <*@@+   p3`+ +` @&< @  0@* ^! &#:`  p:`@ C   $*@ @)* :  2 p@ ( p  $*@ @)*  t  :& @*  2& 4& < p̓2* @   * ߑ*  :@&7& @H /d * % 3+}D @!H 00 0(& 0H /d * % H 0㿘 $ |&!D&  &!""@ 㿘 ` $!  &!&!!"a! "@`$ " &!D&   &! "$  ؐ&`@& `$h&!,>+"*!*<@ $ 㿘 "   *@  *@ސ  *   *@㿘   |    * l "  쀊  * * *0L 0* l  쀊  * ; 㿘H /d * %   $ & H 0㿘 $H /d4 * % ?& |  @} H 0㿘a"  Ѐ  $  >̒cG  ?  *@ H 2 >̐ Gc?$ ?㿘a"?   *0,  ??㿘> a  :6L a*@  `p2`` ` *` *  > * `  Ȗ2 /  "  ̀ " & ?  $ $ $  @ٖ ` *@"     $  $     $ > 2   ( "쀢"" ("(" "ࠝ㿘>>"#@ 㿘>>"#@ ۖ 㿘@㿈 |   >̒"> G+  ">  >0 "  0G 0>  ( G@0>  > > >  #\#`#d#h@G 㿘H /d4 |* % |   > !8 F  & !, "&   & @HH 0㿘H o*@ e@3 H 0㿘  "   > F!p0> F!H /d * % @ H 0 㿘       & & &  |`2a,& m $a``a"a& a`"@$aD0@2H `G>#p*` & $`< `$` p( 3`+ +` @#8<`(ېa`쀊   & 4 ( l` * @ " ` 쀊 "`(Đ! ?$ ``$`  ` & >+"`a`:`` ?$` " `0@2`@9$`@@5?$` & & `h`0B72<`h>+"!'*`  ސ` ` ؐ  Ӑ &     ` `@`(  $``̬  `Ж@#E<  -  `@&A$@8> z  @&78$`<`` - $`@&&`ܪ%@H0@ & ` & /  `0*@& & 6& >+"*!';@ # M o, `@ ` g  a  [  U     I, `@ ` A `z ; u 6` `o 0 i * c $ ]  '!  `& >+"! 2`0 6d   `@ ( :$`>+" &  !& & ͒ >͐ђa0'!0< @`067" 0'!<@`00" 6,  `  ` $ ` @2 `  `4  ` ? ` & Ɛ&    &  ;&   ` `@%/* >>͐ b4?>D &  ?? &   ? ` & & ` :`І B`<``䀥`ؘ " $` $`؀  `  @!; c$@Ò |ѐ d>+" 2`@ & !& & &:`ڐR &!^>+" *  @& & & &!u  6 `o 05 &Ґ!  ` & >+"! @$% 0" >?  "$`@ |`쀊 "   >͐a  &!@ & 㿘 |!,&  `9    6   `0.`0+ 2  6  2 >͐!C 2    3& 1&     ? >͐!Cܒ  !& `    @$D* >>͒b? 4 >CĐ >͒b`0$`4($`0  & ?? 㿘> !6  @ "A@#"@@"` `p@`s@8  e e@ "H  r ">@ 0@8   h@"9`  `m@;`q@& 0| )"=@"^ !@P 0p e g@+j  ! @` !ǒ X @ S `G! "`*`` "E C ) `2 "?92  @?6 `# @ `* * `>@xb$R   @ 2 n  @ `̔ 4L 0 " $`㿘> ! 6  @̐   * 7 $,$D$0@```̔ ` @* &:  `:͒b0 >͒b@ ܐ !W &&6r6J-h? 2`  ?6   .  *6> b@{㿘>+!l   $ X   S 0    ? *@   *@ `p2```   *` ( > ( ȁ㿘`> B6"h >@]bxJ@ >B+"3> a @_ !<: a>B"!@>!<B" 㿘>+!l 2 2 ` 8 2   & 8  `?P`   "`>A"0g`>_^@b@"@&`0>A>͒b@ ?&`< 2 a4 < &`8 @&`4)& 8  >ߥbP 2'a4 ''#>͐@c @"ؒ &`8 r  &`4>͐#@c@㤐@c(@͐@৔  @ >'Ȑ) @ܐ >́㿘 8 23`0`4=#  ?*@2`&a@M&a<>+!l "`0>@_#0>*  `  &`4&`0@ &a<9&a@ `4@ >"@  `0"@ ``@ 0( &a<`4`@"&a@ `0 8    4@  @  `4  "  4  # ``@ 㿘>͔ bX@\ a<: 2` >A#X 㿐 /H /e4 H* & H   L # P`2  H@'H 00 >+"@"#貒 $  & L& H 0  P"H 0㿐H /e * &  0 /& L & HH 0  "@"  "@"  4㿘# @ #@" D!? # @  #@?     @R  ܐ&   a㿘 <  ` & D%. <`"   0  . < . <   <     . <>͐#@H 0& 8㿐 8 `    / 0  㿐.` & 4` `2``2` 0 // ` 8`? h` >b`8!> ,* "* ` 0bH& & &`4 > &``?&`\ w# ,` @ *  @>Ӑ ? `\  >Ӏ`    > "  `| "`  "`>  |" `\ >`  >   | "` >  |"   2>  Ȓ >? >݁`Ѐ >{` 2>>? >? i!> ">>>c&&&&l  * A&`0"&`p`p*&`l &`|&`t&`x&`d&`h P 2`\ & X`\ 7 @ Đ# ' ''БH /k * ,  1 . 1H 0&@ȑH /k * , @n H 00 @ H /k * ,  @Q H 0? 0 > 4* 0㿘 4 0H /k * ,  `. @ . `@ @ >+">6  \ 2  T 1 ` , 1, !]  T`@ 4H 0h?> 42 `  6 4*@ 2 0 ` 4`p $ $      H /e4`p* &`p  $`lP`"'@ "'H 0>Ӑ >  '' `  @' ` @ ' `  'БH /k * , 1 ,1, H 0$`@ \ 2 $` # %$`$`$`$`$`afMH /k * ,  @d x> $ p pb$ l$ t  `, @H 0H 0 `h>6#@*` € 2`p 㿘?2  > b4.  0 p >6 h#@*`  €W p ِ 㿘?2  > b4. >6 0@ h*` 㿘?2  > b4. >6 0@ h *` 㿘?2  > b4. >6`0c@ h`* @`4@ lZ d H /k * ,  ]@ "4```y@8`x@6@ `z@`{@7  `\@ " j@(+ `m@&`k@*$  0 0& $``@u 0 @r 0 @0@& H 0㿘 l? 2`  > 4* @ 4H /e4 p* & pA =V  H 4 P & p~ HP-  H , P Hh H o4$ *@ l$ $  p  & p, `1 2   ,`1,`!b   @   $ $ H 0`l?0> "4(H4`p(`p " " `p"`pH 㿘 l? 2`  > 4* @`( 4``$`@" `  `   \  @,@  " 풒 2 H /k * , @x 3 c 5 ? !   " #" ` 4`@`@ ` 4,3 `d,5  @"`@2`,4& & & @ @   $ $ $@@@>  $ d $ h   , , ,L    `, @> "b$ d$ h@a H 0@@  , @  4 `G `H*`F " `F `I*`F `F `? "߄ *`?㿘 4 J`` 5 * *5@     & & "@ 㿘 4 ?2  l@ " 58 m k@" 5 @@" 5@* } *5@     & & "@r  4 `5`   `D2 @ 2 㿘 l? 2` >  4* @4 K 4 H /k`* ,`    `*@P    ***L   `*@ H 0 㿘 4 K  58 %  @ % @ *5*% %엒 㿘  p | tv 쵐 p 좒 0,@,``@: x썐 $ p$ t  , . L   d `,   `,  1   . 1R. !㿘 @  & @ $ $    x @   $ $  1  . 1. !-  ,  , . L㿘 2`0; `\  `|`2 F D D ` ` d  F@. D E  `@ . E$`$` ,`. L㿐H /k4 P* , P& X T& P& TH 0  > >Ә!H`2>> Ȑ!H#\>Ӓa9r 㿘 l>6%> `h#@*` t "  4 |@   T X `& T` & X>+"*"@  8Г*``p  `,` * $ `@@  p  @ P X `& P` & X>+"*"@  8*`@@?2   ,` > "* $    .  @: x2 @6& lH /k * ,  t% & t t h@     `. `1  -`15-`!   `. ~H 0㿘`p `&`p &`p `H`Pd" >6`h#@ *` @㿘 4H /k4 E* , E D, EH 0  G >6`h#@*`  €  H  . >6`h#@ *` @0. 㿘  0H /e * &  .  .  . H 0㿘#㿘>aX   ` @  " 㿈> D` &`0>ap`P>aĐ`p`Ēh&h&h&h&`> ,`* "* ` 0b& & &`l > &`?&` w# ,   *   >Ӑ!h8ْ ` "!>   >>  | >"bȐ!"">  | " !> "l  {* "l&``*&` &`&`&`&`&` P 2` & X`  @ #0` @ H /k * ,  H 0@  1`. 1 ! H /k * , @ H 0>+H /k * , @Ԓ H 00O!l &`@> }!H>@xax  >"a 2`@ &`@`@`D`  '>89!`D> " >`881!`8 >`D8*!`D> "`a '>Ґ#*` 2"> a>'!8'􀤠> "@].>x  &`h㿘 l$ > ! c) >Ӑ"7 0H o+*@l@B 4 3 ` 5 @ ``, 3, 5 , 4(р   & & $ @뵐(& & (В  .(.(, L(А   (А `.(@J@ؒ H 0(Ӏ .(@@H/` / ?& D& 4@_ ##`   @ < `7#Ӑ#`   @ < `"! 8 2& D@* ##`   @ D?`?>7B"H 0㿘H/` / l@ "@` *@~H 0㿘H /k4 * , ( ? & (@ *@((Ȑ  &((&(̔*(̑H 0 @ 㿘 lH /e * & (Ӏ 3 /H /k * ,  .( 1 2   , 1, !?  u @  (Ȑ  & & (& H 0H 0 l `G `H*`F (ր" `F `I*`F `F `? "߄ *`?㿘 l J`` 5 * *5@  (р   & & "@Y 㿘 l K(Ѐ  58 %  @ % @ *5*% %Ԓ 㿘    糒  p ߒ 0,@,``@: ʐ $ $ (Ѐ  ,(. L (Ѐ    (А`,(  (А`,( 1   . 1. !㿘 @  & @ $ $    @  (Ȑ  $ $ ($  1  . 1. !e  (р ,(ѐ ,(. L㿘 kt `2 F D F@ . D E  `@ . E$`$` ,h. L㿐H /k4 * , &  & & H 0  >"X>Ә"``2>>"X"`#\>Ӓb(4 㿐> "l   l"@ @    `& ` & >+"*"@  p*``1@  p  @   `& ` & >+"*"@  p*`@@  h@[G: 2 @6& H /k * ,  %@ &   @ (Ѐ  (А `.( 1  - 1- !(Ѐ (А `.(H 0 lH( `E `D*`EH  `H  *(0*(Ӂ㿘 H /e * & (Հ .(H(Ԁ .(ǐ(Ҁ .(H 0`> | H l"H  "@"  "@"㿀 ?>3z"h  ` @&`$ &` Q'`$ 8 " 028`4  8?@4@1?2- `4 ' `4` > `@ ''>Ԗ,''L " `$ "0`$0"`4&`$`$"4"D`( &`(  '㿘" >3" / $ + 82 0` D2 0`` 0>2" " 0>Ӑ" 2  ـ㿘" >2א# ( $ $ 0  8@2  D2 " 4 4$ 4 4 0"@  㿘`"  > : *` @ #(2 3 >3#P 㿘`  "@ @`㿘 $ & 0 & , L@  " 0 2 L 㿘 $   L@  0 2 L㿘 $ & 0  & , L@  0 2 L㿘 $   L@  0 2 L㿘 P`  2  8 `4 $  T$6@6 02>ӑ*`X * @`a >@2# $`8  8 P 8  $ 8 T @ P 8  8 $㿘 T R`   \ @ ` @ @!`2 P* 82 $  8. P X?" : ! `2d \@2 P* 82 $  8 T @" P \2` "@  P  8 8 $ P 8 $  8`  P  4 8 $ 2. # !$ P&  T`>+">Ӑ`& T: T @?`2?` h& T>c>+"2`@ :`?㿘 ( "H /f * '  T  ? P& T`4 $ 8 L@  PH 0㿘 P` \ /` 2, `4  8 $ P`4  $ 8 2  d 2 ` & d ` d  & ` L& ` @ ?? ?㿘 T #!| P  8 $  8U! cQ#  c   P 4 8 $ @ H   T d P 8  8 $㿘 T  ?& T[ h㿘 L`@㿘 P `0@ ` `,@`!@!`<@ $`0 & `,& H /f * ' MH 0㿘 P,   0@    و0 `k ,`k `x2<`x`|<`x 㿘 T   P H*``" q  X( H*``# g  X'  H* `#  Z  X) H*``& O  X#  H* `&  B  X%  H*``( 7  \<@F@   T H *`& d& T`+ %  \ T H + *`@& d& T   \  T @& T& da$ H *``0  \  T @& d& T!$ H0*`@    X  H*``   㿘 Hظ P`  -㿘 T L h ` (: @2 ` `82`  `2 㿘 T!/  P 4 8 $ P`4  8 $ T` $, *  $ 1$ ( ,, 2,` 1  (1" 1"  (""4# # & 0&  0 ! A !㿘 P  $`,$`0 P  4 8 $` P`4  $ 8 " P`, $`, P  4 8 $"`0$`,s `0 $`0h 2 P`0d   4 8 $ P`4  $ 8  T @  \@  P 4 8 $ P`4  8 $  "`0& !`0 `0 `0 `0  @`0 `0 @$`0`0 $`0`0 `  a$`0$`0㿘>Ԑ`   㿘>Ԑ` > H/  (>&`H&`L&`8&`P &`T&`d@`P  4`8`$? b &`X 㿘 ( `S "`"6`0C<0>` H2  9 0= H2    P 4  8 $ P$`8  8 $0*` \    P 4 8 $ P%b`8  $ 80 H2   ? 0 P V[ 㿘 P  $`,$`0 P  4 8 $` P`4  $ 8 " P`, $`, P  4 8 $"`0$`,Z `0 $`0O 2 P`0K   4 8 $ 1  P 4 8 $ P`4  8 $ "`0 !`0  `0   @`0 "`0`0 @$`0  P  4 8 $ @`0  $`0`0 $`0㿘 P  4 8 $ P`4  8 $?b  P: 8 8  $ ~d ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~t ~ ~ ~ ~㿘>Ԑ`l   㿘>Ԑ`l > .R  (>&`H``&`8&`P&`L&`T`@`P  4`8`$? b &`XƐ㿘 ( `G "`"*`07002` H2  - 01 H2    P 4  8 $ P$`8  8 $0` \ 0 H2   ? 0  ! 㿘 P  $`,$`0 P  4 8 $` P`4  $ 8 " P`, $`, P  4 8 $"`0$`,B `0 $`07 2 P`03   4 8 $ P`4  8 $ ?`*`>" `0 `0  `0  `0 `0 @$`0`0 $`0㿘k P  8  8 $㿘>Ԑ`Ā   㿘>Ԑ` > -V  (>&`H&`8&`L&`P`&`T@`P  4`8`$? b &`Xɐ㿘`" 0)#0$  H2  0"  H2  ` \ Ӑ0 H2  ʐ?0 -049 , 4 t P 4   8 D l , l h h 4 l < 㿐> c    "c > }>Ԑ a#\   'j >   㿘H /d * % ">  4 !F 2   ``@?> } ' ` @ G  ?4 & H 0 ?c 4 H 0  @>,!H 0㿘` > }(    ` 6 ?# @6  ې0 `  $ `@ (@'@  @  "  %h/#\#`#d  @  >  * *` *Ð   ő* Ɠ*` Ǖ*  ' 2a`2^`Ȑ@  ؐ@     ///#\#d///#`  @̚   ? ب ٕ.ڑ+`ۡ(ܖ ݒ  ޱ5`-    5- @  -`4,-,ߴ       * *` *  '`F 㿀@ a  ##\#d/#`  @v 㿀@ M  /@ H :` M ` I `  E  `$A  c $/#\#d/#`  $@J 㿀@ !   6////@ / #( #\#d#` @+ 㿀 @2 @  c /#\/#d#`   @ 㿀@   /`//!0 ##\#d#`   @ 㿀@ ˒@ ǒ  // / \h#\#d/#` @՚ x@ @  ?# Z//逧 / 7 /\h#\#d/#` @      ( (     㿐\&` dh'`  ?@`2$@ 2$ " 8  " #\     j&$ " #\  "Z*   R  $& *  B 2A  8   '`    *` *   $@`)   * *    '`    *` *   $@` * *   *   ?@ 㿀@ Ӓ  / //#\#d.#` @ x,  @   U4 ///#\#d/..#` @š x@  @ 666 (/////#\#d/#` @ 㿘   @ĐV 0?  :08@א2 0,@@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @$ `@  Z㿘 & , ? $& & (. X `,@@`"= ``>0:$`5>05 ` "4?H /d * % 8    >ԑH 0 ` "? 0 ?@Y?" & , #(+!@㿘dl  `Y$` \$`$``$` $`$$`$`0$`  ,   `  *` *  $ ? H /d #* % #  0 H 0㿘 ,`**`>  * @Y?" $  @     ??&  & , ?& ?  ?  @  ,>(!p 㿘    .`  "   "@*`" * * ? > +>Ԑ !&  ?㿘 `$`4@? ?     > * ($@"$( @    *  d  @}@y#`d_dqdn0W  *  @@` V]@Z @W`?# @4`O U@K V@G @ C VC!G  *  c > 3   *  @4`@``?# @4` `  1  ?    *  b   V  @㿘 4 (` $`>Ԓ!> ! '㿘 4 4  ` `q>> p  > @ @'  (  |  > **` @ @ ' 0p@q>'   >'   > 'z  ,  @>'r  ,  ">> 'i>'f!    * *`  *  "  ">>!P!X>'N!(  ,   * *`  *  >'<!` @@ >!x'1 `>'+! @ @ >!' 㿘#> `@  ` *     ``1>  "Q 1> > #$*  `1>  ` M p@>> >_ >Z >U >Ԡ"   "̔ @ 2   @F`` ">( & E1> A "@1> `;>! *`  @>!>!*>3 `&̒ # !` >"@ & 1> *>`2& 1> ĕ  1> *>`2& 1>    ( h H㿘  #!0H /d * % > }`` &" "`& H 0 㿘H /d * % `"  "` "@H 0 㣒 H4> }(> }  @2H㿘 0`@ >&#00Dڐ 2!(5 >%#P09 , [ X, Z ,`(*`>"  ( $" $ $%, [ , Y X 4 (  , Y X 4 (   >%А#p        ,>%Đ# , [~㿈  >%#W ` < @ a(>%#J  2 D ( `Ԑ>% : `2(`` ` #d#\#` ` HG H /d * % (   0">H 00 0& 4(& 0H /d * % ~H 0㿈! !&( , !0!"> ,  *  &&  & & & "0     `@xv !"K !_ 0j0!f Ȑ: `&( #&  &&&   &>&  &&> , ` !Ĕc &L&4&8&P&D< `q0(?# @4  4   4   @4    4 'В"#\#d#`    [     , 8 h h h D P h h h h h h h h h h h h h h h h \㿘`>$h @  㿘>+" > "#&4`.&`0 2`0 6`0`6`8 ` 2`0 *``0>` P$C`8a`8 .  &`4>#' p`0 `8.  `4, "@ `4 2`8>#   >a! > $`@㿘M㿘%' " 8* @6" 4  4 " 8 0  .` " 0`  0` @ 4 W 8`@  4O  㿘` @2  "@@"@ `㿘0a@a@", ?2 ?2@$ " @)@2  @ @ 㿘 0 ` @ `  㿘 0@k 2 4d .`2\  * M  :>`8  @ E(   >> # !c N( ൒ /   * *`  *   2 @,`  2` " ` 4"@@ 4"`@,`    @@ 2` 㿘 0`@6 @&    @㿘 0 ` @ `  㿘 0 ` `@6( `@.` 4 2 `   4,   @ 2  ` & 4 㿘 0``@64 `@&.  `6*  4.` . `      ( "`, `@  4 "` @ " " """  " " """C @  \  "*  2  *    *  \_ \* @ 00* @ 800* @ 0**  @`*`>!#@      ` `@2  `  >> > >> "> #H> #X #>"c`5В ``.>"*` >(#>%#>"#>#>#> > > > >  >  0> H>  `> А* % p   > !| "" >!t  `> `8 @>!k `> > > !^ H 4.`.        2 0 {  0> #d$ $4 4 `, `  8@ "ަ ݐ  4 > # j+> c x 2 0  @ `@" 0```` 0 0  " 0@0> 4`"*> (2&> t?">`t  2>`x x2>`| | 2 > 4@ :@e`8 "w >` ! @~ `> 8 ` ( ` ? # @4 ` ? # @4 `  ? # @4 !4  " `  4 `   4 >'!p'   >  , 02 4 (.` 4@  .`   c 4  ʒ4  4.`@> "c >  0 , `@̒ 㿘 2 '5 @ 2-`2)@`` ٔ 2` @ `  Δ 2`@@` Ô  @@'ϲ@p :>`8  @ % > #А $    " ` @  `Ԁ @㿈#> c ` \    ܐcP J $$ = z ` $ 3 `0  `    ޢ Z  $|   |2| $t$t|y$x    H ܼ ڰ <   ی H  ޤ  ( < P㿐>a  㿘> &` #$ $`$ ( 4 > #Ȣ`&``06&`L ">> `8  @ 2>`Ȑ &`>;!p>axג`> p &a>!x+ 㿘@ H '> !* 〠 6'> ' > ! >!$@【` 〠 '> '$ 6! > !#>!$@$`͖ $ 0! Q 0 㿘? 2  @ 2` `?>  7# 2   0_ z  ` >I`  4`!!    j! "K .  C! 2B ` 4`!!@ ?`# @4`/  @  `6" ,@ " "      *@$  *@$    $ ` 4`   !`?# @4`ѐ㿘?2  @> #2`   0@ ΐ 07"      **@$  **@$    $  ̒ !` #?c 2 `!   ɔ  ̒b 2!x 㿘 D? @2  `@> #U2` 2`̐ 7& 4  2` 0& 4 <(@  '& 4 '`Ȑ @   $  !x 0 8 >!   2c 㿘H o*@ eQ H 0㿘  0`  (`0`< `@ 0 " 㿘 D? @2  `@> #'2`  Ȁ "    ( <*`" 4& < `,`@0㿘>> ̘! <㿘>> ̘! 0 X? 2` > #2`    ` _! @"R$c@"L !@"F Fc@Cc @ p@": c@6c@ 30/ #  `q@") !@"# # # @`m @0 @" !@ 0!@2@2   @"3Qc@!)c@ c @!@S f c @c@ ] c@"; c@9c@ O c@"`c@"` /c@c@ < c@"`  `p@`s@q ,  #@2 #@ "# e e@ "m` r @  @a #@  @ "# @l   `m@\`q@Ґ   e`g@`f@L  h@"@` #@t •  !@ ۀ 0#@"q 0#@0#@ ʀ 0 @2@   !@Ŗ `v !`u!0 &`*`` &`0  ϐ `Ȕ$``  `Ȱ $` Ɛ0@ @a@ #\@|@ v@(q? ,@@ cˑ*   8trW   @͚ M` $ ?# @ `*`2 @7u 0:#$ ׇ #; - `@  2)`  " "*  @<*@ #@` $"?  ?# @ `*`2 @2?` $ ?# @ `*`2 @4?8s > ް   +#$   @O @ ,` $   ?# @ `*`2 @2` $ ?# @ `*`2 @4   8 &ׯ 0 @@N @w     @     @ }    @ t    @ l    @ݚ c@ _@ Z  U`̒  O`̒  IV  "A !=2 q 8`̒ k 2 `c@ * 0'2?#ϒ @!2@k@k@@l    `̒T㿘@6!  G#$`В d &(&8&0&,`ؔ @ d`&4``">aȐ  >aؐ  6>a `ؒ 6p&<!, !W &&6r&6J&6H36@Z  "   "   @  `֯ `?2  @?`6 # @ `* * >`̔@)㿀'  Ԕ  2`5  #`#h#\#d  >  "  * * * *   `̖"  ה `̖"  W 㿀'  Ք  2 #  #` #d#\#h   " `  ` .@ ` .` ` .` `.`*  x'  e  2`_  #`#\#d#h N К 쀢 "  I  /  / / `̖/#`#h#\#d  쀢 "  *@ * ` * ` * ` *耢  `̖"  > `̖"  վ x @ Ô@ /#\//#`#d    㿀` "'C   ݔ  2`:  #`#h#\#d  G  "  # ` *` ` *`    `̖"  ۔ `̖"  [ x @ Ô@6`6`6` E6////#\///#`#d    㿐A @>   r#$@  0  4 @ &.  `  `  J  ? `  ;  .` #\ `@ x\ @   G/#\//////#`#d   + x @ ̒ K'/#\/#`#d    㿈'В"#d#\#` ̒     x@ޒ  B`/ / 7` @( //#\#d///#`  x@ @ C`/ / c7 )/#\#d///#` š 㿘   ך 2`` "   +   Ś 㿘 b ̠(> &  ( r  Ѐ> ؀" &  ؀   ܀ c b> ؁ ?? `@R В @N@` 9>"ȓ*`  a0  (//#\#d/#`  U    װ 2 .`` ̓*``0  (///#\#d#`  8   `I ` ̓*``0  (///#\#d#`     `-``* ̛2`!0 2`2` ////#\(///#d#`    İ Ԓ`2 2  2  .` .` .`Ք pװ 0` ̓*``0  (///#\#d#`  Қ   װ .`` *    ///ђ/`p  a0#\#d#`  쯚  z $ ` *    ///ђ/`p  a0#\#d#`  쏚   .@W  .@S ` ̓*``?0 //#\#`#d :  a0  (//#\#d/#`  b  - ԰ Փ2 ֒ ` 2 .`.@.`.`.` `a0   ///#\#d//Ԗ#`  :      @   T@@`a0 ̔  T(///#\#d//#`  T  M` @ ?+`*`@  + ** *  3((*`  ` @ 322  4@5`  `  .........& &&.  p@  @` ̒a0@  (///#\#d//#`  뤚   .`.`x( ш  '  @k` ̓*`0@ ( (////#\/#d#` (u  ``o]( 㾸@B ( @> @a0  (///#\#d/#`  L  ()* &``o-,  x( '  ,  @  a0@  ((//#\#d//#`    @ `*&``n` ѳ 㿘@` >"*` ƒ0T  㿘  `  `諔!㿘  4    4 ` ? `2?  @"  *  $2 ? `& . ?㿘H /d * %    & $0"4("0l  $2$H 0㿐>a  e㿘> &`0` >"$2"0"(@ 㿈?> 2 `  6> . @ 2 06 ` 2  2` 0 Ɣ! 2$ 0 * H $@ > #@` 2 0@   *@  8 $ 4? c 2 ? 0 > * ?0` 2`㿘? 2`>  * @#F #D #H  \  cC2#F">4#D"*8F0 #E"'H?0 #AcH130 #B",0@/ +@} '@ #4" "?@$8   48" "H"L"P" T "@/ 툒x@ 4M `4I +  H`?@4A * ` ?@ X8  :  81   `` ` @C@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   C x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ ``   ``@ @ݤ  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d   Қ x@ * 0  H `?@ '  :` @  4, `4  +24 ////쀋 / / 0ab#\#`#d   蛚  J@ @ "**4 *J@ @ "*** `" `#(2 "㿘` .ݒ` @*ؒ`0㿘*  H   Z   M$ 8@ $@O A *  nP    2@@5 '  *   , *     @? Pj̐ι δ x@ݒ  6`67 7 ///////`/ / 0ab(#\#d#`  㿀  ˔  2 0r  #`#\#d#h  6  "  ?  *  $ 8*  $ H*  $ <  *  $ L   * $ @  * $ P* $ D( 0$ T#`#d#\#h`  . 0 X@Y  \@U     . .@ ``$  0 2 㿐> `& d  ? `& d㿘  4   4  `  2?  @"  *  $2 ? `& 筒 ?㿐>b<  㿈> #> !>  X&`$ $$ (``T&`L`0`(&` " " ? !4 ? 2   4  ")>> `8  @ `Ȑ &`">aa` (2  Δ   䫔`̒ H  `@  䘒 `>">0 @ @ >#\;`"ВԔ0ѐ#ϐ">6>!   &a>#(㿘`` Ȓ`@@& ȁ 㿘@ '> !* 〠 6'> ' > ! >"@【`{r 〠 '> '$ 6! > !#>"@$`{Y $ 0!`>6㍐!  0 㿘? 2  @ 2` `?> Ð @ 2   @" ؐ  0 { "  ` <G[  (2 `!! `  4` ϔ! l! "? % `, 4`@ Ѐ 2  `?# @4`+ @Җ  `6 ,@ " "      *@$  *@$    $      ~!`?# @4`nU㿘?2  @>  @2`)  2 Q  @ 0>J K 50A"      **@$  **@$    %$  Ȁ @[  `   .!` #?c 2 `!   <  ̒b 2! 㿘 D? @2  `@>  @ȓ2`  `Ȁ @"`;& 4  2  <  2& 4 /& 4 "0 <`@`(   #& 4`@  $ #X ֒` 㿘H o*@ e H 0㿘  0`  (`0`< `@ 0" 㿘 D? @2  `@>  @2`  Ȁ "    ( <*`" 4& < `,`@ 㿘>>#" 㿘>>#"   㿘? 2` >  @2`Ǧ    `Ȁ@"`ې  )  !@" p@ !   q@ " m@  0!@2  Ȱ ư `m@"P t@"` `p@`s@$0e`e@6`r@-0 !@"V `q@r  h@)0 e`g@`f@ 0'  ȯ!@ `f!] 0~@ 0x`f(!0s` &`*`` k&2`0` d`Ȕ$``0 2` e g@2`? 2  @?`4# @ `* * >`@c`Ȑ ;$`0:27 2$`Ȑ /$` `1@ ' ""  !28 @"`  %p@!@ ̐`@  ̐`@`H  ̐``X  ̒Д $ Θ >aߔ 0acxT  X@!`&(`&0`&,`h&4 &8 d&8 6` 8  2 >>ch `̒cb `̠`@@ `̤Ȕ @|`H>  4 @֐e` 6p&<` !W &&6H6r&6J&&XÐ? 2`  ?6  +  *6> c@֖㿘 Ȁ @ J!x@c  @_ 6`6`6`  //////#\#d/#`  i 㿘  4 (  4  `? 8'?   2"?  8 ? *  $$ ?’   /  "?㿘? @2  `@>  @6` 2 Ȱ?<? @6?`  *@2  ̐ ؖ '?   .`  ࠀ "??( 2 @  B @纔    V ??㿈->  ? 2`>    @2  % 7  @*@`1` (@븒 f @4, @ , @= ,   @C    >D4G 2 @@ > > 8!@o  *2 6//2 2 /////@_ ` @$`` #  $`$`$` $`$`fx$`($` $`,fq$`0$`$``,@@  %  _(*``  @*h ̒'>` ̶   ('  7` 4̀ ` ǀ    Đ 8   2I  #d#\#` #h  ~ 쀢 ? ``@# ` 2` `*   `0( *` 4,( @ `,   >` x  *`@q' ""'  #\#`#d #h  3 耢"# ? 2 ̔  *  *`@ @ *   7ސe Ae`@  9'  #\#`#d #h  䀣 ) ? $  *` @ * 7  '    *  '``@ eweu >` ``@$ 2&`  ""&` ` @"`d"`b h@"` @@@"`7 ` ``e=@?c ! &@&` `&@ &@ &` ?&`ސ`".&` 2 &``e@`@w &``  ` &`&@&`x ` !@ْ aba 5/#\#d#`      Ȑ ?& ȁ㿘H /d * %    & $0"4("0`А  $2$H 0 8 8 8                8 & &0 &, &d &` & & ( & 'D & ' '$ '4 '\ ' 3 3 3\ 3 6| 6| 6| 6| 3 6| 6| 6| 6| 3㿐>`$  p㿘> &`D $ ($ $@~> 8>Ȓc8a K?`&`&`l&`&`&`h ?# @4 㿘`` 0`@@J& 0 㿘@E ? @ `%> !2  $6  > ! >Ɛ @sK  sF  sA  s<  `%> '$ # > !#>Ɛ @$s$  s  s  s $ `0 㿐> c $ߘ  & P& p@& 4㿘 P t@’  .   p  $`  .  ,`  . 㿘? 2  @>  |[2` 2`03  @. `D  )  4  (! ` @є  2  `0(`@Y ` ?# @4  `0 $`0D㿘?2  >  |6  7 0 @1 !  D @  `"` ``" ` @ `  2 ` @ ` @{ `?# @4`!  㿘?2  > 6 Ր |  _  0 @(W U D p t  $ 4@ J ښ  4 "`@Ő @`"@y 5@ 0 " g |, < 0 ?  $ 0 x  $ 8`$ 0@D @ > @ 0  ں!@ 0($ 0` 4`㿐 0? D& lh& h @ @ @a @ ڙ!@` @' @ 0? 7& 0 c 4  D"  H 0 `" 0"" < L2 < 0" 82>ń܇( 0 `" 0"" 8"" 8`" 0 4  `2 0 ` 0" 0 `" 8 0" 8" 0 < 4  0& 0 0 0" 0 㿘 D? @2  `@>  |2` _ 0`@D < @`"  H@ 8 > 8 `i   &> L`  > L Z   & 4H /d * % & $ `( $& (`("@'"`(H 0p0 0(& 0﷐ <& @H /d * % ]H 0㿀 0 @ D``?# @4`ₐ0  $ ($(&  (" 0h"`` ``?# @4`6`"# 0 0@  @> " 0 0 ( <$ 0$ @$ 4]s` 0$ 4 < 7$ 0$ @ 0   0  <($ 0$ @$ 4 0 ]& 0X`@`  0@   0 > /& 0)/( 0   / 8@ <2  <2 2 /// l 0  * *`  & l#  #\#d#` H < C  #>  !  `$$!  0g ` 2O`㿘H o*@ e9 H 0㿘?2  @> 2` | " `0 @ >`D`,`"   㿘?2  @> 2` | " `0 @ >`D`,`" ì   㿐? @2  `@>  |c2`    0@ ! 8@ < a@a@* D0 !@"/V D@; ΐ@~  6 8& <& x& |& 0 ( 6 0(" > 6 >6 @6 h& l& 4 >4 @`v>Ő!(*` @   @ &@ /   @ #  @ { v 0u @ o @ j @ b  @ \*3$ 0/$ 0@ N`2 H `@  L @ @  L@<$ 0 0$ 8 $ 0`( , <0  D'@ʒ > @( , <$ 8 0 $ 0 0 ?$ 0V  " 0  8 $ x < , |, 퍐㿀2 @⧒  0 `/ 8 `/@f: 22///66/// Dc #\#d#` ٝ x`D  % @l a0h /#\#d#`     * *` *  $`L$`Hp`D ' W  ` /  #\#`#d#h ׿ఒ  0 "   `0 ?$`0 <`X$``$`d 4xD '        24Ȓ   "   y @ 0 <`/82 2 ///`  #`#d#h#\  [ T耢` 2    $` \^ *  *    "`\P쀢 200  ,@ ,` ,` \>`D!0׻  2@,@,` ,` ,` ,`\%`D!0׼ D A 㿀@j  `/ 6/b /c  D #\#d#`  u 㿀"! 0 6`0@ 0"0<`2 =7`     2f  0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0?  ?& 0`7  @ D66`6` ///#\#d//#`    2??& l l? & l? & l h?& h& l& l& h 㿀`4 `  0!"! ?& 0 0 =ϐ =& 0 @ඐ D6`6` ///#\#d/#`   Ś ?& l& h h?& h& l 㿘 0 %$"  %  & &` 2  ' x?& l` & h ֖ 2" 4  `2 @  @U D6 /#\/#d#`   h x  ! 0 =& 0@4  /`/!06"#\ D#d#`   B  & l& h㿘 4 4  `   (` 0 Ҫ ` >Ő!h-`   @" ` Ű ` *  $2? `& ב  @  ` ` * *`  *    $ 0 "T $ 8]& ( ` @  0 $ 0 ($@ `   0 h $ 0`$ h$ l" ` ($@ `   0 $ 0 ($@ @ "  4  2 4> Д  4 "  (  2 ( 8>$ 8 ( $@ B` 0 2X  :2$@Q & ( ` @2L    h? $ h$ l@ <=$@    5 >"! .     >!  ! Z& (X$@`2? 4 "  0  2 0 8> $ 8&2 ?"$ 0 $@& (>$@?㿘$ D  6  '$$`8(`82`0`0    ?$`0 Y  ” Β 0 2`8ǒ   㿘H /d * %    & $0"4("0X  $2$H 0㿘`"!@>  !P!@>!` 㿘`   >!p "   > z В `Y&`48Ԓ@ P "8, 2  80 @ &  '>&`8H #%>+>ax@>a >a 2 `8`8* "`8 "\" %>+l > < " >a@??&`D&`D`D &`D>!`8< @ %&`@ `>@">,>(@ >$@">!>,@">>!>}!>>x!>t!>p! >l!>`@g!>d!@Ol B>8 >2ap  >8,a@ 8'H 2'8 ''@ ">a@g@A   >'2 @v >0>a@  >`@" &`0"% > >>>Є>ф0"\"h>>>>ІH#`cpl"p"`"d"l㿘 8@$"! 8@耊d! ?[>  8$ ?   > 8@">b(Ӕ!V>А"x 8 |` " 8 @!,@2 8"@ 8"[  8  "[  8  @@ `(@(@"  D@" D0,@ D` *`  `  " @,@2& < 8" & t& <㿘 㿘`G  2 @@ 㿘m  8  8 㿘 8@$!@耊d! ?Z  8$ ?   > 8@">b(2!> "x 8@ < "@& T& X@?@*@"@ 8 & P' @,@ >+ t 8 "@ 8 t"@ 8" >+!l 2 T P`   T @& L & H>" T 8"  @@2 8> z` T P@  8@ *@ "  8"  @,@""  8  " <㿘`8@B`0>>`"`8?@ ="@`8@ ``< >#H@$"!`@@耊d! ?Y `8$ ?   >`8@">b(";>"x`@,@ @`2`8`8@ @@ "@`8@ "!`8@耊` ! ?YȐ `8  ?   >`8@">b(]";>K#h`8 }"`P$`< Z 2 Ȑ@€   ݀ 2,`PȒ €Ƞ@€  ՠ * `@ Ȑ@€  *  2 `P`P@@2`P Հ @" `P, >+>`Ta€>+!l 2 `X`H "`X`L@֦`P`X @""@`T@"@㿘 8 > }" 8>` " "  \@ 㿘`"!@> ֐#!@>Ґ# 㿘`  2 @ P "8, 2  80 @J &  &`<8&`@ < " >c@ޔ??&`8&`8`8`@ `&`8c>:` #&`48  ''@А c@@   >'D| @ >㿘`"!@> d#!@>`# 㿘`3  2 ,@ P0  @ &`0D&`<4&`P4 2&`@&`4@f < " >c@i?&`D>) 0R >" 0K>`@@U??&`8&`8`8`< `&`8c`D :` > p> x>`D P&`48  ''> @@9`@@  @V >'  @) >㿘 4#>@`   & L>  Ĕ01 @ސ& H 4` L@ H $ `8 6 H  L`4 @2     " `4 L  @"`` H㿘`0(&a< L(   P` @"&a@ `0 H   L   `4& L#``@ 㿘`0 $   W ?   2`D> E`0@ڶ`<$  `D$`T`<@گ*`$ `D *``<@ڨ$`X$ $ `8 @ 2  < $㿘 ` ` `TԔ@`*㿐 )Ē  2$ > * 09$   Ȑ*    2( ? $ '􀦠&  )y     )   2(8  T$ $@&@ޢ㿘` `?㿘4``h> 0>`@?&b>ՐbNbؐ0  @? 4&b<  @9#`&b H @3 &b&b 0@ &b>a@ʔ??&b&b>a@??&b 8&b 8>bВcȐ `&b&`0`0&`4 @֐b[@[b>>ؔj @~ ?@zh # e ! # _  #&b@ ! # T  #&b@ & J ! & D  &&b@ ! & 9  &&b @ ( /  (&b`  &  &bbC` Sː>&`h!$>>?c" $0$4$@4\$PzO3>bȐ!(8 >`ʐ `@"&㿘b쀢 $ \@ \ $@ @J!Db 8b!D "  D  &!D&!H$ !L?&!L D " T  bܑ* @ ?* b8@,"b "@"  2!D \$6 \ 2!D b$b"`b쀤 6 Z$b$b㿘# 6 """" "" "" U֐ "" ""?""# "#   UŐ "# ?㿘H /f * ' ɐ@H 0㿘>  kaH!B!p>!x>>!!`>!㿘 @ ` >!p>!x>>!֐!>Ґ!n" h "`@a:  *`"#``6$2Z"쀠  """"\2\"쀠?""" #㿘 h 㿘"", @ &&" @?* @ "*   "!`  "@ &" 㿘 h"H /f * ' @DH L ࠔ @ C 8 @ D H LuH 0>+""㿘 H /f * '  a2a1;a a L0!5A0 !6= A \ 6 \  @L h0? \@  2 \~ \ ?36 \  @s@20( h~ h`4 \ @ @ɐ :" hӖ $  H 00H 0㿘" h""H /f4"* '"䀢  " @Љ &""܀   "ܔ @ &" "@"*  + @" " ("   " "*`   + " 4"" "@  "   $"&"&"&"@h&"@"("*  $c""*`@ $c""*`@ $c $c @CS  $b  $bP $@"$ "($ TS("$ $ $>$  $a_X? $ , , $ ($a$ $ &"$ $ $b,$ 0b  $b c  $c \ @ ;4\H 0>+"Ґ"F"Ē  "   #d"  #d #㿐""Ȁ`>"8  0  $   '$   'SW   &"?  ?&"$'0>"X 㿘"Ԁ      >ܐ"M1? @ @ @ݒ @ڒ  < `@Ր?< `:@ `@̐?`"Ԁ @W@U @R *?@@K@I@G@@ @ *?@@ @@㿐b԰ bĐ $   '$   'R  6  > $   '$   'R  6 "b` 㿐b԰ bĐ $   'R  $   `'6  > $   'R  $   `'6 "4`㿘"Ԁ     >"% 00@. @+ @( @%  <@ `@ ?<@ `:@ `@?`@ @  .2`:@ `@?.Ԁ `ē*``ē*`` Đ`#d #d#㿘% h> ѐ"  "ܒ`*`   2  `B <  D`B <  K  㿘 Őa !"  0 2  & & #&`  `   ?&`㿘"` X  I E  Qɐ ?     > ;"x` ` ``*  "b " b ="b ?*    Q ? J $ >  "& 㿐" h \!c  @$c 0Tc ?$c  \"?#$c@$cD$cH$cL0G?#$c@$cD$cH$cL \>"" 7777'   ?    @;n # 22?2``$ 22*  * @3 2  א$c@$cD$cH$cL \ =6 \㿘` `?㿘 @`h>#0k>c(@?&b0  @> 8&b<  @8 &b&b 0@&b>c8@ϔ?&b 8>ڐ!`&b&`0`0&`4 @bo`N; >>&`h#`D>?bԘ!d`"$0$4>>$@4\Do<  s # # $Pڐ>b#HW8 >c* `@"&㿘 \ $@ @>!D 9!D "  D  &!D&!H$ !L?&!L D " `  `*   8 ' ,`"  `"@a" Đ  $ \$6 \!D $́㿘" ",   PO ?    $@@   P? ? @ 㿘ڐ@;㿘>ch  !`B >!H /f * ' H 0㿘"" *`2 2" `#߀@d?"  @  " @2 㿐"Ė h" `B : "Đ? &" *"( ' 6"Ā "2Z"Ȁ  &"\$ ;2\#  㿘"", @ &&"Т @ @d  `" *`# " !`  "@ &"Ё 㿘`h@   >`5#  `B < @  `B < @ >` #  `B <  @ >`#  `B <  @@ >`#  `B <   @>#` @> ` @    BaB < < @> (ܒ`  @ >`Ӑ H  `B <  @ >`Ɛ `  `B <  @@ >`   `B <  @ h   BaB < < hd  aB < db  aB < b >`   `B < a>`    B`B < < ``@  aB < `@`  aB < ` >`f   `B < ` >`[   `B <  ` >`O!  `B <  ` >`C!   `B <  ` >`7!@  `B <   >!`)`>`#!F?㿘 H /f * '  a2a1;a a L0!5A0 !6= A \ 6 \  @L h0? \@  2 \ܐ \ ?36 \  @ѐ@20(ђ hO h`4 \ @ @  " h $  H 00H 0㿘" h""H /f * ' " " @X &""@)" "@ @L &""@@  * " ", @ "   " "*`   , " 4 " #"@   $""$`"($` &"&"&"&"$`$`$`$`$`0$`4 TM"$`$`$ `$` `$ \ X  $`,`, "$`(` , ,,,, , ,@ܐ ,    dMv ? $"  ",",",",",",@?,\  `@ {a4\ , H 0㿘% h> !  "`*`  Ґ 2  `B <  D`B <  d ɒ 㿐" h \" ,    dM ? $     ,? 0M \"6 \" 7777&`?  ? @   @;n # 22?2  $ @22*  * @5 `2``ؐ ,    dLǐ ? $    , $  #"`@ ` "` "`؄   㿘`  >!Ѐ  >!  @ 㿘4``>!0`>"08  @0&bD  @<&bP  @H&b\  @T&bh  @`&b>&`hb0@%? &b &bb  `!&b>b8@??&b <&b <b @ @&b>#&`0&`4``0 @%b>bH@  b>"`>>!d` >`l#L&`&`>>&`$&`<??? `   "   " 0  0 I=>>>?"#|aL$!0$!4$!@$4 \6c  $ $!P8`@> !< >b6 >a0 &㿘 \ $@ @5!D "0$  &!D&!H$ !L?&!L "$$ D ǔ @%?* 8@,`" `"@` "   $ \$6 \$㿘" "@"    K` "    2 >"  ?& 㿘H /f * ' Ӑ@H 0㿘>  b!HB"쥒 $!$ % , @ % ` %@I@">"쎒 $c @I b  $$b " 2"$@b  l`$b c `$c \ @ ;5\6#5Z㿘"  "?#" Ȓ "" I&"㿘" $"0I `" `>"H 㿘" $#0I `# `>#3 㿘> ,#  㿐" "H"L"D "@   B< #"H#"L#"D#"@#` \`B 4 \` <  #?&##  ,`#(@F  6 &## "4 Z   i  d2 _2  <Z` U S?`O `  0G D  ?@ ;쀣 8 `*`0?  @2`?  @ 3`+b ` `+c` (#d`0#h*`2` ?@2` @2`@8 ( ! #㿐#  , @`B <@#!'@F    `  # F2  &#  㿘@!8`B >!8.@  @ !H`B >!H.@ ?"@ >>`#@4 @ 㿘b?a" Ԓ @@㿘.`* * # * @   `2* E#2 㿘% > ސ  # .` @ 9  `B <   B<  D |Q  㿐"  \!#  @$# 0]# ?$#  \"?#$#@$#D$#H$#L# ($# 0M?#$#@$#D$#H$#L# ($#  \A"" 7777'`'  ? @    @;n # 22?2``$ @ 22*  * @3 `2``א$#@$#D$#H$#L# ($#  \ =6 \" ` "  " 㿘""G ``"  !2 "  "" "@@ 㿘"  #"*?.`c   $` ` @@ Gl ` @@?  3> 0 0. $`       >@ `>@ > `> > `>$`㿘" " % *`@.` $` ` @@ G ` @@?  > 鳐 HB ` 1?#=  $` Z ?U R O L  >@ `G?>@ > `??>$`B >*? 630㿘 \ r 㿘 l &` &` "b "b ! b "b ! 2! ! 2#㿘 > ` > p 2` `   "  > z В  C>$ 48@ 㿘4`"> x0m> &e  &e [ >`@: &e0e>`@4?&e," &e0&e,e, `$ 0&e,e,@_b@&e, 2R > ` 2K `>ِ 04 x   `>ΐ 0)  &e80 @[ $ 8>辐!0>+!l< @$ @$ 0 < " >a(@??$ D$ D D $ DꏐD< @4 '&e>藐!80 2&e80 @% &e!> !`  2`&e& 0@!` &e" 0>x!h>f!p 2 > >G p 2> > "!&`e3  `Ȓ .`.`.`  `Ȑ@€ _ "`8&e4 .``  `.`   `Ȑ .``  `Ȑ@€  `.``Ȑ @.``  `Ȑ &e4@€  P2e, &e4e,#@ȇe4`&e<`` >6b` >6b@&e@ &e<@&e@@m$&e<@&e@>6be&eH&eLeH @M` !8 3>a 2.e4 <@   2"e4 `@2e4 @M e4 >a 2e4 ?2 e4 `@2e4 @6 e4 > e8 &e8> aE| @' %*` %*`( % %( 㿘% d@㿘% \@㿘% h@㿘% l@㿘% p@%8 %<   㿘> } Ȁ> } Ē  㿐```l> 4>+!l d & 0& 4W& 8`2U 0> " L 1` P'2  E" 2  E" 2  E2  ` 2  ``/>#8*` $!##$%$"!" 0J` "$   $ 0  %  0#&@%& 0& 4%& 4& 0 0C 8 & : 2& <>@a& 8>@ a& 0>@a 0& 4 8@:@C 8C 8 & : >a@& < 0C 8 &  <: @&& < 4C} <& @J   J* (J А 㿘>a !, &!D!  &!P &!@&!< `D"`H `H $ 㿘 T`A$`( 83>+ <& T$` 0$`al 4? $` !> }!H>@a "!H>@a Pal 2> "   " Q P " P P@͐ 8 ?$`h$``$`㿐>+!l  T D@ H " H& D& H H `$ $6 & H D " @$ ?$ & D$   @ $  $ D $ $ Ԁ 2   H > D >"$  ̀    Đ  @0 Đ  @P`$!,` @B㿘 8 8`6  %>@  @  @ ` "А@  @  @ `   @    @    @    @ 㿀2` `> }> }"`"`  !,>>>"c&`&` &`!, !\&!\&!T&!X!T>'''''z 㿘!` T  &'&`̀   `Ē  @ !``Ē  @ !`  $!`!`"!` @#``#dd"@@d`?"@0 d0E" Ed0 # P`#dd2 #㿐  Ք  ?`> } `  #\`    0     '&` &@@. &` `#\`\   &`&`o$$ $ $  $ `S P  㿐  "V y    : 7 㿘`N@ 2@`  `, @ ܒ  @&` 㿘>! 䗔>@䐐" <.` @>` "`㿀` P .` < J  8 2 0C   4耢 "6#\#`? 2 & 0  € 40!H /e4 p* & p    0    `@ 4$ p$ lH 0 㿘@ 6 @ p "@ l&@@` *`  <  ``_ `` Z   㿘` >6 h#@*`   € > '$  > !c>"@ <$0c "@$  <@ @"   *@@2  *`@  O 㿘` .`F  <@ 2? > } Ԁ@":  2 H /e4 p* & p"& p$@H 0  " ` 0 € 42 >"( ㅔ `       㿐`  #\@b  *> |> "h@$> '$ 6`> !c>"@"` $0c "@$`?c*   |* "`㿘@㿘"T   ,  <@  `U 2  , "d  @   㿘`>"@ 㿐\ `&&"T#\#`    ܚ X& <> }  > } >""P"d@  " <>"p  <&"d& p& l >ِ"& 0& 4`& 8> "  G "& &!> "   >6>!    `$"!> "     "@@ "@ 㿘 > }`"`>$ $ @ǐ"$  @> bh> > } $ "|# Ё㿘?2 > b@ 2 b@*@  W * < 2N  G> p>2"a`$ $ Т`$ l"! p   " p4   a# %$ $ $ $ $ $ @  9 p>6 h $ p*`@ € `"    4   4    $ 㿘 ?> b@6 H *< `2`@  "'` ` "`H /e * &  @- H 0`>6 h#@*`  €` @ ?$`  $€ > } ̀  @ $€ `  ?$` 㿘 ?> b@6  * <     >6 hc@* `@ 㿘 ?> b@6  * <     >6 hc@* ` @ 㿘 ?> b@6 >Z"* <   㿘 ?> b@6  @֘2 / *`< 2 '  >6 hc@* `@@ 6 6 @? 㿘 0 4 @ 㿘"d   0`@  #V " #L   cV #P   p cV"_ #KcL"Y 0 #P40 #UGN 0`   $& !&& F ` ?&`   `` @&`   $€  0 4@*  0  2&8#  0@ ` 4  @ $€ 0a@   4@㿘 #S@/ ca@"  #V@9cT@, 0cb@ #`0 #U@& cM@*cO@0#N@[0A#c@n 0{ t 0omj f@ ` 0  [  W(<$<@L  Ԑ89 "&8 0= 0   4 x 01*" *  t:D <0' #* "@*` `t:8 < ?2 "d 2"d@&"d 2 0  ` @ 㿘 ?> b@6 *`< `?`  `0 `4?㿘> ? "@2`   * < "     㿘> ? "@2`   * < "     㿘> b@  lb@*@`H / * &  p"  HH 00 2 o "r p o`<* @`2 `H 00q  & pH 00e& pH 0 H  =` `  P@     s * `   P@     ^H /e * &  p ? H & p>+"& p` 耢`&`:` V  H   p  ?& pG H H 0H4 p( p" pH `$ `( ` ࠝ㿘  ` `   㿘      h>6@*@ €`㿐 p D  @}* 2  o!<@ 8@>@  >6?#@` 2>6#@ h *` ` * 2 €0+` 2`   ?>6 hc@J`*@ '€ ?㿘"\ <* @`"X ?&"X`  㿘bX >"1 b\ , >"`< ` >#  "$`lb` ?>#0bX ?$bX$`p$b\$b`@  $`p 㿘"X >ڐ#P@ "\ ? $"X$ pA03*>#xܷ  < ` >#ݽ   ""T"X ?$"X@  0> }  > @` 4@ # 㿘` .`I  <@ B H /e * &  p` l@`2 "X2 "XH 0 "   H 0  &"X&"\H 0  p  l&"`?&"`h 㿘 p``` 0 @  $€ 0* ` *`   <2  (p?l㿘# H /e * & p !А p` >H 001` .`< ( H /e4p* &p  > $ !Аc    ?$ H 0㿘` p "``"` X > }耠2 d" \" \"d2 ""d 㿐> } Ѐ /> } 耢 " > } < "> }  > }      㿘> } > }` " `0 $> }`4€> } 쀢€> h> }   > >h> }  " 㿘> } 耠<`  0@   4@`㿘㿘  &  &  & 㿘  & 㿘` b (H /e * & = $`>ؐ! ;@`@񀎠`@ !`" H 0` 4 4@.` * +@@ ``$#$@  `0H 0 #H 00 4` .$@㿘 H /e`A* &`A   @  H 0 ް ް ް ް ް ް ް ް ް ް ް ް ް ް ް ް ް ް ް ް ް 8 8 8 p p p 0 L  h ( ( ( ( ( ( ( ( ( ( ( ༀ`  " 㿘`>K# `       㿘> b&`p&`0 > ! &``   $&``"@>`a`` " ?&`d ```&`h&`&`l&`@ ` "``> > b &`Đ`t5M > bȐ`5H  > >"a B`\`">> 0`> @㿘!> $!!>>>!b$ $ n >  "a㿘> !"!"`i"`> "!㿘H /e * &  `2  H 00, "  \  6  `,    # \ & ` @  ` >+7_"@#- H 0`"* ́ 㿘 " p&   p > "! X E> '  B$H /e * &  Ȑ? *&   $   8$ q   " $     !4" >+">* "H*ǒ  > P- H 0> '$ 6 > !c>#D@  $0c #D@$   E  㿘 " &   ( `@{ 9 \ "  6   `,    o \& ` `#>+" 6& @#}0@` >+" &   & 6& @#e㿘 X`-`` ,    ?@$ 2# >`p ʐ 0|>"`$`` "`$` `  `!4r 㿘 \ Ȓ l`  ? d € h& l㿘 \ "  " d&   d€ h㿘?> 2 `  6& . @ 2   `  2 X  4 &`@  "& X㿘& X&  㿘?2  > b. X   "  "X 㿘?2  > b.  ̀   Ȑ $ Ԑ 4 Ȓ`$ d 㿘?2  > b. @㿘 Ȓ & Ȕ@  Ȑ? & =㿘 "}@ 8"~"|@" X0/@  v@" X0' X` @ %"` "  !4  "  8  2  !4` @ @? 㿐 @  #@"# #@ # @"   @ @   !  #@"?$c@ "  #@E#@"  d#@ "s t#c @>  d@y>  d #@ "/# #@ "m  #  #@" d@y  d@ "S #@. t d0# @" d d  c hÔ t " x & | &   & & d   hc "" "" "   ""   && &&    > ۔"" "" " ""q  &&&i  d> ""@@C*` *   G1  @I  1Ȓ Ĕ  ` $ Đ 0: 8&*  *0. +&# !2 ` Đ !  ? ߀" ` @  '@>'  `$    h@㿘?2  > b.  X i > b 6?b* "b\b b?> " \㿘 p 2) ` \ "  \!  2 \ @ & \s & \& \`>  ה` >  Д  㿐> !  > !  1>  "@ 1> "?`)&"> > ! * =* 2  o"< 8@"1> >  ?#` 21>   * 6 !> !  @> &""a㿘> ! > ! ">  > ! € 㿘> !  > !`  `㿘 ` @ b2 d2 h2   ld €h " l`     ( " x \0'ؒcY @'䀦  '܀ 60"''0 \cZ㿘.2 <!@ " `4!! @"  `@@" `@ @  @@ @@ 2Y  ` 2 \ 2N  \ I.2?Ò@`+C>"L*` 2? \ # 7  \  \ l 0.=2$@ ?%@`? =2'@ ?(@`? =2*@ ?+@`? ` 0 㿈 `'H "    $  ?Ð" @@& &  6 . * @@d  =!LH?Ð"@`a>"*` H  k H  d H  ] H  V H  O H  H H ܖ @A H Ֆ : H Ζ!3 H  , H "% "H ( ^ h  H H`` 2 `  "  H "$ $ N $ H `  !0" `* 2  o< 8@> @ 2 $# b    `?   @@= @ .@=*2  o< 8@*2  o4!< 8@ >  `?# > > <c"24 >ab(.`)=``!.`, 2 a .`  $ &   2   $ & 6 .`=2`!@2 ِh # 2  @2  .@ 2&  ` " *  2@ ? & @Q   і$}* 2  o:<@ 8@5>@ 2  ?#@` 2+6  0* 2  :.`2 ` `2`  * 2  `8" " 6    6 6  `6   < X | 㿐->  9   > b -  , *  > @@ " "  @- ? * @> *`"@-Ԕ Ш  %  <$ : * @> "*`  @   @  $ :  4: 2ߙ<1=!-(0 @#* =(0o< 8>   * ? 2 ** 0> *2 㿘`0>!.` 4a666$666666 6666 6 6  66 6 6 6㿘4a22222 ? $ 2+  * 2  o< 8@ >  8 `8`8`* >2  v+< 8@   +fb+ * 2  o< 8@>    ?# = "< a @a@a@2 2 .`)  +* 2  o< 8@ > 8 `8`8`* >2` @.``@ ܞ>!6 0  *j`2T㿘 . @ . * &  &@  @4!2 @ 2 @ 2 @ 2 @ 2  p ?   `  2  2 > ! * "  `T Г,   (G* 2  o< 8@ >  8 `8`8`* >2 ` 2"(< 8@  <(< 8@  > @ " ` ( *А`X Г,   * :* 2  o< 8@ >  8 `8`8`* >2   <>M" 8@  @ " `*`2  * 2  o< 8@>    ?# = +`<  @@@2  +` @* 2@   () ,`* 2  o< 8@ >  8 `8`8`* >2` @( ܢ``+`>" @ *  ,` * @ *aTа @"` 㿘 > L >  !!`n  2  l x l 0  H P P P P P P P P P P P P P P P P P P P P P P P P P P         P P , , , , , , , , x 0 $ 4 4  4 $ @ 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4  4 4 4 4 4 4 t 4 4 ,`" "`$" `" `" " " "    " 4" <" L" $" 8" D" H㿘#> }` $  ``   @ @ `   @ @ 2$ @$ Ӑ㿘 > }  P   \  & 㿘``Q>!*` - 0H  E?C& A&      "" @ 8 `4 @ <   @  %&      <& &   ?& >Ϙ"p0  & $    & @ 4㿘` @ 8   @     &     " 4& @֐& 㿘``[2  (& 0@  㿐``3>#*`  0 ?`  *  (  & *    # 8  @   #  @  O < 0 ?`  *  (  & *     "& &  0 ?`  *  (  & *    "@ 8 &  0 ?`  *  (  & *    "@ 8 g&  0 ?`  *  (  & *     "J&  0 ?`  *  (  & *    8  0?`& `   *  (   &  *    8 ?&     "   <     <"  0 ?`  *  (  & *    " 8  @  "   0 < 0 ?`  *  (  & *    "@ 8 @   "@      <"@ 0 0 ?`  *  (  & *    # 8 @  #  @    <" @ 0q 0  D@ H7 L@,` (  `/(>"T*`  0?@M       0@,` (@ ? ? 0@,` (@?ز? 0`@ @ ,& L& 8& <& D%& H       0 ?, *` (    8  & 4  & L& <& 8& D& H;㿘``0" `9`; 0  0   ( ,(  & 0$  0 (* *` * ?А"   & 0 0  & 0 & 0ג 㿘    "3@ `?%`" $ `       & $  r & $`2@    㿘 `  @` `; ` `  `` `  `  ``` "`" 2  `  @  }(0o < @ 8> @ 2- @2 -`2-> (Ȅ-(0 * ?,(0 * ? -o(0 * ?Æo0> ( ",v(0  * ?Æv0> 4(2j"* 0<"\>&#"a>""^>""R>"U 0\"F>A>"8>"1 0N<>##(>#"< 0>%>## 06,> ## ># 0( ># 0 > ` h>px>"  >>" >" 㿘 > }&@ ` &9 㿘`"`0`"00     <& &     0    㿘`2  &    <  0@ "      "@ <  "& 㿘  *@ #    @–    @ >U"?  @A  4& >I" ?@  2?@ 㿘H/` /  ? (>#   ("`  \& $ $  ' & 4 $' @ & 8& 4 8 4& 8 4& 4 4'Ԑ 2 @ & D $@ 8& @'Ő : $@<& H& L& <& $&  '2 & T $'& X (' $ (` & P ' h  ( ?& (  (`@%& \ ' <: "  :  ?@ 8&   "':  \ " @&& & d  \ @"@* & `& d& ` ( +  \   " < 'h$ hA 8  8  'X \@'T'P@$h) >>>>>>>> a`Ė xcTH& & & & & & & & Ѐ&  ( >>!    & &     (@b (@  ( =& (H 0 ?"& (H 0 㿘  @    @ &@   &  &       2`> 2 2**` #      (* # 㿘  $& <:`:`  X& @ X&  <@& `$& & @&}@%  ?""" " """"  " ?"ۖ 㿘 T&L X&H `$ &A@&< ?$ ?@?㿘 ( "  П@ & `& $@` (` П€& (0 ( ?& (  0"h *`h?`` 0 *`*`@*`*`h`` 2`2`" " `#㿘> h< @2  (    :  \:     <`$:%ɣ: X%Ő   H@`""@"`"`"` "`"`"`"`?`  ""@?`@ 㿘 $ X%   T%   " $$@ "@::`: `8"2 0)  8*  82 8" 8*"822 㿘 T%B X%> %9?   < h@@ <$``??o> "??2 0`??\> 2??2 0M?K *??2 0<` "@ `& @&>>??/ `*`2""""" """" "*22??2 >p`"`  >>>d "`"`"`㿘  $ X$ <  @  $  l h" h l@ 2 ?     P&${ 8 (@` Y,>, `H@8 B @ @ &@@9 `3   *  *` * @82 @ @&@@    *`  * *` @2 @ @&@@ | @  * &@@  t&@ `>#ē*` >@,88 @ S @@` @ @&@&`@F  `#">   *  *` * @8`*  @ * 2@ &@&`@!    *`  * *` @*`  @ * 2@ &@&`@ -@  * &@@-@` @ @  &`&@㿘 ` ##?  h <@ X# > `$ @ + .>@  H ??=8 ?   #? 01>cĔ+ @ >#@*  >?/ ?/     # `#?  `? #?2 㿘 `  #> $ X#:  < `$ @ *,> `H??-@ ?  #? 0">#Ē* `>@*` ?8 ?8   # ? #?2 㿘  """ X" $@ V >> ? ?@ ? @:   "``* > , * > `H@ * "#+ @##đ,   #+@#*  "@  #>#@ ; # ??@0e>cđ(`@ +>, c@@  " ?<? 6   >>   "@   ??5 @ - :   "`?* ? >> H,  @ *   #@#ĕ*# @` @ @ #@#`  :   "`4#@* #@ B :   "`* ?> *`*>  H @* !#@+ @#@#đ.@ #@+@#@* `"@ #`c@; #`??2r 0 >> ? ?@?  @ H :`   "`@* @?> (`* > `H@`@* !#@+ @#@#đ(``@ #@+@#@* `"@ #`c@; #``࢔ :   "`4#@* #@`* :   "`?* ? >> H,  @ *   #@#ĕ*# @` @ @ #`#@??2n >|" 㿐 X! @ T!?  h?  < @ <@  ` `$` //;  + 2 + ` P & `(`8@ ` `*  ` @*`  *  @ 2 @*+ 2 `   * 񀦿$, 㿘H/` /> !Ѐ     $ ( 2 H 0> !̀> h "!̒ > !Єh @` "!Ё> Ѐ"  22 㿘H/` /> !Ѐ -`  $2#`  2   (2  aR 2 H 0   ׀H 0?㿘H/` /  $ (   H 09?  > #'> 4`В`"#$@`4` 4`$` $`4`   <$`y <  $ ( ߔ `"`8` 8i 84`$БH 0 㿘Ho oU ' , H 0?"  0"  H 0? * 2 &@2`?H 0㿘Ho o `&@` &H 0` ?㿘Ho o  ? ?> H* 2 2`H 0  ?㿘@`!"  - +' *  @ `@  ` @  `@  ݦ`   㿘@`!"  + )% *  @ `  `   `  ߦ`     23`2(+`@ #@( ` ("@ "`("`("`("` 0 "@ "` 㿘* * \ *@  *@ Ŗ 㿘>_`p`?㿘>`x@c>А>  0`?ad >`@c: >ap>@cat @sK&d|>`B@c @s@&ax>`Д @cܐ&`8>`$@c֐&`0>#`@cА&`4`8`0@a`8_`8 & `4: &`<V&`@`0>`8|!d|@?&`X `&`p> aTۘ`<?> c˔㿘#A@._@"5 <@@ D@#FD@ B@"' 8 #E@;?0: #J@"6?1C@"  8/? +"@ 4"@ 0"` 8"` 8 @? !"` "@ 2 @S!|   2 @n!| 2  @! ? > zԆ :    &?`@8 2?@ (?>+lat ah ad( ad ?㿘!|* "|* #|* @N 㿘@ `!"@(` C 2!` ; 2 "`3  㿘@ `!"@(`  2!`   2 "`   @ax(""ax0 ( a|b|c| ax( @@ ax( ax(  `  㿘` ^+ 2'  "#  b ?"  ">+   !l 2   E"  4 ?   㿘>"! '>+l   0 ? 0`L`&`L  @q &`P0 @q &ad &ax   6  0 0l >`L  >!( &ax >a0@b   >+L >!8ג>+l 2?> "`L`*  J`@`l l? 0>  @`?ah &at @ # \$`0>`4!@> z Ԓ `@ ax@q2* @?&`X `&`p!`?> cA@"' 4_@"( <@@D@F@ C@ B@ E@?0 J@  "" 0" 8" ""? > zԆ :    &?`@8 2?@ (?>+lax al ah( ah ?㿘>+!l !t  L 0*`Њ@@ Ъ@@0#Њ@@ ?Ъ@@0H/` /`!d `  `!d ` *`!d ` *`H 0 㿘` \ 2 >+!l 2  2    ?" و  E`?㿘`L  &`L0 @pW >+al ` &`P> " " J  0 0  @pA?&apad  z ap "@ s"` "@ "` # D$!> z&`p `@   *@p&at`@  * @p &`X@ @? `>`0!Po`4;?> `Hʔ㼘`!p> z Ԓ  @!t \* ///   * * * > z Ԓ  @!t [*   * * * ` !  㿘 E@"> #F@ "8? c@@!cD@.?0-#H@'#A@" 4$? cC@ cB@L@"? #J@ "& & 0&&&  ? > zԖ  8`  %&#?`@(((8 ?@ >+lah ad(@ ad@ ?㿘` [ 2 >+!l 2  2    ?" T  @`?㿘>!h`L0`&`L  @o  >+al ` &`P> " " J  0 0ad”  I ap"@"`"@?"`  #$> z `@ * @n @?&`X `&`p>ta>`0!pG`4`?> `ע㿘#A@". 4c_@"0 <c@@ cD@#F<@ cB@"!t #E@3?02 #J@".?)cC@!t'? !#&!& 0& 8& &&m   2 !p  ? > zԆ :    &?`@8 ?@ >+lah ad(@ ad@ ?㿐!p #\ !t㿘` Z 2 ` >+ 0@  >+!l     㿘>!8?#4>!@044>!w 0`>q!0>b@^J@ "> >c">   @ 8 0`?@m  <    "0&e&e&ex&e|&e&e&e&e >2&eD :` :" <ad  $#`@D*` `?&e&e  @m &`X`0>`4"0>#&ee `@it&e&`8@ג e   ap"  @ @? `Չ&`p>cT  Ē?>6>! | > `L㿘#A@"/ 4cD@"s c@@!?0lc\@.c_@"1%d? #L@ "M#E@Y?0X cB@'cC@"0%O? K&& 0&%   &%@? !<& % 6 @6&  <* 0&.&% 2+ !p@ % # 2  !p@ɒ 2@ 2%@<   @5  ? > zԆ :   2!?&?% @*`:`  2? (?>+l!h !d( !d 㿘 8#`2 X% %x @ A*@>cTO& 8@ @% %x p q*@%!*(%"& 8&%t㿘 8 ђ >  \> "`|% A @`%x ( (㿘@``!"  + )% *`     `@\  2` @T  2`@L  ߠ `   㿘@``!"  , *& *`     `  `   `   .`   %t2%p"%p "%t@  * @8 "%t"%p%x(%*`ap  @%` 㿘*`!s* !r* !q* !p*  㿘%x ` " @    *`%x `*%t%p  %x  "  㿘` W " >WbH 2#   >+!l 2 ]&> z   ,@k?@ ?" Բ `  㿘>"X0ad5   @ky&ap   @ks&at  *@km&ax @kg&a| @ka &a  " L@`L> &`Lbh >bp@[L@ >"x>+l ?> "`L   `" J` l l? at>  `?>@#&d:`d`&d @f @ @ $#( > z Ԓ `@0 * @k &`X&`p`0#  >b`Ӆ >#>>>>aX!&a&a&a&a &a$@>`0"`4D > `0# ? > a8Ӛ㿘#A@". 4c_@"0 <c@@ cD@#F9@ cB@"! #E@0?0/ #J@"+?&cC@!$?  &!& 0& 8& &&e   2 @g ? !x?? !`   !t`@"!p" " > zԆ :    &?`@8 ?@ >+lah  ad(@ ad@ ?㿐!p #\ !H!x`!x H 㿘!x `0 02 ?#ߒ @`"!p! !=  !|``?""`㿘 ]!|` @ @ 4"@  4"@H `$ `$ `$$ $ $ $ $ $  *`3$  ̒$ $! `$  d$  4 ` ?$  d?$  `$  d$  ` 4 ?$  d?$  (  @㿘 n!|`k @@g D  4"@  4"@ S `  `  `  `$$ $ $ $ $ $  *`3$  ̒$ $! `@$  d$  `?$   d`$ ?$  `$  d$  `?$   d`$ ?$  (  @㿐 `W!| @@S D  4"@H 1`  ` , `$' Ȓ@ $ $ $ $ $ $  *`??$  c?$ $! h* @$! d$) `$)  d`$ ?$) `?$) (  @㿐 `!|  @@ 4"L Ȕ@ $`$`$`$`$`$` *`??$` c?$`$a h* @$a @2   ( "  $i$i ?$i `$ d@$i `$i  d`$?$i 4 ` ?$i`( `@㿘  !| $   $$$$$$$ *`$ U$$ d@$ `@$  d$@@ $  ` @@ $( @!x(( "(㿘`TO  >TI"   `?㿘>`"!>T5"  " >b@X|` > J@ >G">  0@`? @gӖ (&ap  %ad   >  `ap  p 2  ؐ  *    *ad`  ad] > X&dxdx&d|`@cg  @˔ ap "@ s"` "@ "`$#Υ > z Ԓ `@ * @g &`X>`0"`4&`p `0#  e>c > `0# ?ϛ> a*㿘#A@". 4c_@"0 <c@@ cD@#F9@ cB@"!t #E@0?0/ #J@"+?&cC@!t$?  &!& 0& 8& &&  ' 2 @x ? > zԆ :    &?`@8 ?@ >+lah  ad(@ ad@ ?㿐!p #\J!tH`!p `!p(!p(H 㿘!p  "    !t `*!p !  !p(㿘`R `?㿘>b@W>>b@WJ@ )>>ܐ")>ِ">  0 `?ad ! ! @f`&ap "!@fZ&at# $@fT&ax$ #h`0 &`8:`4 }&`<`0&`@e `?&a`8!> z  `8   @f*a&a|`0   `8   @f&a @&`8a|@?&`X `&`p" `0??>6>!  _`0>`4`a#>c@VJ@ >V# T"> bδ㿘#A@". 4cD@"C c@@ ?0<c\@%c_@"% <4? #L@ "!#E@)?0( cC@!cB@  0 && & 0&&&  @&* & @    @   ? 㿘 8`>!' !t."`\!t " X!p "`p!p?" T!p"`X! !|Q !' !t."`\!t " X!p " p!p"`T!p "X@!x "#!x?#"c(!x[& 8' !t."`\!t " X!p "`p!p?" T!p "`X! @J!|!' !t."`\!t " X!p!" p!p" T!p" X! 2@2!|!% !t*"`\!t %"`X!p?" p!pc" T!p" X! 2Q"!@P  **!x "*& 8㿘> zԐ>  @2'? &$? @(82?@ (?!h>+l!d(! @ 0@ 㿘 8 * >  \> "`|!x ` !x2` ` 㿘`P   >+!l  V$> z  0@d?@  8@ 㿘>+!l   > " " J  0 0ad  / &ad  $ @dq&ap  ( @dk&at&  @@de&axat<2@ @   #q$> z `@ * @dL @?&`X `;&`p>Ғc\>`0#@`4q?> bP㿘#A@". 4c_@"0 <c@@ cD@#F1@ cB@" #E@(?0' #J@"#?cC@? &!& 0& 8& &&@T @ 0? > zԆ :    &?`@8 ?@ >+lah ad(@ ad@ ?H`!p!p(H 㼘@``!x!"*!pK R !p 2  ,`!p ` *`  *  "  *  $  *  !p `* J` 2`  C  ` <  㼘@``!x!" L `  2E`   2=`  "!p3 !p 2  ,`!p ` *` 2@ `  2@ ` @ 2@ `!p `  *`㿘!p !p 2  .`!p  *!x2 !x @2"!x@2d!p ` *`㿘>O cX   >OcP   㿘>cp@SK>#h>  `?'> z>#x` 0jА` @b &dp l@b$&dt@b!*  $4@2&dt @֔  #ɟ$>c@S   ad`@ >#ܒ`08  %`@   *  @be@?&`X&`pT `ap@l#>`>`0#`44 $> `@P`z?> b ` ` `* " 㿘#A@") 4#D@ "@ 8#_#@@?08@"! <4? #B@ "!p#C #E@'?0&@!p"? '&!& 0& 8& &&@v  @ 2 @R  > zԆ :   2?&? @8 2?@ (?>+l!h !d( !d 㿘$p #$pw#ŀ`  ߔ $p u#Ł㿘*`!p * * * @ 㿘$p#_`.`!p.@  #$pS 2 㿘@ `!", % # @`@ T   ` @ L   `@ D   `@*` 㿘@ `!", % # @`    `     `    `@*` 㿘 # $tڒ! 2?㿘 #!Ք ?  $tƒ! *$t㿘 $@V֐ Q  L 8  6 0@?0&$x 0$"$x%"# "$x01"$x&@$" $x0)"$x0&$x @ @ &$x>>`>>>⠘#`$t&!&! 0 &! &!r&!$$t Gn 㿘    В ̒ ` ǐ$ Ðx d` @ `@ mt FD tD @.`t? Pt; T  X $t*4D㿘  $    d x`@ @  2t F  t  @ `.` t P `. t T 4.t  X㿐  Ȕ$x @ h* @ ' G`  `  B `  $ < d` @  $t FŔ  `$t$t @.`$t T  X $$t*Ő㿐  Ȕdx @ h* @ ' dt F  `dtdt @ @2  ( " dt  T  X *dt} 0`$ ߒ ے d T  `.`dtl  4. dtf Xv㿘     $ d  $   `dx`   odt FF 3dtF @,dt P@dt< T  X $ *dt4 D㿘>K (`?㿘> 0> cT  cT "dx 0&dxdx ad> 80h` 80 @_- &atD< @_' &ap>    `?"!5 > z Ԓ `@ * @_ at&`X&`p>&d ``0 `m`4at > &d" #@&d&dd @Z` `0#4 > zb,`   @ @Д  > `0#? > bǝ㿘 #E@ "d c_@"G < c@@+cD@U?0T#H@"P?K#A@"+ 4H? B@ ".!x#L@"<? #J@"7?2C@$!x0? (,& 2*    "% @! !& 0& 8& &&Q  ꃒ 2 @< ? > zԆ :   2?&? @8 2?@ (?>+l!h !d( !d 㿘*` !x* !y* !z* @  dx (* ax aydxaz( dx ( @ dx ( axH!t`"$8"߆ t 8H 㿘!t     !!t "` !t "` !p0@  #?@02?㿘 :>!>!>!>">"!p ԒbLP!&!&! &!&!&!$b &$#b !p ""!p""!p""!p""  0 4? /!p o*  "$!p@&$"a!p"!!p"! 0 4? /*  o!p "㿘   ƒ?’ ` $ d p3 $"p $o*  "   $ o@? /*`p@X"p$*  "    $,@? /p"@ p`c$㿘  $ v?r dmNp3 $"p o$ ` /*  #  4@ ` o ? /* p X" p$ ` /*  #  4 `  ? /p* "@ p`$㿐  Ȕ @ "`  `  `  $ d ap?#$d"ap""ap o*`$d@#   $ /@ /ap, "@ ap`$d㿐  Ȑ@ ǐap?#$d"ap""ap@ $d @2  (  "@   /*  o `$ d ` oapo*`@"  4@ ` o /* ap " ap`$d㿘   $  d   $ ` vap!$d" hap""ap / *`$d@#  ` `$  /ap,  "@ ap`R$d!t "$ 㿘>Hg `?㿘8  @\0&`0*`0>  *`0 x㿘>HK `?㿘>`Te  0&dԒad&dА $4 @[ &a@  @[<&aa>   &d `?@  # "X`0> z`4&d&dԒ LD *  &a@[Ĕ $`$`d>dؒ % a >$&d" "t&dd&d `@Wx@p@Ò   Õ-  2 >$`T`* ``""@$``$`>$!`l`   `0# @ @@   ?ó> chB㿘 #E@ "l c_@"O < c@@+cD@]?0\#H@"X?S#A@"3$P? B@ "6!#L@"D? #J@"??:C@,!8? 4&`1&$>$ÿ`l    0# 2% @!!  &$ؐ!& &&&    2 @H ? > zԆ :   2J?$Ѐ'B? !d`8 ,?@ (>+??B !p`8 2?@ >+??B !|! 4 >+? >+?>+l` @( @ 㿘*` !* !* !* @ ጇ*`""""""*`* ?" @( ""` ?! `("$"!"$"$2` `*` !"$"$2 ! `("$"!"$"$2` `*` !"$"$* !"$ᘁ"$H!`"$8"߆  8H 㿘!     !! "` ! "` !0@  #?@02?㿘 H>%>%>%>%>&! @a|ܘ!8&!&! &!&!&!$b &$#b !?""!""!""!""  0 4? /! o*  "$!b&$"b 0 4? /! o*  "!@&$"a!"!!"! 0 4? /*  o! "㿘   ? ` $ސ d  b$"b o$*`@ "  $ o@? /*`@X"$*  "    $,@? /"@ `V$㿘  $ ? dA b$"bo@ $ `@ /*  "@  4  `X ? /*  "@ $ ` /*  #  4 `  ? /* "@ ` $㿐  Ȕ @ h* @ 'D`  ` ? `  $9 d a b$d"b** a* "ba o*`$d@#   $ /@ /a, "@ a`$d㿐  Ȓ@  h* @'a b$d"b#*`*`@ *`a "a@ $d @2  (  #"@   /*  o `$ԒВ d ` oao*`@"  4@ ` o /* a " a`g$d㿘   $  d   $ ` Va Zb$d"b h#** a* "ba / *`$d@#"  ` `$  /a,  "@ a`-$d>  ` O T`  @I0>ؐ Ȗ,(Ú$ >'(@IP',,7(`4$"2  ". @ "*  %> #$ $ $@`,`: $ ($ 8 2 >   ⽐!0$` h I   $` 㿘H/` /` f  ?y $  \  o $Ԑ ?&$ԑH 0! "$ 㿘N , 2 N  @>aHDE 2 >CaX@ 㿀J@ , 2`J@ `>!h > >!p`0m#> a`?@H`" a>ܐ!($#''' 7@G˖ >̐!Ƞ0  @W]&d  @WW&dad   &`8 &`0&`4&`< &`@`4>`0!> z Ԓ `@ * @W8&`X&`p@3@?" `a@:#>(`Z? @ > c㿘#A@") 4#D@ "@ 8#_#@@?08@"! <4? #B@ "!#C #E@'?0&@!"? )&!& 0& 8& &&@d  @ 2 @  > zԆ :    &?`@8 ?@ >+lah ad(@ ad@ ?` $@ @$@ @ @$@ @㿘!* "* #* @] 㿘@ `!"@(` Y 2!` Q 2 "`I  㼘@``!"( `- 2!` % 2` 2Pa Kb F $:`($ab*c @$`( $( $ (2 @㿘`!d @U  2/` ?? @ @ +`*2 @ @3`@ @ * @ +` 3  3` ` ? +@?@` 2$*@  @` $"@ ̈́2`㿘>Aa`?㿘>" >" 00ad T `    @U &b @U*> `$&b `? #>b0@F > z Ԓ `@0 * @Ur &b&b !&b!> z `@0   * @Ud &b`@< * *  @UZ &b `@` * *  @UP &b&`8@Ē  @ b@?&`X `5&`p>*̒c>*#Ġ`&e&ee @P` f?>6>*! ؒ w>b@@EJ@ >"Hb>@"P@2@3 `03``4 t `> `DԔ㿘#A@"/ 4cD@"o c@@!?0hc\@*c_@"-"`? #L@ "I#E@U?0T cB@#cC@","K? #G&& 0& 8&"@? !<& " 6 @6&  <1&* .&" 2+ " % # 2  "ฒ 2@ 2"@   @   ? 㿘"??#"h"" " 8")& 8"`` @ `?*@" ` `"`2& 8>*c& 8㿘 8 ’ >  \> "`|H"`(" H > zԆ :   28?&5? 8 @8 @ >+l!h !d( !d"? @(8 2?@ ( ?>+l!t !p!p 㿐" #\ O"㿘"h  ?   "h"" ! " "(" 㿘>?b >?b   㿘>b@D7>>b@D/J@ >" ?4  &4&8>  0@`? $@S&ax>b@DJ  g?Ϡ$$  >+ ">  >c@D>@Cc$# &`8&`0&`4$&`< &`@`0>`4#ad !> z `@  *@S8&ap`@ * *  @S.&at @ ap&`p&`X 4 >,a ?L> `۔㿘#A@"4 4c\@5 @c@@&cD@#F@"<?7c_@"& <5? cC@cB@, #L@ "$#E@#?0" #J@ & & 0&&& &* & @I   @E  ? > zԆ :   !&?`@(8 ?@ >+lah ad(@ ad@ ?`15!x 㿘` @ >,a!x     !x2` `   㿘>>#0 >>#8 >>#@   㿘>#H4>#P` 0y>cx@BL ">#>  >@`?c> &exPH @R &apD< @R  T&atad >."&ee`&e@MĔ  @ $#  > z Ԓ `@ * @Q &`X>`0#`4H&`p  `0# %  ɐ>-b@`> `0#  %"?0?0`? > `㿘#A@"- 4c_@"/ <c@@ cD@#F:@ cB@"!%x #E@1?00 #J@",?'cC@"%x%?"&!& 0& 8& &&@[!x  !x@ 2 @; ? > zԆ :   2?&? @8 2?@ (?>+l!h !d( !d 㿘%x  .`!{* !z* !y * !{* !z* !y* .`!x* @ 㿘@`!"P ! ; ,   `@  2?`@    `  / ,   `@Д  2 `@Ȕ    ` , @` @  ״   㿘@`!"Q   9 ,   `  `   `  1 ,   `o  `h   `  , @ ` U  נ .`  *`x!xtt$ @ ``"!p!p 0  㿘!p` " `  "` ϔ! !p  㿘>c@@J@ ">U#>   &`8>`?cД$@@&`0>#c@@|`0&`<* >&`@&`4 8#> z`@  Ԗ *  @OƐ@?$ $  ` 4  *  "@*"$ H: \  $ L $ <  8+  $ T" $ :   \ " @~|$ $ d  \ @\" &>1>1>1>1>1>18bDH!bt $ $ `$ $ $ $  $  >6>2!  qז?&d@  @_ > a46㿘#A@". 4cD@"; c@@ ?04c\@%c_@"% <,? #L@ " #E@!?0  cC@cB@  0 & & 0&& &  @ &&@< ? > zԆ :    &?`@8 ?@ >+lah  ad(@ ad@ ?!p( "p( #p* 㿘$@x`$x[$p  @"  @ 0  @    0@|$|?n?"n$.#$.$. 4? 0*`? $.$.  $. P$.$.  4  0?*`  $`$` $` $` @@>#!p"p#p @+@` @`+` @ *`>/ cL@Y&$ $.?$. c?$.#$. 4 0?* @$`$` @@ $`#$.&$㿘dt$ ` #& ?    >#`㿘$t`& ` ` @"?&&  & &  㿘$t$Ð  #p!p$"p  * @@ * @$ `  $  $ $t `" 㿐 $x$p  Ȑ@ 1`  `  $+ d   % ?`$ ?@\ h$n/ * @ * $n . @  @$ $ 㿘  $x$p \ ` $ d??  @@.`   P@ % . %` / %`%`㿐`P#\ $    㿐  P#\t 㿈 @% ( ! xp  ȟ@@@  P& h* @ * &   ?* @&`&` 0   P#\  D@ 㿐#\ D l 㿐 #\` 㿀  Ȓ@ h*`*  ''P` `$L*  ,  (  P#\  쀢 Z`$* @  P$ * $ ?* $$` "*@ $< $x$p` P&`8`(@@  P$ * $ ?* $$` "*@ $` `$ * $  쀢 * $  쀢 ??$㿘$  >  \> "`|㿘#$8@  > "a 0> ! @   >  ?#$ 8  >+l# 003f## 0㿘 #$! 8@" "#$ 82#$㿘 #$ 8*@ " "#$ 8 ?2#$㿘" `  `1  " >+ >+(  >+# !l 2 -#$ " - !l 2 -#$    -!l 2  #$ "  #$>+#( l2  %8 # %"`㿘>+!l !#$``8 `\@ #$?#,`8 "` #$ `@#$ 8@ @" "~㿘>+!l #$ "      0 [0B0?㿘#$  8 "  >  >0  > H 㿘`7  " "` 8X@ 㿘 >` 7>``? 7>`?`7 4`? "> 0>  &b&c(0 @K2 &c ` > ! @ !   !*@`!`D !  <&b@>&b&b"D`@; &6b >+!l   b   b @s,?* @ @* >? &b&b6b&c$& 4&c, 8 &>1 7   <@    ` >1 6 ` @$ ?bH1>+!l>@>@>@>2>2>3"b"ВaX,&bh&bl&bp&bt&bx&b&b`&bd>3 &b>2#b&b|>2>2T<? `  # ? @ #0#!l c$   #?  % ?   ?ݖ ? 0  % ?Ԗ ? %$!l>=#쀢` &bc$ ">2 &b&bb @F`f㿘` 6 2 4 6  2   ? 0 ?  㿘 t 4(@ݐ d4(@ t(@?Ȅ 2(@(@(2(@ t(@2(@㿘 t d, , t (( t(㿐`x􀠠"q>4>>4>4>4>'"c$H>#T@&b&b&b&b &b&b&`p0 @I̖ `p&`t!?'> ,n > }"!D>!@ `p  &`l> !H#> z``p  @j}2 ``l  @ "`p>!X&`hb€> `l!, &b&b̐, 2 >!x> 8 !$ , @ ?&b``l &b``p" J&b>4>4><"b><0!t@&b&b&b&b  &b&`p&b(H@I_&`th@?4  @ * " `p@IQ &`h&`lhD !4hD?*4@ ? 4gb`l€`p`l`p$|# &b&b&b&b&b!0Yb=}@O `>!0M0 @>7">;>5?cȖ"$0$4$@4\$/;Ɛ;b> a*@ >!j  >6 &`0&`4`0@D 8 4 8>6 &`0&`4`09 8  >a85! ` @"$ 㿘>  \a!B@L(D!(F  (D!4(D"Д ` @ @o `P `@``@` >" !B@>!" ` 2"Ё 㿘#"!@y@`,`"  ` ?` > Ԓ`B > 0#  2  *`   ( 2  2(* *2`(@2 2* 2*`2`  ! @ B >!4  $4  4  4 #Ԑ@ @ n'" *"ܗ*2 3  n "ޖ #@ +`3 +` 4 @㿘#c Ԑc {6 6 ҕ*   >k"0  4 !! B`C >!.>! > "P >  "h > "x  > "E!`B >! > :"!!`B B>!>!"  # #̐*` @&" ؒ` 2`@ ?"@& & & @ x㿀"ܳ.`!''2#`? 2`*  a̐ 2 #@xM &`@xH &@R !`B  >!䀢 !> !Ԁ "Q$!   '  $!Ԑ x8㿘!#'*@ @ > bԔ @Ȑ0!@# `aА 2` * #2@w &*` ?# @2@w &㿐 \`@?%@ 2qad6 \@ 2` @̐ė*@ @ 2* @ * 2& @Ě@ * @̐<#@@  2@@* @2 @@*` $`h" @ ' *  +  + @ +   3 @+  3 @+  3@(@``n#@ +`+`3  0@+  `n#@ +`3 +`bИ 0@t  $@a V  $a$a$ aĐ?$aĀ Jc@c̦* @   @      *  2  %(  >"ܒ`W. 2  ; <"@@tz <@ Ē@ *@ . . 2  2@ ؒ`2`@@ ?"@$@ $@ 1#@ m#@ i` #@#̐#ė*@ @ 2* @ * 2% #@#Ě@ * @#̐<#@@  2@@* @#2 @@*` $`h" @ ' *  +  + @ +   3 @+  3 @+  3@(@``n#@ +`+`3  0@+  `n#@ +`3 +`bИ 0@  $@4`ҁ㿐H /f * ' "Ȓ "€"̒ "€"В "€, h$@' `, ` * `*,@ n`$, 2 , 4` l h"@ ' ,` * *"@"@Y d @ "@ `@W H 0  H 0 㿘H /f * '  >Ր# Ԣ x ;6 '  @`` @& ># ` @ >#8 Ԑ`6 Ԓ@A H 0 "x"А`' 4 !"@>9u0b(>+" @s* u- v0@   㿘<%6`6`6@ n&@ *"Е*2`@ 26`  23@@ 2`3@"А@ ` `$@@>#X`@>#p@ 0` ?>@ #`>@ #/ 0># )㿐"# "ؐ"€a"ؒ  3@s#< &> !,!,&aГ* @&  #,`"  `` ? !  @ + ,`""   `@  ?+ a @6 ,`"a̢`@u:*  n "@*`2 *` 4@,` !"ܐ?* @ ` 2`#Đ,`"  `` ? !  @6 + ,`'"   `@  ?+ a @6 ,`'aТ`@t*  n "@*`2 *` 4@,` !'?*  ` 2`̐,`" %`` ? !ؐ & & Ԣ & @ & !,`"  2` h%' ! `*` `* *@ ?  n!"ސ!"  "Аc&c?&*c&c2*&  3 n'"@*`2 *`"ܐ 2㿘6@#6`<c! 6`!*` "#`**` ** 2`@ 6` n &@ **2"Д 3 f >@ 2 >  0 㿘"Ԑ< n#$ *`"Г*`2  4`4"4 4 "Ė ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  - > 2 n>  `0J!$ *`*`2  4`44 4 ""     > >  0*/"А@   `q n"ސ Ԗ" * @*"Е2 6 3`  "А@ `ޖ "`@ 㿘  Ж 㿘 H /f * '  a@" \a @"  \G a2@Ba1@ ? (!1 6 \  L xQؒ00@ #$" \ 2 \ \ ?"6 \  @00@6' x6 x`4  \ @ @   H 0㿘" !&&! 4  Ԑ .  "   "6 Ԓa x  *@ #*`@ 뙔  & 2    &"` * ( 22#  *@ `  `" *`0*@2@  `*@㿐# #猑*@ @">+ @ a2*    @rТ@   ?b ?# !*` ⴟĀ"" #!0ڒ ֒ @ &`2Ғ  ␀@ @  @  @   @  @  @   "& & ␀@ @  @  @   @      "  2 &`s ! r  # @  @  @  @   @       C A&!ј >    "& &`21  ␀@ @  @  @   @  @     `  & @ &`  ?B?< &@   ??ذ?0x & & & '  ֒   & ` K   (8&  @  2 & > -#@ 8&   & &  $@&@`Ӣ# `W- @@2 *`  !"@"! @ⴟ&@ @ ! ⴟ@&@! @ⴟ&@ % 2 `2@q/!##$*` ?# @2 @q $  4 5$ 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5p 5p 3 4$ 4$ 5 5 5 4P 4 4 5 7 : : : : : : : : : : : : : : : 7 7 7 7 7 7 7 8 8 8 8( 84 8@ 8L 8X 8d 8p : : : : : : : : : : : : : : : 8| 8 8 8 : : : : : : : : : : : : 8 8 8 8 8 8 : : 8 9 9 9 : : : : : : : : : : : : : : : : : : : : 9$ 90 9< 9H 9T : : : : : : : : : : : 9` : : : : : : : : : : : : : : : 9l : : : : : : : : : : : : : : : 9x : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : 9 : 9 9 9 9 9 9 : : : : : : : 9 9 9 9 : : : : : : : : : : : 7㿘 <""> >| !ؔ"@ H 0"& 0 0 ?& 0㿘!@m!"$`(a6"@ aAa$`8a @j 4`p$`<$`8?*   * >  ">?bp@4\ $ a6"@a4>C `F>`6  *294`6 4`F4 `3, `/,`:4ځ㿘` + 2" "   5 ? .  Ѐ` "@g `$   `  x 0 @> & &`h> "d*` &`|>!(&` + `l  " `  @f#&`&`@l#` &`&L I  &`>!0  `+ ` "@ a(, ` =@ `  *```4 * ` ` * $`` .af&`.ag.ah.ak.aj.ai&`&` 0#\#`    @  2`>!@0˓,   S,, * `* @` " >@ 6>!h>~!pai? `.aiiaiaf .af ,`" af iܐaf0> ! `ai? `.aii̐aiaf, .af , * `* @"`af 2#`iaf#`#\    @)  2ai ? `.aiiai, @*``@*` af .af ,` " af `iaf` `@ Ő>!0B>F &`0&`4`0 .` "@eі 8 0 ?耦'?2 '`@2' @)m ' s   '@eג" @)[ al>L`mt>+"*ms@ `    㿐`0@kc > "(`&`&`L  6`6`&` l&` * "@ 2!`БH /d * %  `Β g& `΀ >`>"``А 6`#\#`   @g   ! !i? `.!ih!i, @*` @*` !f!( .!f *   " !f `Bhɐ!f`B`>N"6`" @ >"(C6`>>"@`А#\#`   @"  2!i  ? `.!ih!i, @*` @*` !f!( .!f *   " !f `h!f``@ >"X`А#\#`   @  ,    2!i  ? `.!ih`!i, @*` @*` !f!( .!f *   " !f `hI!f``@ >" 6`6`6`6`.`.`ݖ <#*`2 `}2 `А#\#`   @  2!i  ? `.!ih!i, @*` @*` !f!( .!f *   " !f `h!f``@ 9>8" #``Д #\ @g  2!i  ? `.!ig!i, @*` @*` !f!( .!f *   " !f `gʐ!f` `@ >"L6`ΐ`0{/.`ǐ  `>`ؘ9"``ܡ*`ݐ4  &"#\>4 : "#`А#\#`   @  2!i  ? `.!ig!i, @*` @*` !f!( .!f *   " !f `gi!f`"`@ >I#P `ݐ`֒`淠 ?泐毐`И#\#`  @  2!i  ? `.!ig8!i, @*` @*` !f!( .!f *   " !f `g!!f`" @ Y>#M6`Ζ    ?#@`2 `Ԑ  " `Ԁ@  `ܑ2  `݀ ~}`~>#xH 00&`$"  @&  > '9 26`` @"$ 6`  fĐ`ΑH 0? 0  > 2 * " ` `` ( ("` ( ("`` `"`㿘?2  > b  6  b. @ >#Ȓ`a 㿘? 2 >   @2   * @  e`f@"N  m@"Ve e@3 0  h@3 0  n@"`g@N 00 e@r 0zy H /d4 * %  x"H 0b  l!\  `& *`` &  x K ΀ G E4 C  "  ̐ 4 ?# @4 ̀2 1 w + ΀  ` 4 Β@?`4# @  `*  * >E bD@/$   @ $ N’ @㿀 ?>  6 2  M * @G΀  Т'  @b" ?'Ȕq@b%"΀  )  `6! . @  "   *@$ *@$  $㿘>E>"D#@ G㿘>E>"D#@ G 㿘?2 >    2  65?* @`.  `*@2 ` r 2!?`, @ ?    `(@ 2  B @e=  `  a ??< 㿀 D? @2 > `@"2` "*@   p &   (@i> <  t& 4΀  Т'  @aC" ?'Ȕ@a`"΀  "  < D  " < N& 4 Nw)  $H +!l >  .` 0t.` 0r 02 .`  .`  ݐ?.``.` .`   ؐ?6`   ܐ?.` 0Y 02 .`  .` .` .`  .`  .` "6` .` .`0B` .`  0   ` `  .` &6`   2 6` .` ` .`  (@g.`  @gQ @g.`  @gI `ܴ6`  (@`  &` $@`*   = .`㿘` ` \ 02g !f 23!f @\  2\ !f &!f  !f a 2L !f > !i!i az 2> !i >!f 2 2!f!f 2?>  .!f!(J , *  * @@. l     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@㿘!f 2?>  .!f!(M ,`*  * @@ 2$>y 0("(& (?"D l 2`  2 * D   p`+   @ H @_-< 2"<> ] @!f`.!f `- *  * @"`!f  b!f &$($&(( "%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   LvN`0@  㿘.`*  h*  ,@P2!ka !G* !k @g_ !h.!k`  .!h08>0E>0@` `  @>>א h@ * h2 *` h2 *` h2 *` h =*`  h *` !g  .!g0>0P> @` `O  @> @  㿘!h @ h B B  a ?  B   `  ? @ ? ``?  @ 2!h- @!g 8!h" @T !h !g .`*  * @`!f "    "!fx   @c   = @   *@ Р"@ `Ӑ ` *  h*` h2 *` h2 *` h2 *` h*  h*   hs ? $  h   "& h   @>  h *`  h  b@O ?  h  4 >ِ  *`  ޛ 㿘!f` > ג  h *`  h  b@$ ` h ` ? t   ` 0  2m !g?.!g"Y!j&` /   * 2 *  `@*    ; 0 "`0J "5!iF  "`4`0`0("`0`$`0* "`@`0`<`,@^`H  0`0 `< `@ 0t" 5`0!f!( .!f * " !f 2 `ΐ!f `ʐ!i .!i` ? @ &` ?  .!j!G* !h .!h   4@( `2 !h!f "!h`!f!h!g!f@!i@ @ ` >  $  >(>>! >!@㿘`"!h!GJ@ @ee !h.!j.!h P ">!P !h  h "!j㿘 h ` @ `  @>a` ? >!Ԓ>! `  *`       Ő @“-  @ !g?.!g  2 "$  `$  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*  `@,@ &$ 4`  @b 4`   @b  @d `,`  ` a >"@,`  ( $`!j ?  .!j!G* !h`.!h8 M   ` "9 ?`0`A 9 ?=   0`0 ($`4$`0 $* $`@$`@ ,`H@\`< `< 0`@`0" s[ !f!( .!f * " !f _!fܐ  @$ !i`_{.!i  @$ !i .!i 4 4`4 㿘     #>a 0  D> `!`a@  @  @  2>>!!` >` !` @zƐa"  @r >! > 2>> ">"0㿘` ``?` ?`@&`!i .!i`?&`!i?.!i? X` V `$ + ` `("  @ &`$&` &`(``   @a ݦ@a@c ܠ@c͐@*˒?- ` &`  .2 *  `@.2  .6`  Ԑ ?6 `` `ܠ" @a. `@c `. !j 0?. `  `` = `&`@2( ` 4$  &` .2 *  `@.2  .&`!j ?  .!j!G* !h`.!h  0  H /d * % !h!G!g!f ۨ!iؐ!(ۣ H 0 W #\> Ր"8@`y >ΐ"x`$ >? >Ɛ"   , >" $> >"  *@ @c  ? >"0    2  ,  @@ @2 >  " #\03 #`  `40 >! H /d * %     `  @" ?` ?"`    " ?4` > Z"ؐ ? v H 0>+"*!la@ 㿈  ` {'>>"H*`      Q Ѱ  ͑* R  ư     `ް 6?`!?>>!*`  ` @a `݀   * @ %6   @a `݀ 2   0 ~ @a `݀ x  2r   @Y ``  0 @Y0X `ȑH /d * %  #``А#\`,`0 *  * @ `.  . !i? `,!i\!i !f!( ,!f * "  !f 2\ސ!f   H 0 @YN >>p* >">#># >#@>#X>#p>#>#>#>#>#>#> >| (>y @>v `>s >p >m >j >g!>d!>a!8>^!P>[!`>X!x>U!>R!>O!>L!>I!>F!>C">@">="(>:"@>7"X>4"p>1">.">+">(">%">"#>#0>#`>#>#>#> >  >  8> H> p> 㿘\ `& & 0& & & & & $& (& & & & , j j k j j j j j k k j k k k k k k k k k( k4 k@ kL kX kd kp k| k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k k j j㿘 <""> >|z !ܔ"> H 0"& 0 0 ?& 0㿘!@]"$`(a6"@ a?a$`8a @Z 4`p$`<$`8?*   * >  ">Obx@$Z $ a6"@a4>}A `F>`6 ؖ *2}74`6 4`F4 `3, `/,`:4ށ㿘`  2 2   4 ? А@ab@ @  p  0@. & &`h> "d*` &`t>!|&`x&` *`l" ܔ  H@V #?ܒ H @  'ؒܔ  @V H H@VӔؐ H  @>!|ϒ`0@\s H&`&`  9  &`|>{!8   *`" ``| "@ ` 4 @  *@ ` @  *@ ` @  *@ `@ ` *``@ ` @*``@ `  *`ٓ*`|&```h 0&`&` 0 #\#`   @ ` ``2  ` " Y`` >@ ڐ>|h!H>|e!P0h>|a!x` ">>|Z!>|W!` `@ >!|M0P`h   >U>`|C!>|@!>|="0@ X&`0&`4`0 `" @V 8''쀦'?2 '`@2' @ ' d   '@V" @ `>YcP]>+"*]@ `    㿐`0@[ > "|`&`&`L  a &a6`6`&`&a$&a *` *   |* @&` l&` * $ 2!`БH /d * %  @`Β WJ A`΀ >`>"P{``Т 6`#\#`   @    " Y   >{"`;6`">@>;"x{"6`6`6`6`.`.` <#+ a2 a  }2 &`Ԑ &``Ԁ  `#` #\ @  2`  " X 2`Ԁ " `Ԑ@`>"{J6`>{E"А`0l*.`Đ  `>`ܒ{5"``*`4  &"#\>#: 4 { +  " `Ԁ@2 ` ဢ@ >`܀@>` @ >#8 z>y#`  $ܑ+ ``Đ?`ܒ?׾׼`Ц#\#`  @@   " XK "`@@>-#x ``ڒ`י וב`И#\#`  @   "` X` " @>#zM6`Θ   ?#@`2 `ؐ  "  `؀@  `2  `ဢ  ~  }` ~>#zvH 00&a""  @  > 7 26`` @"$ 6`  W`ΑH 0? 0  > h2 * " ` `` ( ("` ( ("`` `"`㿘?2  > bh  6  bh. @ >#`z a 㿘? 2 > h  @2   h* @  e`f@"N  m@"Ve e@3 0  h@3 0  n@"`g@N 00 e@r 0zy H /d4 * % !v"H 0b  j!\  `& *`` &  i K ΀ G E4 C  "  ̐ 4 ?# @4 ̀2 1 h + ΀  ` 4 Β@?`4# @  `*  * >T bL@ $   @ $ ? @;㿀 ?> h 6 2  M h* @G΀  Т'  @S" ?'Ȕ?@S#"΀  )  `6! . @  "   *@$ *@$  $㿘>T>"L#@ 8㿘>T>"L#@ 8~ 㿘?2 > h   2  65?h* @`.  `*@2 ` r 2!?`, @ ?    `(@ 2  B @V;  `  a ??< 㿀 D? @2 > `@"h2` "h*@   p &   (@Z< <  J& 4΀  Т'  @RA" ?'Ȕz@R^"΀  "  < D  " < $& 4 $h'  $  S$ ` *  ސ"@> $ w . l   $ $ $ $ $$ ($ $ ,$ $ $ $ Y$ 0@I 㿘`䀦>vJ 0D   p`+   @  H @Q< 2<> w@ H! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   hK`0 㿘 h  /P j "@0N>0 >0h R @  >S` А Eb@ 2>>u p v uې @@ 2  h#P"6 >u͐ *` h2 *` h2 *` h2 *@ h *` "@0>0P> h RM @  > `@cu 㿘 @VL ` |`x 0 ` 3 "`h`"  & @ ` *`<@ @X &   , *` |*     *`   $@  *"  ` *`2`  `   @X ? Ӡ` @㿘@  4  hBa     ? @ '   ?  @ 2@ @@  2@@@  " h`@ 㿀 ”    *  2`  * @  `*` ߐ * ` *` `  *` `  `  *  h *` h2 *` h2 *` h2 *@ h*   h) ? $  h     " h   @+>u h b@ 2 >t!( *` ` 㿘` >!8u  h b@  ?      |` 0  2M4"H4&` @ ` *` ` `2  *`` 0 0 "`004"*`,4 "`4`0`0("`0`$`0* "`@`0`<`,@O`H`0 $`"!  | 0`0 `< `@ 0fz"  `0&`R` ? @&`4`? 4@ 㿘` ,  l `" a "  `  2   ,  P㿘 h `  >u!H ? Y >!`t>s!x ` @ @*` `  *`  @    @"  ` "  `  `2 "$  `$  @ "   "    @  B2A  <  $  (`"$ $ ($ 0$ $,`$ $  ` ,` ` ` *  `@,` &$ 4`   @U 4`  @T  @V `,` ` a >"@,` (@2` 4` 4`<   ` ". ?`0`0 + ?,   0`0 ($`4$`0 $* $`@$`@ ,`H@N`< `$"a  `< 0`@`0" e $    @$ Q  @$   - @ 2U  㿘     #>t)a 0  D> `!t`a`  `  `  2>>!!`>`!`t@qta"  @i >s! > 2>> s!>s!㿘`@``` ?`@&`` ?4&` R` P  `$ + ` `("  @ &`$&` &`(`` ! @T0 @T+@V @V @ ?' ` &`  . 2`  . .6 `  ؐ ?6`` `" @S.`@U `.0'`  ``` G ``&``@ `   &` .2`  . .&`㿘 H /d * %    | `  @" ` ?"`  |  " 4  > s1" ?  H 0>+"* TŒ@ 㿈  ' 6  0z&  u q m i "0c a  ]*  Y 2S   @L `  X @LΔ0= ȑH /d * %  #`#\ 2   `. . " P   (H 0@L [>Nx* >U"(>R"@>O"P>L"h>I">F">C">@">=">:">7#>4# >1#H>.#h>+#>(#>%#>"#>#>#> > > (> 8>  H>  h> x> >  "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,㿘`  2E >+!l 2@  ?2 &   24 >` 2- > 2 & >` 2 > 2   ˼ ?2` > r` 2    ˬ(?  㿐`     &f   (@#0> > >E>Ef"bመ  ```````6`H&`\&`T6`6&`&`&`&`&`&`&`&`&`Ԁ &`` &`>\>]>]#`&`&`&```(>f&>]>]>]!b&`&`䀊&`>]>]!xaf  >^>^>^!b&`&`&`>^>^!a&`&`p f &` &`f   ` &` &a&e!@&f -ǔ  &f>o   f" &e>\"<&f&e&e  " eД @J` e ` !@&f >pِ!@e^钐( 4   ?  `@ @< @P_ `0'>X  @. 㿘 <8 4& <1E㿘& %Ȁ  `` "> p! >@ p!0` #!  &!! # K㿘&`%Ȁ`2" ̐ 4  4 ͼ 4 4 4 4 4 &4 4  ̐ $ ͮ$ $  $ ͨ  $  㿘! & 9! 5!2 >!Ho'  & ``>o!` $  & & & `/@   $   @I  &  > p!$$ 㿘! ! ` >n! " $`   @J $$ $` 㿘!! %#0#P? d& `` ? >!o֒  $㿘@%  4 %? 0%?c0c0 0 000 0 00 0㿘! ` ` @ %>"n !? && 2 2@   2  23 ?#ߒ @23 22 :2 22 2@   *  * @ *@   *@  * @ *@ * 2! &!㿘! !` %Ȑ ?&! ?# @4  @"! >o4" @ "`,!`&!! ] `&&&" 4 !>"@o ! E&! $!>m"X"@  &!&! 7  2   '?   @0 ?c 2 * *  2 * ?c 2 * * ?# @2`*4 4 4 4 4 4  `* *㿘@ %  $ % %   㿘! `  @`%>m"! ?&& ` ` ?$`<@ `"$`#$`    *" T >"xnr  ̒   * @ *@   *@ 撒 >"nU   * @ *@ *` $`! &!㿘! !` r%Ȑ ?&!  ?$   "! >n."@ "`,!`&!! P "@4 !>n"! C&!$!>m"X"  &!&! 5 `   "> )c&>  ?2 *  c2 +  > 2 +  " > 2 *  2 + b  "b > 2 * c "cc "c$ $  `* * ~ ~   8 D X d x L L L L L L L L L L L L 4 h L L L L @ @ L L L L L L L L L L L L L L L L L L L L L `!@: ``@ >_!*` >m~"<`?>lg#> #(* > cH'@  lR# >lO#0!# 8> cHl} 8>#hm+' ? #mE >l3# B', `@2` >2` ??̀ >l #'@1 " `  !>0>0> ?> cH* ( @ '< `'  < `k#` Ñ, &`㿈@>2 a `#ȧ2 J28    <` &   `4& >_!,` , , @, *@,%  %  @@ @ ,@ @ ,@۔ 0`& 0@c @ϔ ,@ʔ@֐V @” ,@@cI @ ,@@   @ ,@@     p.8"P% L  @@ ,@   ` @s `@U  >   > #J p.@  %  *% , %*   %* %* % 㿘  ,@,``2   @~@9 z` 2    p&   l&  h "L   L$`$` 6  $`  @w" $`  $`   2    $`   $`   $`  B@#6$`@X ` /$`?  @  @  @  b@#   `?$`$@$` b#$`$`$`$`@j   , ,` " : 2"5 `2, ) &`` ` `     `    ( " 㿘  `,, `,@80`2 `@@W   `,  " 2` " "!``   ` @`  ` " `!`  ?" ` @ @@`&4  @4   ` ! @ @@`&4  @4   ` ! @ @@`&4  @4   ` ! @ @@`&4  @4     ` ` 㿘`   &  & & & @a&  㿘?.@6`2 `*  ?  & & & & @J&  `2  2&  & & &  ?& & & & &  㿘?.@*26`6.g<  & & & & @&  g 2&  & & &  ?|& & & & &  㿘?#@#@66/ *6`..7  @ ?#  & & & & & @ݐ @ ?2&  & & &  ? @ & & & & &  㿘.2`&`&` >0 >0=Ks  h#Ѐ2 &@` 2&@ &` & ?&@㿘/ /` (`67`7 @20`0+#" "    &  &2&  @@@&&&& &&&&  0    `?㿘@ ` "`` 4` r"@@ѐ "`` $``  2 0`1 ? #$`㿘@`* @ [G >2`F` Z"@@Z  `@2 2   @& `%@ Y? @`@"` ` & | "11 #`,`1?*@㿘@`* @X >M'@2`&J  ="@@C  `@2 @ 5&  @& ! @( < `@"' ` &   ?1@&1 & 4@`, &`1?@*@㿘@`* @ Q#@2`&<#@  "@@ @`@2 %@   @& $  `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@  @㿘 >>& &&x&f#㿘   ,@ ,@   2@` $` 2``        `) , ,0`1 4  @ 4@D``  `) , ,0`1 4  @ 4@D``  `) , ,0`1 4  @ 4@D`` `) , ,0`1 4  @ 4@D. ``c  `) , ,0`1 4 @   4`      㿘 ` ` `@A`` ``` B : 1" `! B  +`"   B 3`` `   b`    B @ b`+` @  B 3``@ `   b`  ` B  b`+`   B 3`` `   b B `&    b`+`   B 3``    ` ` 㿘`r  # ####2 `_    `?  `$` ` /..(@7660@##### 㿘` ?    ?`8#  ?@ 7`  6  .//@67@/` . ` 670@./(@!#####?   LL        9F (fɀ  ( 4("@`%>+l *>!> }!L@E.!> ! !L(> $ H,"`$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ t >А!H"@>@E!!> $ i   @$ l z >@#  @/>@` >d2 >`@G 2>d( H  >d" x$?>d  , ,  0Ԃ`  ", > d ?P@@ ?, ,  0Ԃ`  >c!0@s?p ?p`>"@@!x 2 >@>@Ja 2>>cސ!@a 2>cՐ!> |?* > |"""l  > #=@`?P ?P*㿘!> }"T@Dq!%> ` "T` @   L -} XL`>L L` @ / 2*@*@L @%? `L , : `L :2>  L?$`L  /" >  L  /2 > $`> ``  "` L / ,@  ` +L -  L c">  d  a" >   s>  bX "bXbX$"bX>d;! bX "bX㿀!>+!l 2N`>d*"0' (''w`J@ ,!l`oJ@ ,!l`g!l N@ x>@N` d2>>bb  > ?& & & `" N`>( d  #> ?`& & &  $`N`>N@ 0 d  `&  & (&  i l'*`N` e#*`> ֒b8!>  ?& & &  $ N`>N@ 0 c  & &  & $ :  sN` d t r> ">  >E & @>>b  !>  ?& & &   $ >#b@>b8 !>  ?& & &   $ >bH>b8w !>  ?& & &   $ >bPi  &  & & $   >b7"X> !  LJ 1 :  : N`>N@0 cc D> &  & & " f@N` d*`>b />  & & & i"༑*`:  l!*`N` e*`>b !>  ?& & &   $ >b  &  & & E$ :  sAN` d t r9>b #> `?& & &   $`>bP `&  & & $`N` r  >b  >N@0b Ĕ `&  & & $`㿘>b"N >> "b  "b `>"b`a N 2 >b"Ё>  㿘>+!l ,>    '> }!H@ ">@BB  >"b_ `"?@` &` &@L *?Ѐ &@ $L 0` &@㿘!> !  > >> #a $ > !.  @_ > "X$#>+pal W >,bH 8 > #L@,  &> <@ <@ *`: * @bH *` > !Ā@"  2$R  $ 2 2 >`ϐ#' > z`А ''> | "c>`#8al al@>@ch>cx al>#` > @>  `x>k#D>"c''IȒ 2al>`# al_ al W H o@H/ />+"@A,(@5H 0>+""㿘> }ѐ"T>  `> }*`"4@ ` ``T@㿘>`K#ȝ㿘@Aʒ#@Aǒ#1> '> a}"@C#耢 ""#@A""@ "@al .,@"㿘`> a/# 4  0 ">>  > 4a# 㿘1> "8 2 &"8@c 2&"8>` 㿘 " >`0@0ݒ @L > 㾘!@@>`H@!?#>@ch  ch@ >`P " @B  >> `8`͘   >> 8` & &@Aڒ &  ,p>` @ ? &   >> 8` <  & (>`@ @?" 6 %>@ - E  (@|4  *@*>+!l 2> > ##ȓ* *$  " , ْ    >>!8`U <  &!0>+!l 2? @ "@ ?  ,  >!0`< 㿘` `?P'>+l 2 > >>  `S  >>@H`0>   >> "``l 5 @?!D>#x'5>k H @?!D> }>"Tb8'''G 2>>^ސ"!` !`''G  2'0>>"@!tl &@ 5> >ch@>cx @?g!D>k''''G @ >> > @?O!D>#x>k''''G >  ` `LJ ">> " b@” > "`@ʐ>va> } "aH>^k"> }"T'h >"_l^['o  >kGe 2^IL Sl >>#h@  @n>cx ;>`0@d   2 )1 ">b>b > !> !` "`> !   >kH 0+>k'G  @P l`!>+!l 2'? "<  "<@ >"8> '''#]ђ> z А ' 'Ɛ耢 "!l:? 3>@!l`">b8 >]# @c8@? >`@ ( >@>b > #@]㿘>+!l >0 > ! $ > ! $ $ ^#`v >    " & 4%> !`0$" > ]S#x`Q S>` $`$ @` D >#^M`>#^G Ȳ )@>4a >]*#>0> > H]#x 5> })`@"X@?C    >X @  $  $    >\ ^  8㿘>+!l > `] >  ` €> 0 ] 㿘>  `€㿘!> "˖ ?" ".㿈  㿘>  ``@㿘>  `@@㿘 >ch͐>x P  ސ >>\  0g %>#h@= >X`P  >P`Ȁ ǒ 2 > 㿘!>  ` >][  `@  `@ 㿘>  `€8@ 㿘>    8 |@= |€0@0>  ` `  @ >> d]K &@8 d]C&@&Ґ  @  㿘>+!l? >   x">   t㿘>+!l? >   x">  `d@>[Ӑ!㿘>   l㿘 X ? >!   >"  0>+l $ ``N  sl` 4  l@  l  2 @N  s2@a @` `"$`x> + > \@[o!  ` G 2㿘>+!l<x> " 䀢@>! ! @ > "  Т@ * Њ@@ Ъ@@> >"\A"㿘!>!8@<!$!P@<!<*> z Ԓ*@> "`> "  Ԃ Ң  Ң Ң>x `>"x""\"@㿘!>!8@<}!$!P@ z Ԓ*@> "`> "  Ԃ  Ң Ң  Ң Ң Ң> "`"@T  pК@ `к@>ax  "aX"ax>[ː"㿘>! ! @> z > ?* > > )" "!" @   ТA0ТAЂA  @ @ @W :>!l !$ >a "a>Z"  >["㿘!>!8@;!$!P@;!<*> z Ԓ*@> "`> "  ԂԢ>!$ !, @ 6 !< ТA@ @  >!<!D @ 6> ТA0ТAЂA 2 @ @ & > >"a[K"㿘> z>>  "?* > "  ҂ z a   6a Т0ТЂ 2  & a { Ң> >"["㿘#>a$a8@;a<@;aP*> z Ԓ*@> "`> "  ւa,  @  > ТA@ @ >!<!D @ 6 ТA0ТAЂA  @ @  ֢&Ђ >>ZԐ"H> >"aZΐ">  >a  > z a8  Є Ģ0 aa8 a  Ģ> ``>+l"`* * :`> 8  Ģ@@> >+l"* *`* *`:>a> z a8  Є Ģ0 aa8 a  Ģ> >`  Ģ0 > z8   Ģ 㿘%>l =)> z > @`4 "@: Ѐ  .? $ Ц Р?0" ,?   Ц? 0#@4  6 6 | `?09>>    8 "  Ģ` > ``>+l"`* * :`> 8  ĢB@@> >+l"* *`* *`: > 8  Ģ  >> z > `:? "` Ģ? 㿘㿘> z`>   %> `Д@ @9"4.$,? "  ТB?@ 0#@4  ?6 6  `?0#@4  v6 0_  Ơ  ƠƠ㿘Od>> 8? ? > @2@>Ä @@ o ??  Ģ> '(2   ? 0 (  > '(2`  ? @0 ` `?> '+*  㿘C D > ̀@\ : ($$ D  < p( $ 0$ <@q >""X H6"@@ @FC  Fv % "  0 $ 0㿘( H$ D@@    < p( $ 0$ <@*  0 $ 0㿘" @`@ *  1>"p!W &`&`X&@ `"&`(!&`,!&`0!&`4!/!`p `< @ B  &`8!<@5ڔ 6`p&`< 6`r!6`B! &`D!!6`H!`6`J 6`&`&` 4 $    4 *2  @ B $ , > (!(  ,   , 4 ``ڠ a 2 " 2 "*   gG#ꀣgG Ȓ @  @`@  gG#뀣2T ! @  @`@  2F   a 4 $    4 *2  @ B $, > (!(`  ,   , 4 ``٠  gG#뀢@2K6` `  * @* ,`  `2`96` 5 " ,`,`` `*@  ""``  ` ``  ` `   *    *   * * 2* `ڰ?6`BC6` 㿘 ("2  , "  0     H 6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`6aa  * 5   > @ B@6@ϓ5  @B@6%`%` 6"6a !!  B 2 !! B ``  ! * 5    @ B@6~@-`5  @B`@6h$``"@`ߨ    `* `*-` ``2 ` gG#a`&`@  @`@ b&` @ 6a@`@ 6a **`@ @  }*  (@ 6?㿘@2  ?6` " ` @6&K&` <* & 2  㿀`    2` 2`> ( ?a8  @` 2  ' 4`H*   '* ?@   2` *`: '2`  ` '쀢 4`H*   '* ?@    @Y'4 D2 D *``='`* 8"2   ' 4`H*   '* ?@b  `` 2    $  4`H*   $ * ?@ E  n` =b`.  X T @?77 H4 `2 D | "2   * D"@1D012   * *  " `H   ` 2    * *   " `H  ݔ  㿈Δ  2 2  2z 2   ' 4`H*   '* ?@  `^ 2` *`: '2` `  '쀢 4`H*   '* ?@    `5 2  `? ; `*> €& # `쒒  2   * *  " `H  Y `    @   ?"@ ? 3    + `,+?%  $(,048< @?܀        ? 3 2 + ` `2i `? 3 + ?# 3  3 㿀`  ǔ /7  '  '  @ @  @ @` @ ` &  ( `"@   ?& ?# 2    *`?, + ??%      $ (, 04 8< ?@ ?܀        ?     ?   ?  ? ?# 2  ? 2 *` 2g `?# 2 *1?# 2 2 㿘 > > "S:b> > D"  > bH   "bH>R" > "D"H㿘!>  3L )> a $, aHo *"` q  ( aa a J` 5*` 㿐!>!''€ 2  > > " Rՙ3   ?p>>#HR˔h>Q#؁㿘> (! !> +: " >c Gf > (!@  :" >c G[ > (!x >:"  c GP 㿘.&``&` > +`G?` H/` /> "L: > "P.   € > (> Qg> (. !@@0020"@&`0H 0㿈>+!c. !@6` H/` /!> "L: > (!.   > H 0%  q8P .  " @(R?'"  N@@'` "L *@ $"LH 0 㿈>+!>+. al!`>"!X>"!" :?).   (R?'H/` /  L@&Ԑ  `> L **> bP. "L"@ H 0 < L L L L , L L L L L L L L L L L L L L 㿀)>+!l 2 >6"`4 ?H@ !l ?H?L I>+"> > "a Q+> z`'>  > 8*@ Q2`@  @ %><*@   >P} P@"#> (>Pt pb0  `> ("4N@1 d$b0`@2b02 @@22 $b0 0' #\6 !l> (!> !"b(??$!#> ?0$a   4?#`"  #\#d Ҙ? !>P. !> a  ,y > (`"",>P   a !e" !@a >P >!#\  F > "a>P!``>`!0*@ Q 2`D㿘O!@!< "!<`@2 " ?   ? !H   $`!H ?&!H!D  #>a|^$a|P *&!D@0| P$a$= ?c$$$,$ 8 `$$$H&㿘`%  >+   -0 -03> (b8)^b8 b8  ǐ 0!l> |#)r> 0 (@! ! ``H`@'@@ !*@ `!!#!  @@'X'\'`'H'L`'d` 'h@*@ 'l`?P'p`0't!  ? 0'L'Dx#UD?@'{ HΔ  ?@ǔ  "; 8`$`H$`$`$`x@'[ ") @ "+ !@$ <* @  ## # # # 0# H؀  (a  a ?"a ?" @&!?㿘>+" ", +>6h>  ""X> (@ > 0` >  "`/"@(>WOѐ!PH/` /!>6@o>6! # ` ">>O!x$>u!>O!>O!>O!؀  >  s*bɔ  @> "Ȓ d*  -> *"Ȑ"* > *"> "ȝ㿘> )"d(2 `*`> !"   * @ `> z ` ?,@#I> `a,  * $ $> (> ("bL"H>   Н㿘>+!hQ3> )@bd?> ("H %> (L bd? 2 2 > `O7!bd> !2  `*"@ `*` @> O'"?bd>O!" 0`2` `*`" * L> :O"8@#@"> z`ؒ* :  >D O"@> "H> B"   > z Е=`  =` D>N"H @ :/ "@ @8> z ?-@ >"PNۓ5`!> "Ю@- "Иbdƀ"Р>  ,@Д@  4`  D@@ ֨   " >{!T,  >N"X0>N"h0>N"0 >N"0 >N"0>"N㿈>N">N"؀`%> z 0> <"  $ ( ,#\ 4#` 8#d 8Nw#h 8  4@4 " 0㿘> ̀ 2 ?x" ` > z Զ8@&> z Զ8 ̶ &@?@">M6#8#> z>M0#H` >+!l @. . > #` `ж&@㿈> 0 `">>`8N#`#> zN#x#> z` > ##\   N  >N# > , #M` *@> 0> <#  $ ( ,#\ 4#` 8#d 8M#h 8 2`>Mߐ 0㿘N@  t>0``>0>L H>MȐ X0 MŐ h0 0M 㿘H/` /> 0 `2a<>+"` ڒ$` H p@ Xt? 0        㿘?  2 @ʰ #> b؀ "> $"ؔ"ؒ!( "؀ >!> ! `$b><> z!`$!! 2`>LA    ?` ?&@ &`>L1 2 @` >"<*` ` @C #> z`> ,`!>   a$'> !,@ ` `Д `"@ @8!  V!`А,@@ ^`` ?G#@> z ?H @ > "@ > "@ : @` 2 @"@ @ 8  @@ 8 `@?  D &` = &`: >+!l   q` #> a > z В  z $a> z  Ѐ@ 8 a `  "]@? 2  @ !> "؀ "* $"؁? -*`" ""   H o"  p ""   H>+l   㿘>   "  @ " @  㿘#   &, ?㿐#@2> }!H &`%> ܀@> }!H@> H/` /H p@  $>  0  c'@'  #@Pc@ 0c@c@p 0؀` Ho o €H 0 @` &   'Ho o  H 0Wp`r]  V |Ho o  H 0 @2b aC`E0 2VHo o €H 0@+= @ $&  4"> Ho o €H 0> `& " Ho o €H 0> ""& "           Н㿘> !@㿘><> z!> z! b а >!x  @ ߐ @P 㿘><> z!Ё㿘 `#Ђ   ? . $$Ң``  ? 1?`  ?1?** `  >?.   I 2`( $(2`  ?(:`  㿘>  ,0 Ҧ`z> l`  >l*             ""@ "@"㿘 @   @$@ :`$@ * `$ $@> (> "@"@㿘> %> ""@  뚐#> $bHϐ  >I bH> " , > z  2@ bH "#> bH > ",     @  > z ؘ 2@2 bH > > @ > > z><ؘd02`  2`@8@( (> {x    "# 2`@8`2`?d (> { !x( *` (< #㿘/>+l  > %?> +?"b""2 @> %?> +?"b""@H4*` > P* l`⌀`@Д`> (bd @&>  a? > > !`@2 4  , @ 2`>  ` * ? Є Ф> z Р? 4&@&㿘!Ђ* >`  `    Т@Ђ ```>0 >0> >"@H!>H!X@>H !` `  㿘?. #+ `$چ ` ( , (> (@ ?( @ ( `  `  (@ +  z@???$ ` @  ` GŐ!` ?˰ 㿘?.  @, @؆  " " > ?(   `   @(@ +` z@??  @   G!  ?԰ 㿘?.  ؆  ">  >`* @.`@  z@Gr"Gp"H? 㿐> !X!X( ` "`# "@"""""`" `"&``$.* @ . 2 "22> "4 "4>G5"x `2> >G." ,@2>G'"` "`" "@&& "" *` `$* @`2 >G "ؑ* @@>G#! @@ (`>>+!l 2``"Ң>Ь@>! € >+!l   + * # + * ; >+~>+!l   "Ң>+Ь@>+!l   Ҫ`  Ҳ` > !ƃ# B><!0?(  2: @*`" * > {!x     $  `2: 2?? * > {"@x*`*  * @`<8 @" ($> z О@  >+!l` >  >  * *`: ` Ԫ`> `!`  *`*   *`* :`@Բ@`> !b5  ` "` $`  "@ @& ` & `"&``$.* @ . 2 & 6 6 㿐> .`b"* @ *  $* `>+!l  ** @** ;`@>+!l   Ҫ`  Ҳ` > !ރ@#  B> z><!0?+  2: *`" * > {!x    `  @  `2: 2?? * > {"@x*`*  * @`<; @" > z в`@ ` "` &   "@2> >E#0 !b*`>   , 2``2   >  ""`"  "`> ""8 "@# #> !X #  "@" 㿘 0 6`*  $* @6`` ?*@@= >  !`@ `5 І@ "0?0.?@H /f * ' > Ӑ"4 >+!l Ү@`> Ҷ@`> !Ц@> z В@`H 0 㿘>+al  0 4H /f>* '>؀   Ԥ # "+<`@@"ܒ??""܀`> "">  ԕ,` "@!l al@    `0&`44>+!l#& G&  @>! $    ?>+!l  `> ``!`Ъ` > ``!`в` ? 2*>+!l ,,: $*` *  аH 00 !>! ,,` Б: @  z@">! "Ң`H 0㿘#>+>Db#Pal &"#>a "a"a "Ң`Ң/>% @>!l    >al ">@>!  Ҫ@>>al   "Ң>Ь@>`$"`؁㿘H /f4 * '    H 00 @ " 4 *` `$* @4  ?>C#`*   > !`  2>+>Cڐ#!l 2< <  | *i$@ % > z"$`x `| X2 `?#?#(M` Ҫ@>!@`  Ъ@@>+l + 2  Ъ@`l2  в@`l> z` ء<  < ?,`6@ <` @& @,@ >+!l 2< <  | "@    $ " ?$ 2l @H 0㿘H /f4 * '    H 0_  @ P4`*` $* @4`` ?>C)#* @ > !`"6  Ъ@@@@>!@ Ъ@@>+al  Ԫ`alԲ`al> z` أ<`  `<` `?,@@ 6 <  , @2%  @H 0㿘 , +> "L`  "`> & !p&     & &   ?& *  "& ` "` &  ?A& > bL`  "` >B# 2  2 > "!p?   !   > `   2 > bL`"`  & ^㿘 ` ` > bL` "` & & E& B& > "L` "` 2%! " " ! #"L `& + > > ` "L>  "!> !p> 2>B##Ѐ""" " " &㿘H /f4 * '    H 00R" G"``_ $ > z"$`x ``|*.@`" ?#(?#(!@"Ң>!@ 0 Т@` :  ` & *}``  $` "@` ?$` @`2`"H 0㿘SH /f4`* '`   H 0C "` `4 2 >#B"" Ң pҢ`  2 `<    @>!@ p Т@` ?|2%` "H 0㿘 , +> "L`  "`> & !p&     & &   >[& *  "& ` "` &  ?A& > bL`  "` >A# 2  2 > "!p>2   !   > `   2 > bL`"`  & ͔ 㿘 ` ` > bL` "` & & C& @& > !p=- > > @ L `"  ` 2" `  "L `&   > ` L" 2 $$ $  $ $ &㿘2 +l  "@@@@ l `"Ң> Ҫ@>!@  2 >+!l  "0@H 0㿘>+!!> z$ C >+!l : > "a@@㿘>+!l'D'H`'L` >>  "!H> >  "aH>1> &">7> &$>9> '!,)>#> "<+>`> "T->> "/>L> " > ("d> "`>>>!>#>%>'>> > "4`4!cXᨠ"cФ3> 5> ;> > > > > ?&b&D'c aD!# h  "` 'L " "`+> >  ,"`$  T> > , b@ #"  ?> ``, * b 2 ?HLL> `*" > * "b@ [!>D$ Ԧ%`,*@7> X" &X> "4""4"`5> " &3> z` @,@`> "4@ @4"5@> "(?> "@`,$    $ ئ$ &$#> `@>?"?"ܦ >+l`4<`  <` ? `,> !`, $#>+   `? D4`   D  6 %D&%`% `""`% > `D` % `""`> "L0 "0% 5 5 ``? ?%@5 * @2`> !``? ?%@* @*`   - `@` > a*  @`А Ф@ @ L>5 %X`% `""`"L,L ",  >  ,  @  > !H <`   ?#8  ?>+al > !`Ь@`!`д@`@  > >    Ҫ@>+!> +@  #Є@ Ф@> z Т@@ `㿘>b1> &">> a,5> &$ 4>>"@bh/> 9> %'#->> >"a  7> &,> >>!>#>%>'>)>+>"`4 > > > > > !cԤH xb|> 3> ;> &bD'aD c!!h <#aT"" > ," "$", `@"(> "@  T3> b> * ̐ " "@  ?* * b"@?#>> ``$`1> * & ,$@7> z $`,>  , "l , @ 2$`ВT !> $"0$@ 9> '!0$@ 5> & @$ > ,"0" $(: $,``z( $`+!0 ,-``$`(-`@ 2  cz@%  2  > >ɐ @-` b $ -` - @ȓ*`  ,2 @ , z@?$@ ``̬ c ,> "a4a4"`D> "(> ?"@ ,%>    # خ% &%>?!>"`<"`ܓ4 *` , $* @4  !@  *> !x2`  > al > b >+>+! > Ā >+>+!l <  |< @z@Р ɓ4 #>ax  !> g!l!l>  ."@㿘 "Ң!   $Ң`I Б2  ?!Т@ $Ң`㿘>+!l   >  P +> $+. 2   #  !% 2   @ ! 2  ,"@  & & Ё㿐> > !p`X#\   8x >+!l !> ("P> > "``$$  8h#\> > #\#`p!! 8^ 㿘>+!l > !l ҂`>!x  ` > "> z ؒ"@ 2@ @ 㿘> z@  > #@@ 㿘  "P @@8 @ " I++& >+!l& $ & `&  & !& >  8ϐ"& (& ,  (*  z$ ( > *  c#z> & 4㿘   ? & @Ò "㿘H /f#>+* '#>+al    "> <#    > < H 0 "al "al   >   > ; >  (9#"& ,& (  " 㿘 V>  ,> "> ! )>+!l  "0@H /f@* '@' !l6` ?`6` * ** :`* @ **  $* @ ` @ !lH 0>+!l  "0@㿘)>+!l> ` ,"0 @H /f* ') !l6  ?`6  * ** :`* @`@** $* @ ` > "@ !lH 0>+!l  "0@㿐. $* @@ / @ `  Ҫ@> z ؐ&2  >! €t@!l n@ @ h> z2a  2><>!@><!0?,  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`<<  @" H /f * '  ܔH 0 Ц@> z в@@ `',>+l ../ / >`@>   Ҫ@l > !`Ю@`!`ж@` c ?, 㿐. $* @@ / @ `  "Ң> z ؐ&2  >al q a€l@>!l e@  ?@* @ [> z<2M?>!@><!06􀢠  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`< > @"  ? pҢ`@ ?*   z> z в@@ >` ,`㿐. $*  x / > 9ސ Ȭ l ;> > 9Ґ a`@2~>+!l 2>` >`  | @a@ X> z2R><!0?,  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`< "H  *  H 0$@> z в@@ `- "% ? , ڒ "$   Ҫ@> z ؐ&2  >! €!l @   Ъ@@>+al  `al`al> z` أ>`  `>` `?,@z @ s> z2a 2><>!@><!0?,  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`<<  @" H /f * '  H 0 Ф@>+!l 2<` <`  | "> z в@@@ 5->+al ./ ./ >`@  al a`Ю@`ж@` "%b ? ,  "$>+!l   0@"& 0 4"& 4㿐.$*  `  / > 8[ Ȩ  2> 8O "Т@>l > z ؐ&2  €k@h f ?*   ]> z<2M` >!@><!04 􀢠  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`< <  @"    pҢ` ?*  z> z в@@ >` /- >+!l  / . ! Ң``/   z!> 4#% ` ? ,`  " Ң`(.@z@@) "`#4$@㿐` <@` }0H /f4'* ''    H 0 0Ҋ@' ĺ ? 9> 5  - $* 5  !@ `?` -`!` @ >+!l @= M |J= @Ӓ "$@ ? - ʒ "|$    Ҫ@>!@0  Ъ@@>+l *2  Ъ@`l2  в@`l> z` س= `= `?.@І@:  @ Ц@@`W>+!l 2>` >`  | @L">  ,2> ,` Ҫ@>+!l > !`Э`!`е` `Ð ?+-  >+!l !`Ю@`@ж@`@[ "`%@ ? - O "%>+!l   0@"$ 0 4"$ 4> !p3ޒ 2A & && Ҫ@H 0 㿘 0< @H /f * ' @6`*  $* >+l@6` ? ** :`* @> 6i 8 ` + @@ ` 2`ز> !` 2l @ >`  |>` @Ɣ@*@"> z в@@@ #  Ҫ@@@@> "L$   "$(>a "(@,Ц@> z в@@瀦@0  Ъ@@l *2  Ъ@`> z2  в@`> zlЀ` >`  >` ?@y*҂*@Т@ @ o@H 0 @㿘> z` >  ,.@  !!`  @6`6` ?H / * ' *`  $*  2  > 6ǐ!H 00 > > 6!@H 00xL`+  "`  > !`  >+!l  >`  |>` @@ @Q*@F&@@@   Ъ@@@ @=L 2+>!@%Ъ@@>+l *2  Ъ@``Б2  в@``l` >` `>` `?.@@ @L.@ @H 00 L `" H 0㿐` <`   0H /f4 * '    H 00z"҂'f  6` -` $* 6` ?, `?,`   "Ң>!@ pҢ`>` :` `   z `2>  ,- ,-` ! Ң`, z#>  1c% ? -  " ( "Ң` (-`@z@3 "&1Ԑc> !p1͒ 2   ?% %%"ҢH 0㿘> 0 ,> `l` `%@"H /f * ' @a>+6`al+   $* 6`@ ?+ + :`* @> 4R 8 ` *@  2ز " Ң)> z  '> L$&: @@"$>` ?* @ @ L (`" (  < >!@ pҢ` ?*  z в@@ޥ>` @H 0"㿘.> z > `,>  l .@  '> L` "`H /f * ' K " Ң<  2p>!@p Ң`"  ?L` "`|H 0㿐> !H >`  d  (:> z>< ؆a06  2: *`" * > {!x @   @#@   `2: 2??* > {"@x*`*  * @`< > z ?6*   @>  ,  @@ɚ @㿐6`, $* @@6` `?6,`@ H /f * ' 5> `@"d@ 6`#@   H 0*0O ><!0?,  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`<    Ҫ@>!@  . @ J@` )> "D >6  - `? Ҫ@>+!l Ю@`ж@` > !?@ Т> z В`@H 0 㿐(66`*  $* 6`@ ?H /f+>+* '+>+al   0 4# 2  :  & & 4   & 0 2" "   "H 0 %-  ?> !b4, @@> ! "*    H 0 q$@ ,  - > !`  al 2>` >`  | &    Ҫ@@>!l @   Ъ@@al  Ԫ`alԲ`al> z` ؑ>`  >` ?* 6h #@  H 0 < ?& <S ><!0?,  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`< ` >!@  , < & < @ @> !`">+   Ҫ@0  Ъ@@>+al  Ԫ`alԲ`al> z` س>` `>` `?.@@>+!l 2>` >`  | $H 0 㿐`+`(@@@:> z>< ؆a06@  2: *`" * > {!x      `2: 2??* > {"@x*`*  * @`< > z ?6@* @ ! @>  , @㿐@?x*  `@`<@:> z>< ؆a06  2: *`" * > {!x      `2: 2??* > {"@x*`*  * @`< > z >  ,> 6 *` l@ . "@@  @@     $ "  $ "㿐6`*`  $* @66` !@ H /f * ' >` ?* @ 2[ @ <H 0.0eL ><!02`􀢠  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`<   "Ң>!@  ,   7` /@p Т@` ?*  zH 0 㿐n6`,  $6* 6`@ ?H /f4* '  " "u   H 0 "$, $ 2!> #+ 2 $H 0˰   ? z@`崐  (2 , @  z@- @`'@>  +Ӑ# 2 $@H 0  ,   ,  ? z勐 2 - @  z@s >` @  2d  ?@<H 05 < ?q& <Q ><!02`􀢠  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`<   >!@  , < & <  7` /@ " Ң pҢ`>`   zH 0 㿐`x* `  ``> z ز6@><!0+ @  2: *`" * > {!x    #   `2: 2?? * > {"@x*`*  * @`<">  , "> L  㿘 r6`* @ $*` 6`i ?* > !`   D# @@  >+!l 2  "Ң0Ь@@ֆ@) >+>+!l   "Ң>+Ь@@>+l   Ҫ`l Ҳ`l> z` ؑ>`  >` ?* ւ @ `>+!l 2>` >`  | @ > z  ? * *@  &     $ 3 ((  3  ;  > z >+l2*@?+ /@" 㿘 <g & `㿘 <  Y  㿘 <O & `㿘 <  A  㿘 < & `㿘 <  Ԑ  㿘 <ʐ & `㿘 <  뼐  㿘 8> z ?4, <> a4@> z  Ф@㿘)>!l 8 `8츐+> z``4 #!l(`쪐`> 4 4< 4Ф@`Вs>!@ ФФ@㿘#> b䀢   8> !4> > "x ,$b!>!l > z}> z 4!x*  > " 0Ң`bz!> F"" 0Ң`b z@㿘'>  8 `8!> !4> ""#>  !4@`, $> "":`,> "b#>al +> z>+> z` 4al,   3 5ax*  > " 0Ң`z> " 0Ң`> "z> "!> "`>!@"" 0Ң` z@> " 0Ң`> " z@㿐>+!l l " Ң c">  ,><!0  4 2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`<`   !   " ?  0Ң`|<2> z>!@> z в"0l@@ Ъ@@ f &><> , !h!0?,  2: *`" * > {!x @   @#@   `2: 2?? * > {"@x*`*  * @`<`   簔 ,2> z>!@> z в @> ,2$$  ` *` (`"8> H@:88> " "@㿀> !H  0@* 48'   " #`#\#d ??㿘>+!l  >Β 0 >Ң㿘 $H /f#>* '#>`0   2a0 >+!l  "Ң0 Ҫ@H 0㿘> "H>+!l*`  @> !`> a * > z ر<㽀9>+!l   "Ң"  Ҫ@"#ʦ 'Ҭ;> z``)> !l* "H?$'`# # > !`  "H* @# #  > "%@#  `> )"d" `D 4@  @#  `> )"d" `D 4@  ?2'"H -!l> ",      ?? @#  `> )"d" _`D 4@"H> !l C/> ` @2>+!l  `> `> !Ѕ' @#  `> )"d" ,`D 4@`Ф``@!l>+!l > !` Ҫ`!` Ҳ`耣   > ) "d "㿘H /f * ' > z >a.€ '>+l  "l@l  "Ңl Ҫ@l l>  ,J   H 00/ 0Ң`{. 0Ң`{l 8>ք H 00Ф.֤>! €l  "0@H 0㿘!@f P 㿘!D> (` "h>!|2!D  !DS!  㿐'> z`  @""` 2 >+" "`&&> > ! aP*x > (#p.  > !)^%>0  2!<>  !< *6$!@  "' q 0,   0& "|  $ 0 (>  "  0   0 &>  ?"? > )" > > ! *aP'    8> !#* !`' 0> ) @ "" 0Ho 8 "` `-` " >  "   ԑ 2'`&&     !D  > | * 懐!> (bh!$!D> |# 2 '    ' #>a| +!DQaL$a| "aL &@Ɛ   ` > ` > ({!H`  @  ` "$`> (k!@  H`  @ h `X`` @ _ ` ?> (K!`$`!H  "r' 4 > (6!!D$|!D' % > )!'   '   `'&& C> (">(" `'&&  !H -$!H("  `'&&    `  0(!@ S  !! ,! *`H@ >!| *@&㿘!<` ` 2 x  xM @ 2??  @$` 㿘U!<" 㿐> z > 0 ` ">  "> !H >  e @ @   @1. 2! > "0(P> 'r" ">+ >'!l@B>+" 2?!<=#@ ><!  0!<$!@  $@  ڒ & @G @ @   ޒ "   @Ổ + @ !<   ``H/` /> > "(""P> '"'`4'`@'     @'  `  0(!@ d  !! ,! *`H@@ >!| *@'@㿐> z > 0``" >   +  `` `Ԑ@`  `@  ` `  g@  > )b]"b$Ђ`  W@#Ђx@ `@.  @` @2Ia<@*` 2>+H/` /> > "Ȓ'> &p"" 2-a<=# ><! ia<$a@`$     "  (@@"'a<   ``H/` /> > #(';"> &)"&0&  0@'``` `0(a@   a!`,a *`H@ >!| *@&p> z> 0 `"a$a@,``0`3   0`0`4  >2!,  `8  . `*` * * T 2$"> %#P`Hؓ,  \C* 22a*`4'' И? ?0 2aЀ &`0 &`4$  `    a@*@`&@&`&`a `+ @`@@&`0&@&`&``` `0(a@ ِ  a!`,a *`H@@ >!| *@&@㿘!@" 0* "" 4 `  0(!@  !! .! *`H㿘><!@F 㿘> z ` . > |" 2&@`6  &@><! @% を  㿘> z `@.@@> |" `6@ ] g 㿀> )" > z #"> z``  8` : H/` / "> ?a@"#\ #`#`@0#d?"> a?a@"#\ #`#`#d@ H 0`; -> !, 7> z> $z#` >+* l '7  > !$>  , @ д@  '>al 2a€㿘> z >+.al`.'0>  ,QH/` /> ! > %7#H 0>al a€㿐 ,)> z $  H><& L`8 $@@  %@`#& H> !, 2>> ##!x >  '> !$>  , @  Ф@@㿘 0@2> z> #Ґ#  H8 $@ >  ,ܔ@><! L>& H& Ll   @ <᨟"@ 㿘%>0 !<a<~QH$`i" !D`"&aD|2 *(  * _!&aD!DV!%% @ &a@~ P& H $"  &   `& & 0& 4& P$  " >' $ $ $$ 㿘!D  #>a|2$a|ݒ *"!G 8 !\&66&(!@~ P!<!D `'>!|2!DƐ !D~!@!"(H ''   '#\#`#d#h#l  !\ #\ #`#d#l#h   &㿘> # 2 ے@ P> c"> #> `> ƒ` 0> # 0  x &`D<  r &`HH  l &`LT  f &`P`  ` &`Tl  Z &`Xx  T &`\  N &``  H &`d  B &`h  < &`l  6 &`p  0 &`ta4  > lc 2'8 ''> ?`0ž@`D* `&`0&`4 "`0@`D`8*  "̐ d@> #n @}!D8 `'` ''>l b 㿘 4#> t`H    & @>  P #G01 @a& < 4`H @8 < $ `8 6 <  @`4 @2     " `4 @  @"`` <㿘`>  #  p  B    *@  2@* *@ : : *2@ :  &  4 @    㿘   `  `  @  `   *@  2@* *@  2  *2@ 2 㿐   `  ` @  `?㿘  `  `  @/# @*   & &@&&``"   ` 㿘?#@6 6`~ ` : & $ @$@&@ ~~2   *  , " 4  "@ ,  4 `@ -` 5``@`   b    88 H'T> )"H@ T ?+T2 7耦(7耢 2:  4`444`4`4`ؑ46'ē4`666A `29`@`@T`*  @@J`*  @@@`*  @T @3T :-`2 -,`- 2` ˰ "ĺ` `"`` ?8   đ. ?2@ Đ"* c'Ā@  .`@    @@ 7'7*6`+@, @?@ْ*`}2 .2, @ ( 6`? #   .. }$$6`@?6"@ #? @ "6` 5  *. ?  @26`5Į5 'T  .  "@* 2 2?. 4@*  *`@T:@̑*  ΰГ*`@     2( 2? + @( 3@"@ @b  *  @    㿘  㿐  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2* J " ?* /> )P=%/> z\%\/> )\ @ E < @   7A2Y    @2 $ ^$ 4@  , ,2 @$ $ +>+al`-?8 -0-?8 - ?$ (` --00 @-a""  Ѐ2 @ , ?$ ( @-a"  Ѐ 2 @`  ,` @$ ( $ +>+al`+?P `-`0+-?P%/> )P@̀'D'H'L'P'T'X@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  drivevectmuxconsoleoffsetslotluntargetphychannelleveladdrbiobpfilterlooprdespFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus ncr53c9x_ecbncr53c9x_sched: not IDLE (state=%d) %s: QFULL -- throttling to %d commands ncr53c9x_rdfifo: bad flag%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d got %ld extra bytes %s: tagged queuing rejected: target %d %s: sync transfer rejected: target %d %s: wide transfer rejected: target %d %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET %s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %d ncr53c9x no nexus%s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] %s: unexpected bus phase; resetting DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled leam7990_config: weird memory size %lu: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook%s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d rdWARNING: no memory for cfdata struct rd%drdattach: device name too long RAM diskfictitiousMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUTncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_done: sense asked for sense %s: target %d, bad status=%d %s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? ncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... ;n vAMaX ֣d° xrndrdRRIP without PX field? ..RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_1282IEEE_P1282RRIP_1991ASPittuuLuTuvLu{TP(n{xcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] ..cd9660_strategy: spectag VT_ISOFS, isofs vnode OpenBSD#!/dev/fd/%dCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2008 OpenBSD. All rights reserved. http://www.OpenBSD.org %s swapperfork initcfpendcannot mount rootcannot find root vnodepagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodoned/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d initexecinit: couldn't allocate argument spaceexec %s: error %d init: not found no initfileplfdescpldup2: fdallocfilefdlockclosefkqueueplknoteplkqreadinit died (signal %d, exit %d)reaperwaitprocppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: locking against myselflockmgr: non-zero exclusive countlockmgr: pid %d, not exclusive lock holder %d unlockinglockmgr: draining against myselflockmgr: unknown locktype request %dmalloc: allocation too largemalloc: out of space in kmem_map%d, $$physbufphysioprocinit: mallocprocplprocessplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0plimitplidle%dfork idlesigaplpauseissignal /var/crash/%s%s.corehashinit: bad cntsysctllksysctldlk%s,denied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleepsyswqwqtasks%sunable to create system work queue threadwqdestroyunable to create "%s" workq thread boredpreempt: cpu_preempt not yet implementedsetrunnable>>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s at root%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %sconfig_detach: forced detach of %s failed (%d)%s detached config_defer: can't defer config of a root deviceconfig_defer: can't allocate defer structureinvalid geometryno disk labelunreasonable partition countdisk label corruptedinvalid label, d_secpercyl == 0invalid label, d_secsize == 0dos partition I/O errordisk label I/O errorbounds_check_with_label %lld %lld %s%d%c: %s %sing fsbn readwrit%lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs bufq_default_alloc: no memoryuse one of: exit %s[a-p] parsediskroot device (default %s%c): exitswap device (default %s%s)b%s%d%croot device (%s) not foundnetbootcan't figure root, hope your kernel is right root on %s%c swap on %s%d%c dump on %s%d%cintrextentplextntextent_free: start 0x%lx, end 0x%lx extent_free: region not foundklogpool_init: too much uptimephpool%s pool_do_get: %s: page emptypool_do_put: %s: page header missingkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%d%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad base?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisablecchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*%3d free slot (for add) %3d %s count %d disable (pseudo device) Unknown devno (max is %d) %3d at root%c ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d % already enabled %3d can't enable free slot command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devicesattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know%s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command User Kernel Config UKC> Continuing... selectpollpipelkpiperdpipewrpipeclpipepl@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /dev/consolettckoutqttyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunnablerunning%ld.%02ldu %ld.%02lds %d%% %ldk putc: required clalloc b_to_q: required clalloc WARNING: mclpool limit reached; increase kern.maxclustersmbplmclplmbuf prepend length too bigm_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == NULL and not COPYALLm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm == NULL in m_pulldown()unixsockplsoclose: NOFDREFsoaccept: !NOFDREFnetconnetclsnetionetlcksbappendaddrsbappendcontrolsemi-panic: sbcompresssbdropsbcreatecontrol: message too large %d acceptuipc 1uipc 2uipc 4piusrrequnp_attachunp_connect2unp_disconnectbremfree: lost tailbufplgetblkcleanerbiowaitbiodone alreadybufinit: can't reserve VM for buffersbuf_needvabuf_alloc_pages: overlap buf: %p page: %pbuf_alloc_pagesnchplvop_generic_revokealloperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.nameilockfpllf_findoverlap: defaultrelookup: null namerelookup: lookup on dot-dotvnodesvfslockvnodevgetvclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevmissing aliasvgonel: not cleankinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufbgetvp: not freebrelvp: NULLsyncersyncer vnode mount: lost mountunmount: dangling vnodevn_lock..defaultvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_ioctlvop_pollvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_strategyvop_bwritedead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockspec_read typespec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledbpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpf_mcopybpfattachtoo many interfacesallif_attachhead: mallocif_attach: mallocegress%s: can't handle af%d d;n &0vAkkQMaXPq< D֣ad°Ԡ x      ;n C&vkkMGP&"/+Ka5 d1͆< 8Ololo%dlooutput: no header mbuf%s: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_set failedrn_addmask: mask impossibly already in tree Mask for route not entered rn_addroute: t->rn_p is NULLNon-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtentplroute_init rtable_addrtfreertfree 2rtfree: %p not freed (neg refs) ifafreertrequest deletertinit: wrong ifa (%p) was (%p) rt_timer_init: already initializedrttmrplrt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputrt_msg1routearp_rtrequest: bad gateway value arp_rtrequest: malloc failed arpresolve: %s: route without link local address arpresolve: %s: can't allocate llinfo arp: ether address is broadcast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arptfreerevarpin_controlinvalid argument to in_lifaddr_ioctlin_pcbinit: hashinit failedin_pcbinit: hashinit failed for lportinpcbplinterneticmp_erroricmp lenicmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout%d.%d.%d.%dKgpqrstuvwxyzoipqeplipqplip_initaeshmac-sha1deflaterip_attachrip_detachrip_usrreqm_pulldown malfunctiontcp_pulloutofbandsynpltcp_outputtcp_output REXMTtcpcbpltcpqepl4p8h9;ltcp_usrreqm_pulldown malfunctionudp_usrreqipip_input: should never reach hereuid %u on %s: %s file system full %s: write failed, file system is full dev = 0x%x, bsize = %d, bprev = %lld, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blocknodev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimmode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %lld blocks out of inodes %s: create/symlink failed, no inodes free ffs_clusteralloc: lost blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %lld, ino %u bad blockdev = 0x%x, block = %lld, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %u, fs = %s ffs_freefile: freeing free inodestart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %lld, fs = %s ffs_alloccg: block not in mapffs1_balloc: blk too bigCould not unwind indirect block, error %dffs_update: bad link cntffs_truncate: newspaceffs_indirtrunc: bad buffer sizesoftdep_flushfiles called?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@x)|))dHt)ffs_mountroot: can't setup bdevvp's ffsroot_deviceWARNING: soft updates isn't compiled in WARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1 ffs_statfsfs = %s update: rofs modinodeffsinodino1plffs_write: nonsync dir writeffs_write: typeffs_fsync: not dirtyffs_fsyncmangled entryi_ffs_size too small%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory chown: lost quotaufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_readdir: lost in spaceufs_strategy: specamap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing thereamapplamap_wipeout: corrupt amapamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countanonpluao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectuao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getpageuao_getudv_attachudv_detachudv_faultfltamapcopyanonget1anonget2flt_noram1flt_noram2flt_noram3flt_pmfail1fltagain2flt_noram4flt_noram5flt_pmfail2uvm_fault_unwire_locked: address not in mapscheduleruvm_init: page size not setuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileduvm_km_pgremove_intrsafe: no pagekm_getwait2uvm_km_alloc1: non-released pagekm_allockm_alloc1wvallocwaitkmthreadkmallocgetpagegetpg2vmmaplkvmmapbsyuvm_mapent_alloc: cannot allocate map entryuvm_mapent_alloc: out of static map entries # uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekpluvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)uvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physrehash: WARNING: could not grow page hash table uvm_pagealloc_strat: bad strat %demergvapager_mappagedaemon: deadlock detected! pgdaemonaiodonedswplkuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filewarning: resource shortage: %d pages of swap lost swapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?uvm_deallocate with null mapuvnsyncuvn_attach: blocked at %p flags 0x%x uvn_attachuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: kill flag set on referenced object!uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncrd%d: fixed, %d blocks NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egress  %ciommu%s at %s unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB nameobiovmelvmesvme%s at %s addr %p vec 0x%x#H#@#8#(interruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsvmesattach: can't allocate intrhandvmelattach: can't allocate intrhandvme: PROM ranges too large: %d: version 0x%x vmebus: no rangesvme: spurious interruptvme: spurious interrupt vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqauxregauxiliary-ioauxioauxio2Tadpole oclockeepromclocktimer delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d mk48t02model: %s (eeprom) mk48t08counter-timercounterdelay calibration delay constant %d oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz oldclk statintrWARNING: preposterous time in file system WARNING: bad date in battery clock%s -- CHECK AND RESET THE DATE! power sun4cpumidsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s %s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dmmu-npmgmmu-nctxclock-frequencyvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typecache chip bug - trap page uncachedcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache [viking: PCR_TC is off][viking: turn on PCR_TC]UnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUsB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%xmemregmemory-errormemregattach %ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorHyperSPARC async cache memory failure at phys 0x%x%x store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. zsslavezsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmousebroken zs interrupt schemepwr-on-auxio2%s: channel %dstopping on keyboard abort ttydttycttybttyakeyboard/displaystdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. device_typestdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. fdc1.2MB/NEC360KB/x720KB1.44MBfdSUNW,fdtwo drive %d pri %d, softpri %d: unable to register fast trap handler %s: no drives attached CFGLOCK: unexpected responsechip 8207%c : %s %d cyl, %d head, %d sec : density unknown fdcresult: overrun fdcresult: timeout %s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam%s: timeout but no I/O pending: statu %d, istatus=%d fdc: ierror status: state %d fdc: spurious interrupt: state %d timeoutsoft errorstray interrupt%s: read-only medium %s: no medium? hard errorcontroller statusfloppy diskfictitioussbusslave-only"%s" at %sdevice_type class %s %s slot %d offset 0x%x unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnamerelative sbus addressing not supported%s: dma card found in non-dma sbus slot %d: not supported %s: reset: invalid keyboard type 0x%02x  '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_ 7 `9T<O;V VB`9M=j> L@PAbEbF ODB  DHh 7N=4L; OCZ:C>j,Hi? JA.KBbUFPUG OD  DH       zstty flags 0x%x input output: console%skeyboardmouse: %s %s: device enable failed %s: %d silo overflow%s, %d ibuf flood%s szskbdkeyboard, flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%x : failed to set baudrate : failed to set modes : no keyboard %s: %d silo overflow%s, %d ibuf flood%s smii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@@@mii_phy_setmedia: MASTER on wrong mediamiiautnsphy v x@ zPP0DP83840 10/100 PHY: %s, rev. %d qsphy { }( ~`QPQS6612 10/100 PHY: %s, rev. %d luphy  s l` PLU6612 10/100 PHY: %s, rev. %d scxsplgetxscannot allocate scsi xs scsicmdscsi_execute_xs: invalid return code (%#x)unknown error category (0x%x) from scsi driver scbusy%s(%s:%d:%d): probeReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sensex`8 P h@ p@p8  h ( xH(P8        p P @     h P 0     x H     x X8xH(    H (xH p@`8h8x@ xP0pX8xX0    X (     h @ !!!"$h$P$$$0$$$%&&&h&@&&&&&& `& @&  & & &'RH'x'P'0'''((x)H)0))))))p*X*@*(*****+P,8,,,,,,`,H,(, , -./`0@00000p0@0(00 0 011h2@2 345555h5@6 788889h:P:(:::;;`;8;;;;;;; p; P; 0; ; ;;;;x;X;@; ;=>>>p>P> ?????x?X?0??? ? ? ? ? x?X?@?0?@ABCxD`E@F(GGGGG`G@GHIJKKhKPK@K0KKLNPPxPPQ@QRSSSTxU`UHU UUUUWpXPY8ZZ~Z~Z~[~[~[~h[~H\~0\~\}]}]}]}h]}0]|]|]|]|P]|]{]{]{x]{H]{]z]z]zh] z0]!y]"y]#y]$yP]%y]&x]'x](xp])x8]*x]+w],w]0wH]1w]2v]3v]4v`]5v(]6u]7u]8ux]9u@]:u];t]<t]@tX]At ]Bs]Cs]Dsx]EsH]Fs]Gr]Hr]Ir]JrP]Kr ]Lq]Pq]Qqx]Rq@]Sq]Tp]Up]Vph]Wp8]Xp]Yo]Zo][op]\o8]`o]an]bn]cnX]dn ]em]fm]gm]hmP]im]jl]kl]llp]l@^l(^l^k^k^k^Akh^BkH^Ck(^Ek^Gj`jajajajbjpcj@cjdidieifififiPfi gighghghghxghXgh0ghggg gg ghgigpigPig8jgkfkfkflfmfxnfXofoeoeoepoe8oeqdrdrdrdhrd0rdrcscscscxscXsc0scsbRMA/PMA Is Almost FullProgram Memory Area Is FullProgram Memory Area Update FailurePower Calibration Area ErrorPower Calibration Area Is FullPower Calibration Area Almost FullCD Control ErrorNo More Track Reservations AllowedEmpty Or Partially Written Reserved TrackSession Fixation Error - Incomplete Track In SessionSession Fixation Error Writing Lead-OutSession Fixation Error Writing Lead-InSession Fixation ErrorDecompression Exception Long Algorithm IDDrive Region Must Be Permanent/Region Reset Count ErrorMedia Region Code Is Mismatched To Logical Unit RegionRead Of Scrambled Sector Without AuthenticationCopy Protection Key Exchange Failure - Key Not EstablishedCopy Protection Key Exchange Failure - Key Not PresentCopy Protection Key Exchange Failure - Authentication FailureCommand To Logical Unit FailedRecalculate Failure OccurredRebuild Failure OccurredRedundancy Level Got WorseRedundancy Level Got BetterState Change Has OccurredInformational, Refer To LogParity/Data MismatchMultiple Logical Unit FailuresData Loss On Logical UnitLogical Unit Not ConfiguredSet Target Port Groups Command FailedMultiply Assigned Logical UnitAssign Failure OccurredCreation Of Logical Unit FailedAttachment Of Logical Unit FailedRemove Of Logical Unit FailedExchange Of Logical Unit FailedModification Of Logical Unit FailedAdd Logical Unit FailedConfiguration Of Incapable Logical Units FailedConfiguration FailureDocument Miss Feed Automatic In Document FeederDocument Jam In Automatic Document FeederAutomatic Document Feeder Lift UpAutomatic Document Feeder Cover UpVoltage FaultInvalid Packet SizeIllegal Mode For This TrackPacket Does Not Fit In Available SpaceEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailurePower State Change To Device ControlPower State Change To SleepPower State Change To StandbyPower State Change To IdlePower State Change To ActiveStandby Condition Activated By CommandIdle Condition Activated By CommandStandby Condition Activated By TimerIdle Condition Activated By TimerLow Power Condition OnFailure Prediction Threshold Exceeded (false)Firmware Impending Failure Drive Calibration Retry CountFirmware Impending Failure Spin-Up Retry CountFirmware Impending Failure Seek Time PerformanceFirmware Impending Failure Throughput PerformanceFirmware Impending Failure Controller DetectedFirmware Impending Failure Channel ParametricsFirmware Impending Failure Start Unit Times Too HighFirmware Impending Failure Access Times Too HighFirmware Impending Failure Too Many Block ReassignsFirmware Impending Failure Seek Error Rate Too HighFirmware Impending Failure Data Error Rate Too HighFirmware Impending Failure Drive Error Rate Too HighFirmware Impending Failure General Hard Drive FailureSpindle Impending Failure Drive Calibration Retry CountSpindle Impending Failure Spin-Up Retry CountSpindle Impending Failure Seek Time PerformanceSpindle Impending Failure Throughput PerformanceSpindle Impending Failure Controller DetectedSpindle Impending Failure Channel ParametricsSpindle Impending Failure Start Unit Times Too HighSpindle Impending Failure Access Times Too HighSpindle Impending Failure Too Many Block ReassignsSpindle Impending Failure Seek Error Rate Too HighSpindle Impending Failure Data Error Rate Too HighSpindle Impending Failure Drive Error Rate Too HighSpindle Impending Failure General Hard Drive FailureServo Impending Failure Drive Calibration Retry CountServo Impending Failure Spin-Up Retry CountServo Impending Failure Seek Time PerformanceServo Impending Failure Throughput PerformanceServo Impending Failure Controller DetectedServo Impending Failure Channel ParametricsServo Impending Failure Start Unit Times Too HighServo Impending Failure Access Times Too HighServo Impending Failure Too Many Block ReassignsServo Impending Failure Seek Error Rate Too HighServo Impending Failure Data Error Rate Too HighServo Impending Failure Drive Error Rate Too HighServo Impending Failure General Hard Drive FailureData Channel Impending Failure Drive Calibration Retry CountData Channel Impending Failure Spin-Up Retry CountData Channel Impending Failure Seek Time PerformanceData Channel Impending Failure Throughput PerformanceData Channel Impending Failure Controller DetectedData Channel Impending Failure Channel ParametricsData Channel Impending Failure Start Unit Times Too HighData Channel Impending Failure Access Times Too HighData Channel Impending Failure Too Many Block ReassignsData Channel Impending Failure Seek Error Rate Too HighData Channel Impending Failure Data Error Rate Too HighData Channel Impending Failure Drive Error Rate Too HighData Channel Impending Failure General Hard Drive FailureController Impending Failure Drive Calibration Retry CountController Impending Failure Spin-Up Retry CountController Impending Failure Seek Time PerformanceController Impending Failure Throughput PerformanceController Impending Failure Controller DetectedController Impending Failure Channel ParametricsController Impending Failure Start Unit Times Too HighController Impending Failure Access Times Too HighController Impending Failure Too Many Block ReassignsController Impending Failure Seek Error Rate Too HighController Impending Failure Data Error Rate Too HighController Impending Failure Drive Error Rate Too HighController Impending Failure General Hard Drive FailureHardware Impending Failure Drive Calibration Retry CountHardware Impending Failure Spin-Up Retry CountHardware Impending Failure Seek Time PerformanceHardware Impending Failure Throughput PerformanceHardware Impending Failure Controller DetectedHardware Impending Failure Channel ParametricsHardware Impending Failure Start Unit Times Too HighHardware Impending Failure Access Times Too HighHardware Impending Failure Too Many Block ReassignsHardware Impending Failure Seek Error Rate Too HighHardware Impending Failure Data Error Rate Too HighHardware Impending Failure Drive Error Rate Too HighHardware Impending Failure General Hard Drive FailureSpare Area Exhaustion Prediction Threshold ExceededLogical Unit Failure Prediction Threshold ExceededMedia Failure Prediction Threshold ExceededFailure Prediction Threshold ExceededSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change InputUpdated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsAuxiliary Memory Out Of SpaceInsufficient Access Control ResourcesInsufficient Registration ResourcesInsufficient ResourcesInsufficient Reservation ResourcesSystem Buffer FullSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase Failure - Incomplete Erase Operation DetectedErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationInitiator Response TimeoutData Offset ErrorNAK ReceivedACK/NAK TimeoutToo Much Write DataInvalid Target Port Transfer Tag ReceivedData Phase ErrorCommand Phase ErrorInvalid Message ErrorInitiator Detected Error Message ReceivedSome Commands Cleared By iSCSI Protocol EventProtocol Service CRC ErrorAsynchronous Information Protection Error DetectedInformation Unit iuCRC Error DetectedSCSI Parity Error Detected During ST Data PhaseData Phase CRC Error DetectedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)Medium Auxiliary Memory AccessibleMedium LoadableEcho Buffer OverwrittenReported LUNs Data Has ChangedVolume Set ReassignedVolume Set DeassignedVolume Set DeletedVolume Set Created Or ModifiedSpare DeletedSpare Created Or ModifiedRedundancy Group DeletedRedundancy Group Created Or ModifiedDevice Identifier Changedcomponent Device AttachedINQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Unable To Update Self-Test LogLogical Unit Failed Self-TestTimeout On Logical UnitLogical Unit FailureLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTIFY MessageMechanical Positioning Or Changer ErrorMedium Magazine UnlockedMedium Magazine LockedMedium Magazine InsertedMedium Magazine RemovedMedium Magazine Not AccessibleEnd Of Medium ReachedMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Beginning Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumSequential Positioning ErrorMedium Not Present - Medium Auxiliary Memory AccessibleMedium Not Present - LoadableMedium Not Present - Tray OpenMedium Not Present - Tray ClosedMedium Not PresentSaving Parameters Not SupportedESN - Device Busy Class EventESN - Media Class EventESN - Power Management Class EventEvent Status NotificationRounded ParameterRibbon, Ink, or Toner FailureEnclosure Services Transfer RefusedEnclosure Services Transfer FailureEnclosure Services UnavailableUnsupported Enclosure FunctionEnclosure Services FailureEnclosure FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedMedium Not FormattedCleaning Request RejectedCurrent Session Not Fixated For AppendCannot Write - Application Code MismatchCleaning FailureCannot Format Medium - Incompatible MediumCannot Write Medium - Incompatible FormatCannot Write Medium - Unknown FormatCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorInsufficient Time For OperationOverwrite Error On Update In PlacePartition Or Collection Contains User ObjectsPrevious Reservation Conflict StatusPrevious Task Set Full StatusPrevious Busy StatusPersistent Prevent ConflictIllegal Power Condition RequestCurrent Program Area Is EmptyCurrent Program Area Is Not EmptyInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectImplicit Asymmetric Access State Transition FailedAsymmetric Access State ChangedRegistrations PreemptedReservations ReleasedReservations PreemptedLog Parameters ChangedMode Parameters ChangedParameters ChangedI_T Nexus Loss OccurredTransceiver Mode Changed to LVDTransceiver Mode Changed to Single EndedDevice Internal ResetBus Device Reset Function OccurredSCSI Bus Reset OccurredPower On OccurredPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Conditional Write ProtectPermanent Write ProtectPersistent Write ProtectAssociated Write ProtectLogical Unit Software Write ProtectedHardware Write ProtectedInvalid Parameter While Port Is EnabledCopy Segment Granularity ViolationInvalid Operation For Copy Source Or DestinationInline Data Length ExceededUnexpected Inexact SegmentUnsupported Segment Descriptor Type CodeToo Many Segment DescriptorsUnsupported Target Descriptor Type CodeToo Many Target DescriptorsData Decryption ErrorInvalid Release Of Persistent ReservationThreshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedNonce Timestamp Out Of RangeNonce Not UniqueSecurity Working Key FrozenSecurity Audit Value FrozenCDB Decryption ErrorIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Address For WriteInvalid Element AddressLogical Block Address Out of RangeAccess Denied - ACL LUN ConflictAccess Denied - Invalid Proxy TokenAccess Denied - Invalid LU IdentifierAccess Denied - Enrollment ConflictIllegal Command While In Implicit Address ModeIllegal Command While In Explicit Address ModeObsoleteIllegal Command While In Write Capable StateAccess Denied - Invalid Mgmt ID KeyAccess Denied - No Access rightsAccess Denied - Initiator Pending-EnrolledInvalid Command Operation CodePartial Defect List TransferRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data With LinkingRecovered Data With ECC - Data RewrittenRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With L-ECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Data RewrittenRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Sync Error - Recommend ReassignmentData Sync Error - Data Auto-ReallocatedData Sync Error - Recommend RewriteData Sync Error - Data RewrittenData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorLocate Operation FailureRecord Not Found - Data Auto-ReallocatedRecord Not Found - Recommend ReassignmentBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldRead Error - Failed Retransmission RequestAuxiliary Memory Read ErrorRead Error - Loss Of StreamingError Reading ISRC NumberError Reading UPC/EAN NumberCannot Decompress Using Declared AlgorithmDe-Compression CRC ErrorUncorrected Read Error - Recommend Rewrite The DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block ReadData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retries ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorInformation Unit Too LongInformation Unit Too ShortInvalid Information UnitCopy Target Device Data OverrunCopy Target Device Data UnderrunIncorrect Copy Target Device TypeCopy Target Device Not ReachableThird Party Device FailureError Detected By Third Party Temporary InitiatorWrite Error - Not Enough Unsolicited DataWrite Error - Unexpected Unsolicited DataAuxiliary Memory Write ErrorWrite Error - Padding Blocks AddedWrite Error - Loss Of StreamingWrite Error - Recovery FailedWrite Error - Recovery NeededBlock Not CompressibleData Expansion Occurred During CompressionCompression Check Miscompare ErrorWrite Error - Recommend ReassignmentWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorWarning - Enclosure DegradedWarning - Specified Temperature ExceededWarningError Log OverflowHead Select FaultSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorUnreachable Copy TargetLogical Unit Communication CRC Error (ULTRA-DMA/32)Logical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Notify (Enable Spinup) RequiredLogical Unit Not Ready, Auxiliary Memory Not AccessibleLogical Unit Not Accessible, Target Port In Unavailable StateLogical Unit Not Accessible, Target Port In Standby StateLogical Unit Not Accessible, Asymmetric Access State TransitionLogical Unit Not Ready, Self-Test In ProgressLogical Unit Not Ready, Long Write In ProgressLogical Unit Not Ready, Operation In ProgressLogical Unit Not Ready, Recalculation In ProgressLogical Unit Not Ready, Rebuild In ProgressLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalVerify Operation In ProgressSet Capacity Operation In ProgressRewind Operation In ProgressLocate Operation In ProgressErase Operation In ProgressCleaning RequestedOperation In ProgressNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xTagged Overlapped Commands (0x%02x = TASK TAG)Decompression Exception Short Algorithm ID OF 0x%02xASC 0x%02x ASCQ 0x%02x%sCheck Condition (error %#x) on opcode 0x%x DEFERRED AT BLOCK #: %d (decimal) SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO: 0x%x (VALID flag %s) onoff COMMAND INFO: 0x%x ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Error in %s, Offset %dCDBParameters, bit %dActual Retry Count: %dProgress Indicator: %dUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category (0x%x) from host adapter code user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistrscsibusscsibus at %s: %d targets, initiator %d scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links%s: unable to register bio 8( ph`XpHp@8(`x`Xx@8x p`PH80  1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P1.0gMemorex CRW-26421.061.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TE02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 3.SDT-5000 SONY DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROPjaz 1GBiomegaELS85S QUANTUM DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID A00MD21/S2 ESDIEMULEX RZ55 (C) DECDEC 1588-15MBSUN0669MICROP 1.01CD-ROM PX-40TSPLEXTOR%s offlinescsibusprint: qualifier == SID_QUAL_RSVDscsibusprint: qualifier == SID_QUAL_BAD_LUvendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: device type T_NODEVICEunknown targ %d lun %d: <%s, %s, %s> ATAPISCSI%d %d/%s %s%sremovablefixed not configured cdhhhhhh@hhNEC CD-ROM DRIVE:260 %s: WARNING: unable to establish power hook %s: not queued, error %d ATAPI CD-ROMSCSI CD-ROMfictitiousch02009000SPECTRA sd %s: %lldMB, %lu cyl, %lu head, %lu sec, %lu bytes/sec, %lld sec totaldrive offline%s: WARNING: unable to establish shutdown hook %s: not queued, error %d (unknown)SCSI opticalSCSI disk%s %sèØÀpXH0Øظ¨€h`P8E MT-2ST/N50 TEAC ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d %s: not queued %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d dmaledma[%s at %s] offset 0x%xespdmacable-selectiontpeauiburst-sizes: rev 0esc11+2fasunknown (0x%x) nameesp%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/RAMDISK/../../../../arch/sparc/dev/dma.cR_PENDdma: cannot allocate DVMA address%s: error: csr=%b INTERRDR1DR2IENSLVERRRST WRITE ENDMAENCNTTCDSBL_CSR_DRNDSBL_SCSI_DRNTWOCYCLEFASTERTCIDISENNXTDMAONALOADEDNALOADEDdmaintr: DMA wasn't activeDRAININGlebuffer[%s at %s] offset 0x%xburst-sizes: %dK memory nameqec%s at %s offset 0x%x#channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameranges%s: PROM ranges too large: %d %s: reset failed. be: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s %s: device timeout %s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting %s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid tcvr type %s: invalid packet size %d; dropping %s: bmcr reset failed %s: bmcr unisolate failed qe: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s %s: device timeout %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... %s: invalid packet size %d; dropping hmeSUNW,hmeSUNW,qfe: expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe%s: stop failed %s: device timeout %s: burst size unknown %s: setting rxreg->cfg failed. %s: reset tx failed %s: reset rx failed %s: link status changed %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP%s: invalid packet size %d; dropping %s: mii_write failed %s: mii_read failed SUNW,fasptscII: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency: expected 2 register spaces, found %d : could not allocate dma softc : could not map DMA registers burst-sizes: could not map SCSI core registers dma espattach: no dma foundespdepthwidthheightlinebytesstdscreen-#rowsscreen-#columnswsdisplay%s: screen %d-%d added (%s, %s emulation) %s: screen %d deleted wsdisplay at %s: console (%s, %s emulation), using %s wsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wswaitwsevent_readwskbdwskbd at %scannot load keymap: console keyboard, using %s wskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrysun D  P  wsemul_sun_output_lowchars: ESC in kernel output ignored 888rasops_init: font table is empty rasops_init: couldn't lock font rasops_init: fontwidth assumptions botched!????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? wsfont_unlock: font not lockedagtenPFU,agamodel: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d bwtwo: p4model%s, %dx%d cgeight: p4, %dx%dcgfour: p4, %dx%d cgfourteen pri %d: expected %x bytes of control registers, got %x expected %d registers, got %d expected 1 interrupt, got %d model%s, %dMB, rev %d.%d, %dx%d cgsixSUNW,cgsix pri %d: p4model%s, %dx%d, rev %d cgthreecgRDI pri %d: model%s, %dx%d cgtwelve: %smodeldev_id (%s) %s: %dx%ducoderev, microcode rev. %scgtwo: %dx%d mgxSMSI,mgx: %smodel %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d , %dx%d %s: unexpected engine id %04x pninekp9000 pri %d: bt445 did not attach previously : rev %x, %dx%d btchambt445: id 0x%x, revision 0x%x pnozzp9100 pri %d: rev %x, %dx%d stdout @ is my-self addr char-height %lx ! addr char-width %lx ! addr font-base %lx !p9100_romfontrfxRasterFLEXRasterFLEX-TV: %s %s: no SBus registers! configuration, unknown %d bytes conf. structure, revision %d, %dx%d tcxSUNW,tcx pri %d: expected %d registers, got %d tcx-8-bitmodel: %s %s: %dx%d, id %d, rev %d, sense %d tvtwoPGI,tvtwoPGI,tvthree: %smodelrevision, revision %sfreqcodehresvres, %dx%d vigravs10vs11vs12 pri %d %s: expected %d registers, got %dmodel: %sVIGRA,vs11, %dx%d zxSUNW,leomodel: %swidthheight, %dx%d %s: zx_cross_wait: timed out %s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundaryUnknown3e/vmeonboardmultibus/vmeieie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s %s: device timeout %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions %s: receive descriptors out of sync at %d %s: tbuf overflow %s: reset %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed xdcxdxddummystrat%s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s xdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xdnfreexdsubwaitxdcmd nfreexdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq%s: off-line: %s xdc_reset%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE xdc_start%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout Software fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatal VMEDMA errorVMEbus errorDrive faultedHeader error/cylinderHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown errorxycxyxydummystrat%s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver xyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xyc_cmd%s: stole control iopb xyc_startbuf null buf%s: warning: out of DVMA space xyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq%s: off-line: %s xyc_reset%s: soft reset %s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]%s: watchdog timeout Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown errorsiswsi_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d si_intr: DMA conflict si_intr: DMA bus error si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO si_dma_free: free while in progress%s: DMA timeout (while polling) si_dma_start: bad pa=0x%lxsi: DMA error, csr=0x%x, reset si: fifo count: 0x%x si_dma_stop: excess transfer%s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d sw: DMA error, csr=0x%x, reset sw: short transfer fpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_explodefpu_implode/obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertieskernel has no debugger twas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecdbootpath: /%s%x/%s@%x,%x:%c WARNING: %s map is bogus, using default sd-targetscpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configuredPROM sync command%d%s at %s %saddr 0x%xiono PROM root devicenameproperty lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector  pled0(virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error8peccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsfindzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%dpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d search_prom: null nodeiommuWARNING: opennode not valid on sun4! %s ' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !PROM exit failedPROM boot failedsdconfig_attach: device name too longvndraidrdstxdxycache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent disk label read errorSunOS disk label, bad checksumstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsAsync registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b VME0VME1VME2VME3VME4VME5VME6SBUS0 SBUS1 SBUS2 SBUS3 SBUS4 SBUS5SBUS6KSEASCTVI5MIFVMIME MAnmisoftintrclockprofintr_establish: level %d interrupt tied to fast vectorreal mem = %u (%uMB) startup: no room for tablesstartup: table size inconsistencystartup: can not steal dvma mapunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %lu (%luMB) WARNING: not updating battery clock attempting to power down... power-offWARNING: powerdown failed! halted rebooting dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @0x%x:%d device bad device not ready area improper i/o error succeeded error %d Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p mapiodevmapdev: zero sizecurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed mmrwmmrw: out of space in kernel_mapVA2PA: Asked to translate unmapped VA %ppmap_page_upload: no memory?mmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typeme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptesme_free: no segments in pmapctx_freepv_changepte: no segmentspv_changepte: pte == NULLpv_syncflags: no segmentspv_unlinkpv_link_4_4c: allocation failedpv_syncflags4m: no pte pmap: %p, va: 0x%x pv_link4m: allocation failedrp->rg_segmap == NULL! pvplL1 pagetableL2/L3 pagetablepmap_release: segment list not emptypmap_release: releasing kernelpmap_rmu: no segmentspmap_rmu: no pagespmap_protect: last segmentpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! kvm_uncache !pg_vtrapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 insn access MMU missv8 data access MMU missv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 intwatchpointtag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b syscall nargsdvma_mapin: null page framedvma_mapout: extent_free failed vmapbuf: null page framevunmapbufxboxSUNW,xboxmodel: model %schild-presentfalse: no devices write0-key ranges%s: PROM ranges too large: %d %s at %sOpenBSD4.4RAMDISK#443 @(#)OpenBSD 4.4 (RAMDISK) #443: Thu Aug 7 00:24:07 MDT 2008 OpenBSD 4.4 (RAMDISK) #443: Thu Aug 7 00:24:07 MDT 2008 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/RAMDISK hsun4c compatiblehd'(7>D1vEHI@HuG-|5wF@ @  0 0                                  eCDEFGTRJKNOPQHIZLMS]\VX[BUY;<=>?stklmn#$%01234#$pq5601 !+':u35700(@0101@0101@0101@0202@0202@020203403H@03403H03403H02020202 03\03p@03\03p03\03p(03 03 03 03 003030303@0;80;L@0;80;L0;80;L0;80;L0;0;@0;0;0;0;0;0;0;0;@0;0;0;0;0;0;0;0;0<0<@0<0<0=0=@0=0=@0=0=@*0=0=@60> 0>4\0>x0>X\0>0>\20>0>\20>0? \20?t0?@0?0?0?0?0@,0@@0@h0@|0@0@0@0@0@0@0@0@0@0@0@0A0@0A0A0A,0AT0A@@B#0A|0Ah@B#0A0A0Al0Al0Al@ #0Al0Al@#0BT0B@|$0B0B.u0{0{0| 0|40| 0|480| 0|4@0| 0|4H0| 0|40|p0|@0|p0|H0|0|@0|0|H0}0}$P0}0}$X0}`0}t0}`0}t`0}`0}th0}`0}t0}0}0~(0~<0~x0~"x0~0~00,0@0T000000l0000 0 0\0p0Ĭ@:{0Ĭ@>{0Ĭ0Ĭp0Ĭ@{0Ĭ@{0Ĭ00x0000|"x00L"x00"x00"x00@&|00X&|00&|00&|00\0,0@p"x0,0@d"x0T0h\00"x000 04H@0(lh4 0PxhX 4  (LθΰΨΠΘΐΈ-Pa4X44X4BCPClCPXXYTF]h^PN^RR_CE`ST`NM[L\dCL\0PL\0RE]T@RR_CE`ST`SLYRR_CE`ST`ER`CE`ST`PnhGtn߀nߌ|ߘ|ߤ|߰} ߼{~n\dPnn(L4n@nLnXtd\p|QR G|\n4^8PSߤ|߰} ߼{QR |\4^4@4native p6,@ TTnative p6,X TT؀p` $4 pd s ͜P $ &D   ?lHI@@ W| T,V L( _ ^4"\#` l?0@ACx c4Ai`O\Oj(j wLǰ4 ! t4l| H P  @ D A8M@?B  Lz. Qx JD O P   K4[K j8  LY\ q u0 (%XIHt/T۔S[\Q1d2L* A | \56K|LJ!HΜ qVS3 `,-  +l?e`\  0@ '|@$  ]6L7t ! "  ` C  C E F Xxk ( G   d  h,DX T 0 H (00dB@ݠH8 ٴ..H xph`XPH@8( p0t44D<44ttyclsttyopnttybgttyinttyout`4 nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn   $c$c@Htovx܈$474566P ffscd9660ݼ( Tx2lockf@`  Pnߘn0n$x\,4<=x?@A>\A@HXhx(8HXhx(8HXhxP\ht߀ߌߘߤ߰߼(4@LXdp|PnhhtSD߀SDߌQ,ߘnߤS<߰S<߼S<Q4QtQQnSD(SD4SD@SDLSDXSDdS<pS<|SDnnR$RQS$\,S<S<n4PnhhtcD߀cDߌTߘ_|ߤb߰al߼aVY\]`]P^ cD(cD4cD@cDLcDXcDdcDpcD|cDYn$_b\\,bc 4 yy$0123456789abcdef^^̐l#$%&'()*+;,-.;/;0;1B@2T 3T 4T 56T cdeB@B@LK@O[T@n6%Ql7Jpp@@@@ j j j@ 8@ t$L8,2dt\JR0UJYx,֬-pBX=%$3H8ͰwͰsZ4Ͱa<<4Ͱ:D8EG<8Ͱp$ dX}E#(D<8Q @X,tDpHLPTX\d`hlx|(@AAA==(A* dd%(i @@@@@@@@@5d5XXT$    x8@lPnhtt+p߀+ߌ,ߘ-<ߤ.߰0߼4 4>>cP>(?4B\@NLShXUdVpY|lYZ4ZD[\Z(^T^ 5pPSߘ\ߤ.߰0߼4 \\HlYZ[\Z(5 ... ...d,dpd,ed,e<$8<L \X ,   M@ @ption %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s' , 2  . @ @ @`  `@  2 ,&ھn (H_ < @Hu))3(@(S/mnttr4 (SH_(@@<@T (Hu_ < @Hu))3(@ Hu_(@@<@T UH@/0H '+A HvHN)HN)0^AHv ?Hv ?Hv ?)AHv PHvNHv;8*e|CHvNHz/`Hz/`+KAHvNHvNHvN,3'9Hv,~Hv:jՀHN)8@HPX`hpx @lHy&)]Hy*U(Hy*U(-ơHy-P`Hy2PHz%.(jHy6pHz0@Hz%1 5rHz+?47[/A YgݠdvD8b!`4vݒ%_BWOA}*u*h[8#0/[s5]&/$( ... . .. tmp db8D runEempty= . ..  tmp ... export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs set -- `dmesg | sed -n '/^root on /h;${g;p;}'` rootdisk=$3 if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u /dev/${rootdisk:-rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = "X" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/ksh MODE=upgrade . install.sub while :; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} [[ -b /dev/$resp ]] && break echo "Sorry, $resp is not a block device." done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV >/dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(stripcom /tmp/myname) THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ask_yn "Enable network using configuration stored on root filesystem?" yes [[ $resp == y ]] && enable_network manual_net_cfg cat <<__EOT The fstab is configured as follows: $( is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs install_sets finish_up  . ..@ bin dev etcA mntBmnt2DsbinDC tmp usrvarinstbin.profile2 upgrade install  install.sub install.md #!/bin/ksh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while :; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_pp == $SWAPDEV || $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_size if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done >$FILESYSTEMS : $(( _i += 1 )) done done cat <<__EOT OpenBSD filesystems: $(<$FILESYSTEMS) The next step *DESTROYS* all existing data on these partitions! __EOT ask_yn "Are you really sure that you're ready to proceed?" [[ $resp == n ]] && { echo "Ok, try again later." ; exit ; } _i=0 unset _partitions _mount_points while read _pp _mp; do _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >>/tmp/fstab while read _dev; do [[ $_dev == $SWAPDEV ]] || \ echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done <$SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" ( cd /tmp; rm -f host* my* resolv.conf resolv.conf.tail dhclient.* ) cat >/tmp/hosts <<__EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask_yn "Configure the network?" yes [[ $resp == y ]] && donetconfig _oifs=$IFS IFS= while :; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" [[ $resp == $_password ]] && break echo "Passwords do not match, try again." done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done /tmp/ttys mv /tmp/ttys /mnt/etc/ttys questions echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname >myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab host* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | /mnt/bin/ed /mnt/etc/master.passwd 2>/dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db /mnt/bin/dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." set_timezone finish_up MDTERM=sun MDDKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' ARCH=sparc md_installboot() { local _rawdev=/dev/r${1}c _prefix if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_prep_disklabel() { local _disk=$1 disklabel -W $_disk >/dev/null 2>&1 disklabel -f /tmp/fstab.$_disk -E $_disk } md_congrats() { } md_consoleinfo() { } ELF`4H4 (ttx"x"x 0 055]]eeuu 8444OpenBSD㿠@ @D* @ +#@㿘 ;""`@ h`'"  @, / &@ & ;J `h  *"J` bh&*"`@_@*`:` J " 㿘!?!`     , `2 ?, ??@@??㿘!` !  㿘 h    !a"@B<!`㿘 h`  "`㿘@ J 2@@6@@ /  @ h `"@! 2     ~a@'#@㿘 ?@?`Ŕ㿘 ~a@&# h`  ` )+@U@  O4@&ے!ؤ@@&֒a`@ @&Β!@ 㿘@k㿈'")" "0"` B%@ [a耢 $aa@^m @  = 2,aa(@^c  L aaa@@^Y 'B `!8@>  a(@^H ! "a`@^>  €#!  $!!`@"@ $!!` @@z!!`a@^ "l a@^  "pC"C##"@!C #C"$!"bpa@] "l  a@] C""bp`"0  b@]Ӑ "l  6 b8@]Ő  #@8?`  `$  #@8w?    $  b` @]?㿘@ =@㿘@R"b"@㿘@I"bl㿘@B "bh?"bh㿘@7 h"c,㿘! @+"b 㿘! @"b@ H㿘@l:P㿘@e:㿘b@]C 㿐@yW ?2!b@b 2J!b@]* `k`m`b". `w . . .  'J`x 4``*2 @U@Ɛ "ab@\ !b@\ 㿐 @ H    !b@b 2K!b@\ʐ  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @! 'J`x 4!`#`*2  @: @@F "ab@\p !b@\k 㿘"t !   "@    `*"0!``$   $ @$   $`$` 8㿘 hbДr@\1 㿘 hbДr@\* 㿘 hbДp@\# 㿘 hbДp@\ 㿘@ FcT@ B; 0 @2   # !"0  " &   #   "0@O"@ "0  & - ~ĐX'@K ""X" 'X\"@`'\А"@@'X'\X h?00 p\ DB F?0 ?0 ` d#\@ <8@P'8 `$`#  d@ - %@@P$ 'x`  (# ` d@ - 8"@P<$ \@S##\x`- @5l`h BX  d0 ¨ @ f;`8<@Pn$@$@?{  @ѐ `㿘@L^@H"㿘V@: 㿘)!  !@=  !   @6|     @OF ?B@ `x@^    6!!@  "  D?D?  hc, ?"c,`@X !$ `ـ@I x р`x@^l 㿐'0    @6$    @N ?vt`x@^N  $ '7a@7 c`x@^=    X$ T00@Ҕ 4A`6`x@^#   7 'a@7ɔ?`x@^ ` D 40,$ (00@u `x@] ` D 40$ 00  D 40$0㿘@9!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!! ! !! !!!! !!!  ~"Ĵ ' 't/G# ;-tp+9 ~x+; 4&* P@€"    c@d c   #@p   ca@W @D@a?Ґ? t* & @ @5@@` t`a@]L ? 'x' 't '|'|t''a@\# @`-b@Wk xb(@]' @ 㿘 ~b@@#@ 㿐@@ ' @] @ `@Iڐ㿐 # @Ēb "L " n L  o  @ = ",@``"@ 2  . @ @ @`""b@V  2 &*@ &"`bȔ@V `"(&@ "$&@@"@x # 2&@@`"2 &@b@V  㿘@)&&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H&H%%&H%%&H&&H&H&H&H&H& /I!#%9-;+ i) ;'*7 $%* @€ $"$b $ $b$" '" % 'ba@ c@V\ @#@@˔?Ӑ? ~ t*@`& "  b @r8c8@@O  2@c`@[  @^@B !耢 ' @[ @ R  @@H  @m@ @@=`< @ @2 @@@ @ 2-`%a@_ @ !"  @@@q`@X 2 ac@@qԔ` @@g㐲`@    @`  @M  ꀢ4?a耦` $ b @'@ޒ@>`?㿐@O  @6  @? ꀢ ` @! 㿘 i!@  b`?  #@N    2b@ 㿘 N  nc@Ua  N  o "b "" % i  @͒ , ` @A)  $@ @[ $@ , `$@  @ , 2*@, $@㿘"` i!@` "` @N /- (+ ) "!v " @K͔! @^a!貆!㿐@3?#@0#@㿘   @2U    @2M   @2F 㿀  @a#   @ cB ҔQ   @ @K< @2Q  @K3 @2 ` @ @K& @2: @K @1`  @ @K @//  #\@K @1 #\#` @" @/ @0}  !, 4` `4 @0q @?@0l  P B`P?  @֔ b N ( 0 f7 @.Ӗ @0H ?, 4` `4 @0= @? @. @01 .6 6@0& @? P B?@ ?#\  0 ( 4@@ @ H@ 㿐"` X@K' `@k"`  $'@J'@L @Q"`"@I @F 耦` ؒ!`"` '$!'"!@"`~   @ b @C@ ?@/ !@/? a B?@J` !P@: @I@0  @Iݐ@0   : @Iϐ @- ;`@IŒ @0;`   @I @-ה  ;h@I @0 ;h#x;p#\@a!贆㿘@6 ?@~#?@C @Ր  @L㿘 @I$@" @` 4 @@  ~#a@ 㿘 h  ~a@#@7 㿘    "%\FaT  @" }?"%\Ua ""0t"& 4F& 0aT&%\ 2.$@ ( :> 8@K  ̘ d : > < (#  ; @/8 @-" d ( 8b @ b >  @J ,? >( Ȓ %:> 8# @/ȕ; $@ B > < d" $@: @/ @, d@d@b>  @J ,? >($>0&`&dx !ؒ@HQ Z@HM Za@  㿘- $0$ X? 8;#S@2Q? L (&K? $*& 4* &@H (   $@H4@H{@Jk$ >   > @ c >   >(   >0&`&d !@G Z@G Za@3  㿘@=;;:t;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;:|;;:;:;;;;;;;;:;;:;;;<;`;l㻀 ~"' '  ;% ;- i+9)7V 8QN* (@€ 'J  F"bȠc8@r @6J@ 70/0@a /% '"b` c@@Q @@Ich  ch '"Đ@=#p  #p@@@~v(?? ~t * &@ `   0`08䀠.`? @0  @#p  @yx @=   @ @    @'  " @5s @J#  c@Vg  @  "@!@( ` "@@@ ch@c@VD @ 6@Ȑ '@c@Pt @@Ѐ  @5O @c@P_ @B#  `@V  & `&@@& ) @50  @5 @c@P;  @ݒ0 "  @ג#p   @ђx " @`@P$  "̖   2`@@0  8@@ 2`@  @n@(@[U #`@@גX  `@)耢 耢 @ ? @``h@U @E@f㿐  @ '%@G@`?@F  2@BI㿘 ibd  bd@"   J@ " @j  @㵠 ~"Ġ'@  #" O #p"@\@?`@ `5h - @@-h'%@Xm Ÿ@) Z  @@!   @"Ā` `В@   @@;   `@T ' <@&* &   ȑ* &*& '@Đ   6 !.  @  . @ @A@Av @L`  i02@!@A@Ad ##;@a$@&@@`a@j`@ 2@@`!(@\@Z @AY@AW@b @L!P,  `2  b0$ ` @W !X@j "Ā`@W   @% b@  b @=!`` ~"Ĵ'   !h@" >bĮ *    i!ap@  i"d` #3"d `-+)@`  2 a!@ ,@`  뀌@`Ĥ!!@!"!@іĀ   p'̒@Ԝ!@/`8@ P!D!! ""!Ȕ!@!  @N. !!@! !! !ؔ!@!  "Ĥ!!@r!  " !!@a!  @" !!@Q!  " !!@A! @@Ĥ!!!@0Ā 2 @Ĥ!! "@ Ā 2 $@Ĥ!! $"@(Ā 2 (@Ĥ!! ("@0Ā 2 , Ĥ!! ,"@Ք@Ā 2 0 Ĥ!! 0"@HĀ 2 4 Ĥ!! 4"@PĀ 2 8 Ĥ!! 8"@`Ā !! Hp@"! Lb@{" Pb@v" T"@qbb@d @EĤ!!@CO!"@R݀b@E {Ā  !D l 2 p Ĥ!! l" p@-"Ā 2 t!" x!! t#@ x " x!!!@ x " x!!!@  x " x!!!@( x m!!!@Ӕ0^c8@Ɛ 8!D l  !!!@@ l " l!!!@H l 1!!!@P"@cX Ā !D!D@#`  !!!@vp#x @m @r#㿐@E(  @6  @L ꀢ  @E `@! 㿘 i"`  b`?  #@U    2b@ 㿘 N  nc@Kh  N  o "b "" % i  @ Ԓ , ` @70  $` @Q  $@ , `$@  @  , 2*@, $@㿘 L@ @Bv@Bs @<  @P @V0@@=㿐'@#1  -, , & @  =   , *& , & & @x 2J&@㿘 ~c@##@t 㿘 @ `8  @_`0 26 @ϒ "0 @ n  * @ h`0 2 c @ a 2 @f 8 @ Ub 2  c @ N "    p@f  㿘@㿘@x= 㿘@W\D]]]]]]]]]]]]]]]]]]]]]]Z]]]]]]]]Z]\]]]]XYYYXYYYYYYYYYYYYYYYX XXYXYXXYYYXYYYYXYXYYdYXYt㻈 ~b خ 'D'H'@t ?D`4@@@ 2 @@!!Հ $!X!$!X@!X $!X @O˒ @AR# j!X@ '3% ~)]+ ~ -gJ / D  'J /D@HfD`+`U"$*` € j ! ;"#@| "a\J #a0@I͐ GDaH@Iǐ  j >"` j :"` ;7# j4" L`"0,`ap @I  j("  j $"`! ;#@F  j" J`#a@I Da@I  j "` j "`@%Da@vH??tD" 'DH*` 'HL`` a@Io @)# # @) #@)   @) @Ac@,@D  `H 'D'H"" `?* : `&U!*` €@a@ G @ @@W!T`# j ` ~#`@ib @@ - @`  ~#`@[b@!^А"@  @ @ "l ` ~#`@Hb`@ɐ @  `  ~#`@<bx!^А"@  @ 6@ O@a @  j ``  ~#`@"bb"@ Β @@@ @ @ .@@ @ y@̒ [@@ ̐ @ D??O'D3^H$@'H@)J @ `DD??'D8@@  @b D??'D# j3^H$@'H@)&  ` @'@ s`D??'D@ G@ @  j `@  @ " 㿘 h  ~b@#@ 㿘@`lL -h`@4/   &@@?@:    @N  $L  `< -1*:  f"  s b0!  L@d#@?g@9` $ @MՒ * *@ `  2 -   - L  $- @:$  @$: ?&dXgggggggggggggggggggggggggggggggggb,gbc4cggd,gggeggge\egfggf$ferrrrrrrrrrrrrĝ  ~"f]`x\f]b̘ @''''''#x'''@$@'#܀    j''@X` j j" "` "cؐ$$@z?* : `9aX *` €@>@,c R ~@'  j `"^@%Ɛ^@ 5@>@ c 3 ~@'̐ "@   ~#c@f@ $@>d@c  ~@i  ~`  ^ ~#c@D}`@ 0w@>A@ǒcЀ  ~@@ J@ \  j `" j@  j[" @>&@c؀  ~!#%')+-/13ఞȠ a8h!aخ"b8 ~#\#`#d;h;p;x;;#c( H@`h @=@pbP  ~@>@=ڐ@`bX  ~O  ~#@’b`#bh@@= bp@=bx@; 2a ~f ~@=@.b T ~! j  ~#@b$  ~b@# `$ @=@b 5 ~@  @=z@bȀ & ~@@=k@bЀ  ~! j  ~#@Rb$  ~b@K# `$  ~#c@Az"@ @¯#0㻐 ~"Ĭ`' 4` j `D! ~#)' h%#@@@)P"@Ӓ$ |L"Ѐ  #@@="Д"ϒ "Ѐ@**`J "Ѐ@* *`J@ " " "*`@"В'`4J@ 2%`@-$n`@t"ВJ@ 2%`%`L"Ѐ /"А @H$@ Ő@`@ @R` 60`! ~`4cP#@ ???" 2#@ c``#@ cp`#@ c `bp@ܔĐ#@ c`` '@'```$" `*@ ``'``@V'@ @#㿘NN "  " N C @ "?.@! ~%#*`:  \ ' N  #@ K# "" .@ ` N*:  N`@`2.@N  *:#@ *c?N   2ʑ*`.@㿘#@zc  !#@룔  2N` /2#c@J@E@L`/ . L /   /`/ L /`/L  .?N /".L :# LL / 2 $  N . $?@"@$ 2L`@G  2L?@` (?N / "@L ˠ 㻀 ~"ĺ'@Ɛ   j`   Ւ!L2`J `: b@ s  @@;} @;zW"  @"@ @;n'~7- ~@  2 @ e@/ @ S`b@ C @$ (`H@ D@$ c# /,`,754/   jՔaL2J :@ `& j `  @ @z , @ #P@ $0 @Pʐ@;`  @   @   ]@ `p@6CbĖt@j @y`bİ - ~ @ ?: @ Ԓ`p@6&b @B x㿘@&@ Y`&J   j ? 2 ^8*J   j`" 6Ւ!L2`J `:   ^@  "    * . ` ` X *` € ~#`@     @  = #@ @  / . 㿈.`* @' '' @*T &L  'L  ' *2 2 j   '@=R ' Q@=E " @@=>  ' ~.`#@;f* @ jࠓ*`@  ' ~@ @  `@ 4  `L ?"`` * $@`/   4  @ ݒ -L ?`&`@  * $㸐 @`  4 - @ `p T   㸠%`?`$``@ * $@_?2`&耤{ 㿘# j!@5 `  !L2J :@ `  1&" ".   @9 0 㿘@  j `Ւ!L2`J `:  ?@ ~  &` 㿘 @`㿘@> jJ `i #؀`"#@" @" @# @&"}~ }}p}T~dd<<}p<㿘!L j 2K @ :  j `! ~!(!0! ~a @ #`#`a8@ ( ~bդ !L j`2'K@ @ :@ ` j j `4 ~#`aH@ ה. `` d@Ɩ@@ a " @ 7@  @ R@ }  4  @!h㿘aL j 6`J `@ : @   J ? `2@  㿘 j ` ~#`@ wap!` @ 9@  /`Քa2J :@ `&`+ j) ~'#` " L @ Ӑ#`@ TL  @ w@ O  @@ 4 `($ $`(  ``@ 㿘aL2 J : @ E  @Š  @!Ґ!2 @   `@2`     j@ -@   ` @ u ~#`@a@V ?   L2    L    ^ ,  € j` 4̀ @@ ̐@)@ a@` j` 4`@  4 2L@ @S@  j` 4  @  ~#a@ 0@ &` j` 4`@@  ~#`|b !@@ o@ @3` j` 4`@@ t ~#`Zb 4 j` |4@|C`@b00nL ` ' j#L @bP@R@ *2L@@2@{@' j($ "(@ 4`:@:@  ~#`a@0* j `& @& ~#`bx@  ~#b@ޖ0@ ~#b@Ԗ0@ "@ 㿘! c@  , c@P c@I c@B c(@; `㿘 j ` ~#`@c8!`  5+@0 * L` &?aL2J :@ ``` #' j% ~T  2  @`@mcX@@l  2T `  (`*` "#` +) j' ~%L  2 T  @ cx @`@?X@f@>  2L ` `2`㿘 j ` ~#`@'c)( (  "  @$@@@ 2 ( (  #@Ȓc 㿘 jJ `R  j `3 j ~#`@c0 ` ~#`@`! j @@s Ֆahբ`@b` ; ~975@c@ ժ!h)' ~%@f  @s@9(@  @G4 `@ @   @@c@]!`@C 2 @Q`  2 @Yx  @  ?4 @@   4 ` @C@&``@ 㿘 j ` ~#`@l` 2!h!h@ f @ @@ a`@@@@k+ j%բh  @ G4h@@` @ͬh)@ `!h@ @`@@`@"@@1/ ~-h@ @Ð!@(@   @4  @ @@@ @!@l@ ^ ` 4 @8㻐 ~ j  Ā`' ~#`@ג`!`  3@o )  &!`  @=@$L` @3@   @+@   ?4   2 !` b @ 㿘 j ` ~#`@`!` @ @$ `% L  ?`4  ?4 T  @4  2 `@ 㿘@}    ~#@\a  @2  2  2L !(@L   @a@㾈 j  ~Ā`' ~#`@-a jaX aH$ @  jJ` r  R aȔ$@@"Ȓ*@ !?  a@!͐  "cԀ?@6 ja@Bs  3+ k!XH$@ L`r `R aȔ$@t @  Ȓ*@ I!? a@!   "c؀?@6c kb@B?    / %"8h///7'/37 l#/9)d'r  4h`& @< @ c@c@Ȁ &c@Xc؀ @@Ȁ  ~@<"h ~@cؠ@ @"@@c " $ " @"㿘Ք!h`< @ @   @     㻈 ~"Į'@ ƀ kĐƀ  d@$c8# /,@`,@!#@ @#ܠ  b@   ~@# ~#b@  b@r   ~@# ~#b@@#܀ %- ~+,@ @$ c@$0  $@#ܒ@e@ܠ@܀  @J# 㻈 ~"Ġ'$@ O'쀢 /  % 'J / @ "  0@ "J@  @#8㿘@  ܢ @ @2@0cܰ "   @ 0 㾈 j  ~bĶ ' Ġ @Ò@ *rĀ@n?#+) ~5/a ? *  *@2@ 2@ &   * 2` 4 !`"   a ",  , ,   c$ "  @8  j   ? @:* j`  #`@H   #`@ `   ?    c@#` c@#`@ @ @@ a @^#Ё㿘 ! l  ̐ ? @d6 % l#Ր $"@ a#Ԕ2 @0$$  ̐a@ @1V  ̒ $ $Ё㿘 l  # l`!`̐!#Ԕ$" 3 @0۔ @r#"c$`́㿘 @1!a " ?# @ `*`2 @&@&@` .` @W@1 ` `6`.`㿘@@@ | ~#c@q|  ;   @0~ c&  @F$& 㿘# j% ~)-+'  2  @3$  $ ` )@D4   @` $   $"  @ ` @,`  $  `2  @0 2 !` ` " `H@ 㿘@c  @|   j@   0 㿘@3@,H㿘  @0   "@ @㿘@V ?" @+a$ "" @3q ` j ` ~#`@ǒ`p jJ r R ! k!X! kaH @$L Ȁ #  @a  ~ @.0c0f`@I 2 @ ! ~`@##@`0Q ?4 ?@-M i x``3 ` @, ? `@! #`2 j@ !( `2`@@>@3@/@/*@/'` ?4`  4@  @@!H@s㻐 ~"ĸ'@ !h@&@! 6`@z!B !# #@(@` `2բ!h57) j- ~+/d$@?2  `@T`@@>~  2|@V3?2 |`@a`@@>l `ۀd@2@2 " @U" 㿘@N   ` @$m  2`@z"0`! 0#@Ő* &@#* $`& (& `'`('@2ɒ#'` #`,@2''`#`(@2''`$#`0@2'`'`'` '`  4''@.㿘! 0@#*  "    2  㿘@  kJ`Ȁ #`@9  jJ`Ȁ #`@2 㿘 !`  #@Xc*  "    2  㿘 !` *"@#@5c* &` j&` " ` ` !`2` @ܒ"` `2`㿘 !` *"@#@c* ``2` ` "` "` `2`"@㻐 ~"Ĥ ' "3 N / @  *@ N` / @ **@@ " *@ " @  2  "  N    2N  @#㿘@ /  , / ,  N  #@<㿘# <@ (  / `&@. ?.  @ `#(@㿘 l`؀  "`&& & & & & & &  &  @" $ 2@#@.   /`ڐ  #h@@Ȑ&@.7. &  0)@ @ @.*&. &  & $  2& @Ɛ#&  & $ `  @#㿘V  c@N  2   c@  c@  '# l `@   `0`   $  `0@~@6@o`& $`؁㿘 2 `@@k " @&  & $ @ / @P@-&@-. @#@   ?6 㿘 `2 "`` `2` "``@0`X㿘 @ @-l ?#   " @'ې ? @  @㿘@-P ?c &" H j `  ~#`@5` j ``@Ґ 2  @z  @֒ a` ?  4 -  $   @,:   a`a` E  <$@ $` $` $`  $` $` $` $` $@$`   `  $`  ?`` $`  "  $`  "  $` " $`  $ @+  2a` !#,@ 2 ''  @+֖ #!T''!H'a`'!\''Ȓ ' @+ `@@ڐ!!@6@ j ` ~#`@uaH a`@+Β "c@!   "c@!h!   2 @ɔ 6 @!!@@> h  @!!@ @ ڐ 2@!@ ؐ@  6  j@w"" @Ӓ jJ `R`r%!T耢 ""`"hbH@4ǐ  j  3!h"!T"aH@@@"pܑ*"@  "!` ""cܞ  ( `*` * @" #`$/* @*` @ " "+  * @"`*` * @"`*` * @" `*` * @" $* Ҵ@`Ԁ$׌xLXl㿘!\ j`А "@G  ~@C  ~##$aP@ : ! l$ @ :. @>  '@ b@Ő !'"@耢 $aP%"@!@# $aP#@9ǐ  l` "`ϐ @$㿘# l`Հ "!\! "@&@̒$ $ c@3 $`( j`   ~#`@c8 l ` ϒ @  l"`# l l 䀢` l" ϒ @q  l"``  jϒc`@9q  @"`!\``  " j `2@3Ԧ@{!H ` l j Ha?`$ #a @g ch@3~  ~#@(Cc`9Հ 3բ/% l+ j-)75r)1r j  a:"kU!"` #!!! 93բ/% l+ j-)75r1rR!ސ" !"``  jJ `tH@H##&aH'!T@c c@8 #$$ܒ?@($ܐ " c@3  c@3 @ ` ! ~#`@H`@ (@vHH H`H@2 ``*  `%` ~#`@/`h` `@ʓ2` %!4@א x!4"a x6h@ܒ!H "``@2Ґ  `@2` %!4@ !4"aL6hx@Ò!x ~"'D' '䀠' l"!"` l`䀢  D @  j `Ǻ0!; j' l`䀢  j@* J R rR!h`  D''p`39 ~a 2!#\a!8a`#@/75)!@#ؐ@$ 1 ~/75լ )'a-@@ !#@@є$  $a#@ ~#%@}@YP@3$ @Ő @W,@   #@쀢 @_쀢 ޒa` *@2"@! ~b(@G#b@@C#Ϩ bp@<#@#%բP@$ P ` @} a@,@b@ O@  ~  @\$ l ` @  l@}  l"``#b@ "'`@'`!\В`"@  j `! ~#`@` ~#@b'``@ ~#b( !H p:` t 2'!Tx:`  | "'@! ~b@#@aH#c@'`! *  j@#! р " l  ~#`@c K#h G` l >" @ϐ? Tah8    1Tah -Tah l` ?:  "#Tah `耢" ? #h#p ~#c@@R? #@?Tah  ` ' ~@#x" ~% l #h   @z? @ɐaH@ZaH쀢  ~$!@  ~ @#㿘 l ` !T!h !h`@#@mc!`` !h4!h"`"`@ "`$`!@̒ 㿐 j # j  l 䀢` lc@0  7`'@  0  l` @a @ 㿐!Ԥ!H#@' ~`0 @`##@'@ Pc`@`@HLc8 ! ~b``#bc8@b#`@bxՠah (   2ah$ @'#@*' # ,@*' $ @ ` ''ؒ#@*' $# 0@*'' <  @  @"{ j0@ ~@' ~(@C @ ~0@  ~`@?#0 j ` ~#``@4@ 0 j ` jB "   @Ӓ@԰ 0 ` ~#``@ Ґ!rr!8*8a\@$!<!<  j ` ~#`a@ @E   @)  j ` ~#`a0@ߔ j `h@ 0{ @  S!P@4z@@& @w\` j ` ~#`ap@ j `@d 0Q@]# +!@4R@s@%@O4` j ` ~#``@ j `@< 0)&@!#р  $a0!@@- 0 @^ a0@a0@Ԓrr L@(`@)a0`@%3ؐ@%0 㿘Ԡ!H@ !H  㿘 rՐ!2h@?cx ~"?H'' H(? 'D'H` `Ԗ !H?cܠ!H' 2 @ѐ! U!@@ɐ! l`쀢   l@Ԑ!  ~ l "Ԑ!H  6#?c?c# + lc`cN .*` `'@0`܀ &#: @Rc  c $8 ` *`  `D€'06 c    c $ 0* *`  D€'?c 4$ c $8$  H€ |B?? 4  ` ԰!H  L " @  0 &pc@!H %??    !H`B j ` !a ~#`@;a? $   ?*` #D@ €@Y!H l"  ~"@ @"(㿘 j `a0@KJ? Ր!h @ b0@3 㿘a0   @$ ?  Ր!h @ b`@3m 㿘a<d "a<!ђb8@- ѐ!8 @m$㿘!b@- 㿘!!4@$[!4@$!4㿘@r"a4"a4㿘 в`    + &` !\+Ѐ/ l - l`  "?$ \% \ *  `@P  l`@@g䀢 \ @䀤   j ` ~#`@mb\% 䀢  4#  \* 䀢 $@`Ǥ#  j ` ~#`c@G #: % [! ~c@@:#R!h`!h``@(cX j#@"cp j @#@c j #@c j `2 \@ # \@Z  * `@#`@ 2  l`<   @# ? 8 `? c@2d (  j ` ~#`@ڒc䀢   j`%  "`0\ * @ y`Аa@#Q$ `&`$@#K l `""㿘!\ "$ l Ѐ"`!\@^*`   l`!\@u* `(@2  j`8 @,>$ : $!\`"  ~#`@t`x㿘 l   l `@ @& 㻐 j  ~ĸ `'::"l %U! !?# ?*  *@2@ 2@  а !!   j ` ~#`@.` $!@ $!`"d@:`h@ :"k ?c ?*` * 2 2 %   ~`@#` $@ϐ $@"HD> ===`;=  &>PT>& >&&6 &&>(&H>X>`&ࠐ@"X!Ua&`;k"4*` €3&*  :3>(x 3֐ &a,&:"l@&3&L0|8=`= > ==;  >>>>>X>`>P&<&4 @ 3 3aU!`&V$V&&& j ` @  " @ݐ Ё㿘 " l!`!!! ~`@P###@#a@G#a@C#c lo"  c %'C!?`,) ~k"L*` €! ~a(@%#! ~aH@#! ~`a`@#! ~`ax@#! ~a@# `?  a @##@a    "  2   @6   J 2 `@ &J  $$!$$`㻐 ~bժ h'# "`@2h "`"`' l U!@ $% $P H#: @ # ?`Z*`k"` €  %բ L@ " ؐ  &L@! l  $ !  H#: @ #  4 !h" "  " " H" \" 4"( d"  <", T"$ L"0 (:8 "!`!h"`!!!h "`@@ "!H@ "( "  ~#@5bHb$ @"p㿘!!`  ?@ R?#??? @*` @* 2 @ 2` @ R!ހ@  h@ ~#b@  㿘 ~'H'L'P'T'X#@H( ( 7?? (7? `? (?ػ/`('' ( ?@? P ;??p P?Ĵ?7` P( @?./`''' (? P?@?X 6.tp'''''ij/`7 ('h' (9?# ?h P ?@'(6'|'x'\X?ȳ/`7 x|'Pt/`(''l' P h9?l/`@#'0(?(D@?6'<\7`(?x''T'd ( (9??P/`,?0hx'$hP67 '`'L?` ( @;?c5?6'8'?@ ' ' ' 5?'| '\ '< ' H 0 4 8 <@' L' P? @?.`+?pP(``) ?Hط./ /`(''''|'0\(<..'x'X'8'@/ Ļ7`(((66''''' ' ''< P @7??(''? / ' @' (' ' ?.' ' /`' 'p .'` 'P  / '@ @'0 ('  ?''H 0/ '4 0@'( 4(' 4'  8.' 87?' ( @@@@?@6 > P X ;?& 0& 4& 8& <& H& L? `?#?x#?# ;??#?0#;?c?H X? X? `7? `?  ` ?# `?#?#??# @?#?#@?# ?X#;??ܻ/`$((../ ''''''̻/`( (\.L./ ''P''''@ X 7?? `@?#?`#@?# 7??đ/ 6(|7`0x7 '.0''4/`0(''/ 6@''p'('' X `? `?#?@# `?x#?#? d(6'''' ''''T7 /`0`'''Ը .0.'P'''''''T'D7`('@'/ 6ОP'TĶ@'''X#9?# ?/`|((.4./ '''''t', X5? ?h `@?#? #@?X#5? ?ķ.@'|D0(67 ''4'0x'x/`.'|6'l0(й7 'h/`x|?ȶ' ?'''04?'<Іhl?'t?@P@?8(d..Թ/ /`'''\''̅('h('\l6$.X0( 'X'''/`\'6.(0ȴ?X\7 ''d7 ?'p@?h'''?'T@?(8? 7`@0x0667 'p''''8'#5? ? X@?H `?#@?#5? ?@#@??@?Xh?H?ظ@? ?# h5?H7 6'`'D? X ?06' 7 '| ` 67 ''?h# X@67 'P' X`p> `HD,@( Ԛ@>#@ 0@>#`p>#>#@6 && & & & &"&#x&#|6 $㾐 ?   @  @ ( ,5? T@ X(' @* '?*`**+/`/ ..''''h'\' ''' ?*' (@' (`' .*' 5?@' ' (@'d .`3? 'X (*.'$ (3? ' ,.' ,5?  T1  X@ .` \5?@* ''@ 'А 'h\@ $ ''-̗26`602 ''''' 3?dcX 60'p'`'T 5` 'D "? '< $#'4 &'( 5'x 'L " '@6` $`'8 &3?'0 \ * 0`'Ȅв@'''`T@@ 2 ''' 2' 6`' 6' x2 *'|'tp 6` 2'P2 L@D* 'H@2<* 824* 02(* ',2 (@ ,2 2 T@ X2 2ܞ &Đ &  &  & tP|'lH@, & , \& l66 & & 6 6 "6 $6 && (& T& X& \ `? 5?(*60''& `㿘@ /  L@*`: /2`,@̐ 2   K@y  4 ,@`L@  @㻐# ~ bĀ` 'b@U  6 $@А>@@&. @,b @#㿘   '#%  2  2 c@ c(0@@N$@㿘 j ` j@7  j#8@0  ` ~#`cP@4㿘N  ch@飐 j ` j@!   j `@6 #@h0  ` ~#`c@ 㿘N  c@Ð  c@ ` o6  j `  j@  j#@80  ` ~#`c@۔㿘N  c@ ` F6  j `  j@  j#@0  ` ~#`c@貔㿘 j `% j@ 6 j  j ` j@K-  j 0@ޒ  P@9  `   ~#``p@s 㿘!`   !`J` !`` !`  㿘  " ?J` "?` ? 㿘! ~`@9#貐`@2# 誢`@*#  "  `@c  "  `@c  "  a@ c " N ~a@cN  2!H!Pa8@c aX@c@@!p㿘!!@a@$$,!@  a@j$  a@b$  a@Z$  a@R$  a@J$  @aȐ@B$`㿘ؐ    Ւ?!L2`J `:  ~#a@琔㿘 ~#)%Ւ!@煐@aP`? "`@ @  "@#  ` "P `    aP? "@ΐ P y nΒ! y`?㿘 ~'H'L'P'T'X#@oH j` "  " @@ 㿘@4 @!Ԁ $!D@i$!D`d@ @ !@86 㿘bX@̐ 㿐 l!`! l"x@?b %!b@ @*@5r $!b@ !@̒@ 2b@$e aD @  @  D,@N 2 @) $D! " @MD!$!@@!@ 5a\<* ''('! l<'$ a@?c@  a@?c@  $'a@  @  a@!   @  㿘N # *`: a @ `  2  _ - @:(   N  㾐# ~bĠ'!@T l "a@b @"㿘! l! "@c$!p ~"Ġ' @)#@  @q"?@#a@@& 4@ @@a@ @#p% ~Ģ'  @@!!@@;0!@@;,@\#( @]#0@# ~bĠ'@ P@Ґ@-#Hb @B#P㾐 ~"Ę'  ?X!@䲐#`@ b @"#h㿘@@@:ے@ @p ~"Ģ'@K OЀ E F AА@A$#x@pr@$OЀ F? l"!@s@J@ "*@#kL @ސѰb @ʐ#㿐a@ @0 O4 O㿘`* :`` ,, ` #9,#5 㿘@㿘@}@㿀'`'  @%8 2a8 @ 2] `&` 2 N!@8@UN u2 Na@K "  N <2  b@@  `( 4*@  @/ `" @8@*J`"0@8v@  `(* N ^N `(`? `-   * `(*  &`  㿘 b`@U b@R 㿘 " @| ` `%   @ @|  2 @x#@w"@|ܒ㿐'H@ި : 'HȐ H+ 'H/-@ޚ = 2,@,@`@N@ c b@ެ 2N@s&  i2 N@c@ޟ 2N@f& i2N@c@ޒ 2 N@c@lU& $ l2 N@c@ށ 2N@H& o2 N@c @t 2N@;&  oc(@g  c@A*& ( `  ' N@J@2  @N 2  ? @$  , 2 H5H  H@|貒 N@ i㿘@"@㿈@L@ -2&` &`` la̘!' @Ė 2 # 2  ` #@7T@  "  & &` @7C@ @ 㿘   D@z 㿘  " $@0 " `  & & & & $㿘@  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@< 㿐    ``'@_   '``@W & 㿘 @ @x &  @$**@"" "$@$   """$ "     " "  " 㿘 @l @vt & 㿘  @0 @7Đ  ?` # & & 㿘@N  & 6 D   $g`  ˒  " " " " $" 㿘 F 0@{ D㿘@v+ @{  8㿐 `'@Ɣ `@@  㿘@`n `P@  㿘@`o ``@ 㿘`p `p @ΐ 2    ` *@&`   &` U&`  2"܀`"ܢ @ܴ 2    `*@&`  &` ;&` 2!`! @ܚ 2    `$*@&`$  &` !&`$ 2"`" @܀ 2    `*@&`  &` &` 2   4 ~"Į') ` *`  €@z[#@zV#@zQ#@zL# @zG##@zA@u}@uU  @z4 (@z.`@@z& 8" @z P @ X! 4  ` `@@  4  h `@@$ 4  p `@@  4  x `@@  4  `@@  4  `@~@  @t@  4  `@i@ @ 4  `@^@  4  `@S@" 4  `@H@  Г4 @>@4  ؒ `@2@4   `@&@4  `@@4  `@@( 4 ! `@@4 @"! `@@@!  4 ! `@@! 4 !( `@ݐ@ @ 4 !0 `@Ґ@  4 !8 `@ǐ@4 !@ `@@" 4 !H `@@$ 4 !P `@@( 4 !X `@@4  4 !` `@@ !p @@  4 !x `@x@  4 ! `@m@  4 ! `@b@ "  4 ! `@W@ @F! ! @I@  4 ! `@>@  4 ! `@3@ @ 4 ! `@(@  4 ! `@@  4 !Ȓ `@@  4 !В `@@ "  4 !ؒ `@@ @!(2 #4 ! `@@ #!""  4 #4 @ِ!4 @Ր! 4 @А"4 @ː"4 " `@Ő@4 " `@@4  4 " `@@4  "( `@@$ 4 "0 `@@4 @"8 `@@4 "H `@}@" @j"P ` %` @@ dX@P@c` @ 2`@O D@K   `2 "hbp d,`` " ` @%@(`  @^@ 2 ` @w @w` @ ؀!@ww"p"p@wt  @y"x㿘!"h @wb P$"h""l㿘!"h  "l@wR"$"h@ "h@`H @wF""@wB $"h@w<""h@$"h㿘 ?  1"`@ݻ &"`1 " "` M."` -*  ^* ? *4* ^*@**"`@ ~" ~'H'"p '% ~'H@C?2 e"  f a t+ gt% ! ;#@  '#b@  t@H*` @qɒbtH*`@ ] tH* @ 'H b@ `@l b@ `h@a `@w"耦` `H H` HHH''@ OH +L =H 7H 1HJ@? a   `  H@j@@qq@s'Hb@l  He`'@1#@/H 'H   @ c@4    `g@ڔ @v#( @#8 㿘 h  ~c@@ݕ#@ 㿘@2++++++++++++++++++++++++++++++++++++++++++++++(+)'%!#/ ~597 -* b@€  %"t  $p $x $"@@Bo`??t|"* @ & Ԑ "  . " `. @@` @, @f @'@@a?@ `(@ <  "@@  @@  `@@@>㺰 ~"b ' @ʒ  ("t`<  2 @g "y ("x`!4 \€ (<  !@  X (#$`0@ۖ#( @g  ?"`0@uJĠ@ $  @m 0 8@@ "p`2'  H@0   "p`@v-  @gR`2 "|€  (@u İ  @ p㿘 h  ~ `x@4#@ 㿘@V44\45(553,3,3,3,3,3,2d3,3,3,3,3,3,3,3,13,3,3,13,3,3,3,13,3,3,3,3,3,3,3,3,3,3,2 202@23,3,3,3,3,3,3,3 3,23,3,3,23,32>d>p???>???>?>??????>㿈 '/;! m) - # ;/ 7+(' 5l9 8g* `@€!$  @  $!$['!$  @  R$!$!$  @   'G$!$! C%! ?%!$  @ z 6$!$!$  @ q -$!$c*'᠐ &%!$  @ a $!$c@մJ cJ `" @ Qc  /a %a $@ C@@؀?? ~`t!$*@`&  $!$ !$ " @ '!$  @` "(  `@ز! 6!$(!b@ ?`*` € @ @ @l @v @ @ (@\ ᰐ@  @ @ؐ @I   ~#`@0  ~* c`: @M @ Yb?  @   @ᰰ`@w# `b@I @  @] @0:a 7 `m@ 0c@,   ?@  @   @    ``@  ᰒ @ @ !@  !@@Ӑ㿘@_  c @3 @ !&&& `&$@/i 㿘 !W&&6@ (a6 e`g@  @#8  㿘@e> "    " #P#p##@-0"@sz㿘 !` `s@I  `8@  !`  e`r@7 `P@  e`e@+ `h@w 㿘`( 2 @"&`&`( @!@ג !Ԁ@ J `@ *J㿘N`` ` @ʖ`N` ` @` @D`8  m * `@ٱ`(`@٬`(@٧a`,@٢a`0@ٝa`4a@٘`8a @ٓ`p `< Ba(@ى`Ha8@فb`JaH@wb`LaX@mb`Nah@cb`Pax@Yb`Ta@O `\`',@C,` v  m P /-+` @  B a@)` a @  @+ B ; ᠐@` ` @B @  `  *@a ` aȔ@ ` - 2,` ` ,`: 2` - a@ ` <  ? * "  2 *@ -  a@̐`` @@㿐 @2 @짒  !. 6`  `6 @웒 @(' !艡B* : `/D!*` €&(''!聠B8' !艡B !@! @"@"@"p. @ @/  @ ? B ? @ B ? @ @ B     ?*@ !   ?*@   2  *@ "    `*   @ 4" ,`   @B  Bb#\@a0:B#h@ #d#l0#\#`@a    m`P* @bP@ܐ0 bX@א  @ b` "В@bx@׻b@׵ .b@׫ ?`&  * &@, 㿐.>`  ~!*`@ R`(! b@׉` * m  b@~b@x`bȐ@r bؐ @l`b@h`X`b@a`X c@Z ?`&  * & @,`(@Gc`,@Bc `0@=c8`8cP@8`4ch@3`p. `< @ ;  B i 9?`p`<  Bcx@`HBc@ @ `H@c`J@c`L@c`N@c`Pc@`T`@`@@`\`   ? , `"? &   %.@P@͐.`X@Ő ```@־`x@ֶ`  F<` @ ~"Ķ m'@ԩ!?@\`Ȣ ?@("@oڒ! @"@հ@pLv    ސ`@s`@o@՝!/3- Q+ !@R@" @ Ԓ@! @{@nb ~@$#` ~` ? "`@ծ   " ? ~#`? $`@՚  $` 2` n N@? @ 2Xb@o^@oא!  @x"ȁ㿀ؒb''"'@~' ?J @t"蔒 J "c@%8䀢?J? '@Ð  @  @  @ @  `#@mG@ @``@n ? "2 @` " @`@퍐 @튐 @퇐 @턐 @@`"㿘@hcL  㿘1@`]#L  #, @hېL   㿘 !L  ?   ` " @,, 㻈 ~"' 6`r&`  &`c@w ,@ "@a :  # @(Ւs-c8@v =  !c@@  m! m  <? " @ A *?   # '耢#H@(.6`cp@5 0'耥 )M %'%!I@"x  '@  '#@(e L@ &`Xc@ + M `\)   ?)쀢'#@(;, $ Ӡ L@ π  ̐cА@耢  ? #@( 6`6`"В`@ι  ``@ΰ `@)G `@Τ    ?֚ '耊"&`( @'`8@·    ?  ' @'Ȓfd&`,`H@k    ?  ' @'JH&`8``@O    ?  ' @'.,&`0`p@3    ?e  ' @'t&`4`@  ? H   @'W 6`p&`<`@ ?   #)쀢 ' @'9׬6`H`@ې ?   # 쀢 ' @'6`J`@; ?   #쀢 ' @&6`L`@͡ ?   #Қ쀢 ' @&}6`N`@̈́    ?  ' @&Œca&`P`@h 2 @   ?  ' @&GE&`T ;L` 7*`: ` - 6`* >@T ? d  !(@&t 5` &@  7 ? G  !H@&W 5`%` C-`  m`P  X   " @- P *L@? a   `      '$:  '쀢 耢 !p@&'-` `  C$ ̐   ?ݚ즒` !@% ? ɒ   '@@v @}@n@k?, @s@k e-` !@%\   ?즒`O !@%Gr ?    '@?@0 @7@(@j?, @-@j -` !@%zB?   #S 5`$: 6`!@%c$@a s@İ`?  @ !!@%J㿘 (  ! , 2 0! 2 4!@%0 0  2 H"@%'   H 2 8"(@%  8 2 p ,@ 0& 8 p <  B 2   8 4  @撔 6 p& < "H@$  `@\B ( @$"` "@$  `@\1 ( @$" `"@$ڔ     -  a* 0   @  B   B  0 ( B :`@$ X * (    8@  B @4 @,#@@$:` " X   8@  B @  @,#x@$:` X  2   B " B @$q#` p      , ~#bP@ˇ p0      B  ~#b@s>0 4$* 2 " " " "  `*`2 6  $$$$ @    @  @'+  @ b  2@(  @ b  + +   4 $4$,  , @d?*   , 4@ z 2"$@ 6 2$@ Œ 2$@ " 2$@  2 $@  $4 㿘"b@v 2  ~"8@[c0@* >    ( ~#bP@Ô`0/        B   ~#c@ʬ>0    ` m!*  ~#@ʘc(0@ 㿈#Xcp@# 2  ~"8@c0[* >?    ,  ~#bP@p`0J  ` 2@`    B 2 @ ~#c@Z>04`'`'` ''@ !@ z @  @ f @  @ T  $@$`$`$` 㿘 #c@ 2J ~"8@c08*@ J02    ( ~#bP@`0$  2    B 2  ~#c@0 ` (@ @/&@㿘`#`@i 2  ~"8@Nc0;* <    , ~#bP@ɶ`0*    *`0    @ B  0 ~#c@ɠ<0 @ D <@   H@a@㿘@    @ F  @ 8?@  ?    㿘  *b' ~!@aÐb$@ 2b ` ,b X ?4  " X* $ X @ ! b@> ?L ", L`?@5 Lb`2Lb@f$Lb ?bp'D ~ 8'X'H` X '@O  ~ / ?/9H@a^ $@ ` ` /`X ?4`  "`X* $`X @  ??@ڐ L O ,O ?O@ϐO ? * `O ``h`qL`   X*`@ R` cD k &"P b %2OYOU"D m gOLOH8C,D`(,>  (d 6 @Ӑ$D(D`(@ @, DD?`p<  @B Ȗ@J$O @ر,` Ȑ$@:?O + -/@S+'"@ؖ@S%? (08@HPX`hpx(08@HPX`hpx (08@HPX`hpx(08@HPX`hpx (08@HPX`hpx`" J` @S "?#? ' B'؅ ЉD?@ۘ *`:  + -@Fhdh=?D9 ~`X D2 ~@ 8   F@,@%@V`B @@b8 @F? @ @b В@`) ~ @|- 㻐 ~"Đ'@` "  @ " -`@ } ~#`5;79-@@      @ @ C  B @B 8-`2U` Q-`@@ll"@"2`2a`a@_Ր`!h@_ѐa(    # ) ~`'%$* a`a@_ap#/$@ O X` ?"` X* $ X@}  O` ڐ?* * x`-`@ --@`2|  ~" @{! ~"Ĕ!X'@(@_l! m ;975/ ~  m*` a!褒 "@@    D ,`` @ 2` 7`6 @_8"Hh@Q`  % ~+',`@_+b 8 `∀` 8`@=``D 8`,```` ?"``* $`@   6 "b/ @@ /-  +) ~ ,  #\;`#hf? $?c@# ,& ,/-  +) ~ 08  #\;`#hB(? ?c@ђ# 0& 0/-  +) ~ 8x  #\;`#h`? ?c@# 8& 8/-  +) ~ 4  #\;`#hȠ? ?c@# 4& 4)@'+`0  @  B 80@0  @ B   ~@ p *  <3   @  B @b h@g B  ~b#`@ž p <  4  8@  C  @   2   ;`#h#\  ? B?2  p2  p ~#@c p < @ B  %@ +`   @#B #s p+`@r P2`6 p ~"8@ݒcc ~ ~c@֐"8@ޔ!X ~<6 p& <'%  /- ~ H *2  #\;`#h? ?@ H6 H/-  +) ~ J *2  #\;`#h 0? ?26 Jc@}# J ~" @yc!x㿘" @Д H           B (# ` ∐b@  ba@3 b@pb X@;@ " N r"bX@O. `@ 2` ?* 2  r@@"h@\" ma )% ~;97!.`@@\ݐ"` "@```.```? "`` * $` E6 @ ' m/-b" "b@@  ᤑ.`@ ",6 ``(.`@\Hh@` !.`@@\"` "@```.``` ?"``* $`@b Őb㿈'%/2 p@8' p  <  @ B ;`#\#h 3 p   < @ B -+)5    #@@ d  `;`#\#h(cH  2  p ~"8@Cc0 p   < @ B @b8Ӓ ΀ D=#=㿘 2 #b:bД  : : :    # B#  ; (c8  @ B :  f75bБ.` @    B @B @C@8    2 ` (``     B       892 `(`99  ``@ 2@bЗ.`    ; : p <  @ :c:#㿘J  @  @(` `(`@ b @ F (`   㿘?* : `6V*`#d €@Ɛ#@Ð 0O@!0K@"0G@ 80C@!(0?@#0;@"07@#003@ 0/@!`0+@#0'@ 80#@ 0@!00@"@0@"0@#P0@ 0 @{ h0@w @t!㿘'   "@d @튒 2$@ @   " @$ <㿘   `" `2 @ ` ``   ~"Įp' @ t   , @ " "@ "    `d#Ða@  N r Ô a@$@\ϒ / "`N@`r2G Ô .@$@Ԙ`.@@ݐ?, ‐@6O @nc  )  " m!(b@t   @*  ` a*@ @#\#\@  `@ 2@@ΐ  @v !@㿈.` `*`2``   @  B  ` B  ;`  #hÚ#\ahHX   ~ "8  # ~#@c ##@2  ##@ ~ ` ~##@9apf `2 `  ~Ð#@-aZ  ` ,` ,`  @+  @DÑ+ 81  `8+ `82% `  4`$` *`2`    B@ @b  @C 8  @  $@4`   +  Ȕ  ‘+  ~"8@[c 㿈*` @` `  `  B@ ` B `;``  #hÖa``#\   ~"8  ~#2 ` ~"@c8 ` @  B   @ @  #B ~Ö@ #b@jc   ~ ( &@Ð#c@[ &@6`  㿈.` ``l@` 2i `  ? *`2 @S*:    ? *@ :`  9è  7ì  51 ~;`#h#\#? &?@쌒#;`2@ #@=@@6@X ?, @X .`  ~"8@kc .`  㿈.` `` 2  `  ? 2`*` * @ڒ :    ? *@ :`  @ 3 ~;97Đ  ;`Ē(Ĕ8#h#\? J?$c@,:   @!c@v`pԐ @ո@  @@@c @Ւ@Ԟ@@˒@Ԕ@XJ ?, @XF .  ~"8@ɒc .  㿈.``` `5 m!*` Đ!0ƒa8 #  D ,`` @Ð 2`.` 29 `(6 @Wv!h /.`  ~"8@늒c) /-Ĥ  +) ~`   #\;`#h֔? ?c@e#` .`  㿘. `E A ? = ;.#!Ā /@ @@_ *&@a@q  ~"X@6c@b"Ĕ"P@   ~"8@%c bP@B 2N@  @&@ 㿘 2 @@ 2  2@ `?@(@G? Ēb@ @! #ea@ `r@Չ 6 &@`e@Ղ 6&@Ēb@͐ 㿘 Đ"bܔX 2J ~q"8 U"* d D j ~ ud ~`2`( ~Z#`& (`,& ,`0& 0`4& 4`8& 8`p`<  B & <M6 p2( ~@#`& (,& ,0& 04& 48& 8p<  B & <`26 p(`(@-,`,@(0`0@#4`4@8`8@ p< `p `䥔# 9?Đ#@UÔ0 BĔ #@  @U㿘.>`  ~!*`@ R`@U#%, >ʔ@U #c”@U c@ c@U a` 0@U}h  @ % ~`䠙<  `@㿘@244,4x m"?" n@ n!@ m m?(((h $"""8"#!" u#b ( € ː!xh"b$" @1!  $"@G˔@A "Th"`P @ M"  ː! h"b$"&@ !  $"@G˔@Aa " $",h"`( @n %"  ː! h"b$" @! $"@Ge˔Ж@A9  "ː!h m """ ?1h" (@  (@GE"@A Ѱ? "@aȀ 6 a@G4h"˔@A " < h"˒b(@@ΐ "@??$"$ⴀ2 "a@D؀   " $  @ ?2 $2 $@F`2$ `2$!@  `h" mh m ""bs#"i Г*` €c?!@  ah" mh""Z"ba H>c? !hh""h"b!@ !h  m" m>""?;"b!@ h!h"  : a@ 8@h%"h?""% m1 m>$""  : a@ 8@" !@ $"!@ ?" &"&"" mh"b"% m $ 㿀 mb   ((h"""a"hb̀ #  m"`# mh#`' nT?`" * " @ h#8T@Cb`@T# mb !(@!Ȁ  n!<    n<8  nh@Tb$b n!@` ! mh#`" @Pݒ @" @Sq "̀  m"`2 (! n!T@爐"h!T@"c(!?$( h n!D"Ḁ`" mb "b"̀ hhb""#`' nT?`" * " @ $#D !hh#8hbbĒb@T@֙Th;"b#8@" h  Th@(  @b#h#8@"؀ #hhh" mb#\D#`#d#h#8b?b@T@^T$b?c ~ m" Ā`' mb   ?#! m"@lK? 4"$ @nѐ# 㿘 m" m"b 1 m"  @_    "@   @E5?˔0@?  㿘 m"`(˒cP@>Ԑ ?"8` hh"#8c@>ǐ ? 㿘 m" 4 m"  mb@k h(  #"!! "(""8b@kݒ ( "a $"@D m"@> 0 m"˒c@> 㿘 m"  mb @    m("a"6$"$" m" W 1 Q !b  @Œ E  > b b@I ; 7$" 6@D`".$"@D`"($"@D `E# @D` ̒`@>( $"P @Ds`"$"@Dm`" $"@Dg` $"  m "( "a  ̒`H@= 0(  m"˒c@= 0  n@DA m"@> 0!D``"@l: ̒`@=ې 0`@=א 㿐(!`g? mb b  na@? Wa(!( "a m" 4=#!9(" #!2$ mb7  a'@$ 6&$%⬀ #!b % m"% m  @  > @@ d@   $#!⬀ ̒ax@=q  ̒aH@=k ?㿘  >2@ `(=  m" 4 m5"`21 ! m"  @湖   (!Ȗ@ 8C 4 2 > <(>8@ b >8  "@朖   @Cy?̐ @=N?$b㿐 m" 6 m" M  ~ `(|$ @=as? ! mq `(o$"  @d   @CA̐ @=Z?b  m"`̐ @<ݒb@K?    "@B D @C̐ @<h8?@= 2h ""1 `(/$ :`@N@ @<b? 7@ʂ m' a@#  @B @<?$?$ ?c ~" mb  ' ' m??c⠒ @i? 4 !?@BP!?# 7# ) '!@ ; 7'!@ٔ #@B10⠒@i? @B$`@iy? 4?@B## 7 - '@Ω  @Bo̔@D ` D?? <  @B0@(% #D@,x @' D@(ؐ D2@c` @B D`(hbؔ @ @'g" @i#Ёx ~"?cP '@  n!D`D !D`  @2 h#`@0 @ {-h'?`!D ???<"ؐ g @' d!D@+ @#hc !?h"`6" @ /c hb #@  "#H @fb  ?`H  `V?`@ M`@& !D@( !D h@.  <@b  h"Ԁ`9h!?" @ 1hb h"Ԁ``@#  "h#`H  b ?`H?`@  h`@` @ @B0"̀   n!T@   n!T@ h "c  "  "@ " @?/ @9   6 4? @@g  @ @ @B`@.g̀ [h#`W n!T `?"`@* "@@ A F$#@ 6!D  @ @ @tB@.=4? <ؔ @̀ `h#` n!T `?"`@* "@@  $#`2 ?"  @ @?B    h@dc  @>͔@8n @ !D`(ؔ @D @1@% @g 㿈 n!D?` '@-? @ D`0@ @-뀦`@瀦``, Dh` 0@.  @+``% n'h7@0@ "@- `   ` @Μ  '@> @7 0@&  h#,` @ʐ  h@@-`0yh"̀  T@hT@  $h`ƀ"  b̀  #hT `?"`@* "@@ $c@s0BD`@@hb̀   #hT `?"`@* "@@ $c 3耢  `쀢 ( @ 耢 %`    `@ `@ `@) h#?B'@-| 8`D`4@whbؔ @" h"܀`@0h@@ ~"Į n?#PaD '@   !D  `@@6 y!D`D q!D`  khc  @, c!D h@.N Xhb̀    naTh8@`ph "c  c  @-  "!D@.>  @ !D@(  @zB !D`(@,y @{ ̀  !h#  n!T@Y $#P  @f>  ~h# Ā`'@,k "@   n!D`D ?#P& " @f ?bp?H? ~#PbĤhԐ? '  '@˔,2 !?L+ /!?c)`#H@M / /-@`-@,""c@cS  "@: 2 @H H @^,  H@ :d $H 4h`8h @7)`   ϒ`@0ʐ ">@ @7` @0 >?@ ϐa@0 >  P@  '"` ,@Ò  Ѐ 2  P>@6ϔ8 @0  >'/h0-h :2 @   H#\@Ú h#,` :h"H   #"H H: $H  @ d D` H"@%h@ Ē   P`4   `@ 4 h` #, h?#,`2   @ϒa` @0   PX  * 2`  *` '     "2  @   @ Ѐ 2  '@6,ϔ8 @0'#h' mb@@` #\@ <@ Eb@@\ 怦!@6   @/Ҙ 1 P    @   ϒa @/ @   @@5  @/   ϒa @/x   P`  `@9㿘 mbȀ  )  $% #h ! mg h  :b@" hh "b? b@> B@hh""D8"bH㿘h"" ` 4+h  1%hh"""  "'%h @3' mϒb @/ #   m  h =bi""h"@  h "bD@=b] && %h' m  =b Mh@ "bD&& \@@ `b <`B=b h"D@ط@@h &"bH$ @h ""Hb@@ <`C &!h=b@ؚ$"H naD@ @$"H@\ hh "b?㿘! m"Ԁ  1 m"䀢 2?!=@̓  $"  "ϐ &"b@. ?㿘! m"؀  1 m"耢 2? @f  $"  "ϐ &"b@.b ?㿘! m"܀  1 m"쀢 2?!=@I  $"  "ϐ &"c@.E ?㿘! m"  1 m" 2?!=@,  $"  "ϐ &"c8@.( ?㿘 m"Ԥ` E1ϒ!=@4rԑ* @ ! m`" $2 "̀`2? `2.1: "̀  @ݐ "̒`$"̀  @ΐ (!=@4Jԑ* "@@   & ϔx& $@- `21#p2& $  @j  &㿘 m"ؤ`C E1ϒ @4ؑ* @ ! m`" $2 "Ѐ`2? `2.1: "Ѐ  @ "В`$"Ѐ  @o ( @3ؑ* "@@畐   & ϔx& $@Β `21#p2& $  @   &㿘@Đ "[?N V mb܀   &N?@&ޔ!=ܑ* @ # m  @  # m 7?! $b̀  @ b̒`$b̀  @&!=@ (ܡ, "@  @ ?` &@ @ @  $` $ $&@ $?㿘@c "[?N V mb   &N?@&} * @ # m  @  # m 7?! $bЀ  @0 bВ`$bЀ  @&X @ѣ (, "@  @z ?` &@ @T @n  $` $ $&@ $?㿘@!㿘ϒc@U   ? P`@  ?㿘 <    < & +& "*0.P(P$#"P(0  #&  &  &  &  &  & P   o @& &  <@!h ? % ~!?#P' @e '  'ϒc,'t@` naD0@ @[Ր#Ё㿘lϒc@+ ? 2 L 2N   В`@+ ?㿘 P   @   4!  P P@ @+ɒ`8? P,  W @"&, ``,@ N,  В`@+ ?㿘`K В`@   ?㿘 L h!    :` @Ŕ  & `  @  & ` @  &` @  (& ` @  ,& `$ @  $& `* @  0& `0 @  H&  P @&  8& `A@ : `;@ ` &L < (  @ &,., Y ?  W㿘@"@ ~"c'@" ư?``   :`0& ",    A4  #`P  A @  `` A @[  !ǒ @R  ~#`   @H  t`   @?  k`    @6  b`(   @-  Y`,   @$  P`$   $@  G`0   *@  >`@   0@   5 ; @  - L  `  ```     2 ,֐, 6 `В`@*]  ? Вa @*U  " @Z!P㿘`m ВaX@-   ?㿘`m Вa`@   ?㿘h @K"c,㿘h#,` n Ӓ n #`  :` @ E `& ` @ ? ` &` @ 9 `(& ` @ 3 `,& `. @ - `H& `@& `8& `6 @  `P:`& @  `$& `> @  `F @  !?# @ `*  * `& `N @  `V @   @ `*  , `0& `f @  `&`^ @   ??& 8 n ` "  .< (  @   @  b  `:&,.,    @  b Y ` ?  |㿘h @ "c,  ~"Ĭ'?@!+? #?` ``0&h#,`!’ @   `   ! @     @   ` "(`  (% ##`P   `  b ` ;@ 6 @   `Òah,   ;   ;@ 6 @ b  %   @ X      @ O  (   @ F  ,   @ =  @   .@ 4  $   &@ +  v `  >@ !  l'? @ `2 @ F @   _0 `  N@   U V  2  @   I ^ @   A n     n  $ )  "a    # 2! ,, & , $   6 Вa@(>  ? Вa@(6   @W"` (:`((!Dž0: 2`(0 ?hP   P?㿘ڒ  h"P!    S;` `*  & ` `*`@& ` `*  & `  (`*`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `*  & ` (` *`@& `  ,` *  & `  $` *`@& ` 0`*& ` @`*  & `* `*`@  & ` P`*  ;`*`+ 2 *  @ :``, 3`@`H`8& B&?&E :  $ 3` < @ (@ `P   &,.,   `  b` ;;   @  b  ` ?}  &p ~"?c'@˔ !B?  ?  0& Ѐ J  `] [  P * 2` * 2` `@  c * 2`   ` `+=  `-5@ *   - @ (`(`(`(``-) b(, ; ;  , ;  `***   : .`.`.`.` )   =(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  2 *   (`(` ( 2 *   (`(`  , 2 *   (` {(`  $ 2 *   (` n(`  0 : *   (`a(` @ ::: *`@ `**`@ (`(`(`J(`<  *` @ (` ?(`d  ^       "bP    $ 2" ,?,   , "   6  Вbx@%  ? Вb@%   @Uz"Ё"T###x#d#X#D#x#x#x㿘#`   c.@_ 6,`@\ #?@+h"Ȁ`  , ( @}  В @%  ?&@6 㿘`D h#0`  , (  @:hbЀ  `  3& Ѐ  @  n!H` n!L`  8 @   @@  @+uД8 @%I (, @㒒  @+bИ `@%5 ?<   @B Вc@$ ?㿘`    @+  ( @Y h"䀢`  2    Вc@$Đ   (@6 O#hh"䀢`2Q @@`@ Дc@$ @?<  @ .#h0 @9 (#h, @*ܰ?є@$ 0" @$ ?@*bȀ  `@v`   @Z     ~bĬ  '   ` [ǐ *` €@*єH @$k *?h#8@ @ h#(` @#?,@⟒ < ( @7 2' &`0 `0 @@В `x, @[ ђ`@# ?"%h@*:! @ ``h"Ȁ` ѐ ( , @ؐ ~ђؖ@# ?#0`` (, @ʐ , @o `ohbЀ  "В  3& "Ѐ  @ѐ%`F) nh#8@H >@֗  ("А@ @)ѐ @# @ c@a"Ѐ  &` @l ) n  !H ` n!L`` @Y !H  n!L`"  8@ @   @S!(@᪒ #h"䀢`2*?<  @E 6 ` @)eі(@84   @)WіH@#+ ?(L /?  / )h  @@  6,@_ 2 , c@a@ , @i / ,@G @! #0,?( m"""'$ 3 naH  n!L`b@' aH  n$b n!L`b $ @(є` @"b@˺  @(є@" ( m#"# &$ 5 nH  n!L`@ޞ H  n$c n!L` $ @(є` @"@ƒc  @(є@"s 㿘@K 6" h#8@! @(` h"̀`@̏ 2 ?@(vє@"J ?㿘@̔ 6" h#8@ː! @([` h"̀`@e 2 ?@(Lє@"  ?㿘@l 6" h#8@! @(1` h"̀`@; 2 ?@("є@! ?㿘o@6  @(є@! 㿘@>  @'є@!Ӑ 㿘\s) 2 '&@"&`(& N    L "  2'<`  @  >@'4"7 h#<h#@  ђb@+ @.` $ђbH@!K ?@1*@@Ӕ @'єX@!_ ?2&㿘!??@ʓ    m@'pєp@!D 0c@   @'`єX@!4 㿘@ @?&@h"܀`  8   @ 4 ?c  ~"Ĭ'  `  &c  ` 8?# :D @ 6  `@ @@N  ! P      b%? @ې  @&   @   ђb@  ?  @  @&  @  ? &  @PF#77 77<767T777p7p77㿘h#(h  "bT  "Th#4`T "Th#$`T @"T m#$`@",h "bXђcH@ > ?@ h ?"܀` @? 6 㿘 N cx@  ђc@  ?@t?`$ mN /".  mc$$$ $ $ $  mc( " "c( m"#("c$ 㿘 m#,` "`h#`h "b`h"쀢` `  m#0 mc  @   m,  㿘h"܀` @3 m#$ )' ~%  4   4  2 `2 @# @  2 㿘 m# + m@ `$c !h%h)'c$`  m"X@=, 2h8?#, "&#,  &#,-?#,` "@h@ߊc  #,@%?#@ 0@/@ c$@%#, ?@ 0 h$"XXT@ e $c  㿐hb` % m"b` % m# m@ @ $c0@%` @%Ҕ8@[  ٰ? :?` 5̐!*` €h"܀`c0 @ @ c0 `O0c0 `H@ 0c0 h c0 @# 0c0  ., c0   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X;`X `;`` h ;`h< "9"20QRc0c0M (-  PAc008;c0h"ܒ 3&  @ 8@ )c0% # @ & : & , @9, 6 ,@$c0 @ 0'&,  & c0 @,,&,&c0 `&  㿘h"`)"% ~'`? $`@  $ *`@@0 = :, *`,? ! ~@y3# *@ 2%, `  2,0  ~#`? &`@ΐ  $@2`Ҕa@  (hb ~"Ī'  h"̀`" @Ż@?`&@ * &@f@bĐ `@ۏ h#2  `(;!@@!h!x@U_`(@v @ /`y `Ԓ #h`   #`#dҒa#\ @ ` ? ?` 2  Җ `a@ѐ`8a@ʐ@N`&@  * &@ @u ?` @0!, @h  2 Ғ@$!, @\?`&@ * &@В@cb @L!ȁ8hc ~"Ħ'  @;a @ 4!h!x%@@T@Ӓ @ "/  @̒Ґ!В@ǖ  @L!㿐@V` N N N @@ĵ N 2N0@ĭ   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0(2   0(2    0( :( ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ?    *    J ** 㿘h"d ; "c`4`I?"dJ@ - ~h bh *bh "`thJ"h`@3d . :  "d"d'?@  :2J @ ~Ґ#b( :2.  ~t  ~@Ґ#b@@  ?*@$"t. > Q,Q,QQQKLLLLLLKLLLLLLLLLLLLLLL LLL,L<OOOOOOOOOOOOOOOOOOMON\NtONNOOOO OOO$O4OOOOHOhOOOOOOOOOOOJJJKOKOOK4KHKTKhOK|KKOLLLLLLMOMTTUUTTUTUUUUUUUUUUU SUUUUTT(UUTUUS<TUUUUUUUTUTUUUUUUURtRURRUTUS$UUS0USDSLSdStSSStSSSUS_\_\___^__________]] ]0_]H]_^]__^__]__________^______\8_\H\T_\\__\l\x_\\_\\_\_\\\___]㿘@@0 /h`"#8`@$#8#8@ " Ґ@0#8@" Ґ@X0"$#8@P  5\- n`JWѐ"H*` €R# ;c@ !h$"`JcҒc@ @Bh "b<h "b7 ;#h"b1h "c, # h "b$@h "bh "c ;c@ 0 ;#-* : `ѐ"*` € n"!H hh n n"!L"0"#!H n"!Lh  "c0h  "bLc(@ @9 L  ݤۤ ;@Ec Ӥh ""ͤ h "#Ǥ h  "" @! ;## m'ؒc`! @ H n "aD#Ғc@@}  ~ Ґ#X@Vcc` '+@#@ǒx  `H#@Gc0MҐ#h"b! ;@F#h: #  bҒc@N @b a Ғc @B"@gh ""a ! ;# @#Ѐ  m?T"b@q# m N"bҒc@  0 ;@ c Ah "#4; h  "#(5 h 1"bh@"#(,  ;@ ^c $ ;@ rc h "#$ h "" h ""  h "" @W@c؀??B   ~sې#` n"aT !%@qȐ   @@  !  @  ! " %@ @$@@ @@ ` n  n"aD@`Aѐ!*` €! ~! ~ t7 t *@@  t@ t $ t0& ~ t@Ӓ`@k @?. @h"c t m t *3@  t@ t $ t m""ā㿐 n "!P'    ) n7; n`Jѐ#t*` €# ;c@!h` $"cҒc@+ @"* $" %!@ m"" ; cJ@ -2 J` h"" 'h""'e#  n{"!Ly w  hh"c0q"h m"c j%!@ ;@c e@sa^%!@hb̐ Y"bh U"c  n"!LP%!@4# n ;,#`h",D""h @"c4@M-`   ;Ӑ @`P@Ge  ;ch,"?'"?h #"c(!'!Ph "c$Ӑ h"b       Ӑ h"b@۔(?H? ~t *`@ & !@ 2 ~ ~# ~#`'aT!@?  !@ @G !@   | -h/ n;9W7Ӱ` 7@ ` ) ~#@tE! !h @A@ !h@  @@  @ "l@"l %Ӓa0@" @@@ՒaH 2 @`@`*,% %, `@O` 6 @@ @@  `@ 2`h"" n n  n Ȁ "aD@p!P h@Zh" s+ m  n+ m@Nk` D   !@>!Ӑ@n  ~#Ӓa@s !hӒa @@& !hs @@  @J "l@"l +Ӓa0@ @$@@5aH 2@`@ "1%bIJ`G   n@ na,  "a, :` @@ @@`  `@ %b !h" "J @!` $"J Ӑ $"(Ӧ!h%+<@$@ZL `?,@CX @^`@&! p@ ?  p @   ?` /,`ΐ P hh!h nhh n?h#0$" "@"b#b"L#"     /9 ~`DҐ *` €h "b m#&"h "b %a@# h "b &L n 8  n"aD%a@ %a@h "c ~#` n"aT%a@&h "bw# ~%a@hz"b ;@m`cht"b! ;#@rza  %h#a@u @%h@ @Ő @l`V#Ӓa0@` @O ;cJ - J #B%#?%! ;## m'ؒc`! @ H n 0"aD#Ӓa@9  ~ Ӑ!@cc` %)@@x  `H@#@h "c(Ӑ h "b m#` n"aD@@x?=? ta@* `G@Ґ *` €@ ? @;` 6@@@ 2@01@  hӒ`@ @q@h"c `@h@  m@b m""%h! ~ @"# l  Ӓa@ @M@K㿘h#8! ~Ӓa@ #   m#8J 6 Ӓb @#@( 2@ #`?"`# * $#@5 㿘@I@ mX   X㿘 m#X`Ӓb(@z ! ~1Ӑ#@˒"P 2@ 㿘 N  b`@u[ Ӓ`P@W :?bxӒ`P@O @0?L , ' m@ْ , 2,@@Ӓ = @ 䀤`."@ "`"` ` mX \"X"  $\L ې 㿐 @u  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @S @  㿐@pQ  h2  J?` '@r  @{@*h "bl  㿘 ~c@\"@C& 㿘 ~c@T @C 㿘 ~c@L!@C 㻐 ~"Ĩ' "N  c` `L@` @`\*`: @2`Ԕhc@  Ԓc@< u?,@@䊔 @1$Ԗcؔ@( @Ґ_?`,@ J \2N2 2 *@X @Ԕ*c$ $J + !Ց*:  P" g G" 0  p"0 $ $@0 @,@ @ݐ ?J   na8 $ n"!<"a8  na< " "a<" @B 0㿘 N  `8@  Ւ`P@ ?$@$  n0$ $ `$ $  na4 " "a4 n"!4"0 㿘 n!0  )' ~%  2 `2 @~  @ђ  2 㿘 n!0`  h#`   \$  hW "쀢`22!0 2 *`2)!02*@sE   $Ւ`@A  ` /*@6$  ` /*@$ @?$ J / * $ $ & !0       2    @" &Ւ`@ ?㿘 na0  &h#`/h"耢`4?2   #h@.         J@ /2 @k 2  bb耠`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ h"쀢`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  㿘 n!P` )/ nN  /&aP .  'N   . @ @t&aP  $aP @aP aPN  /"N aP 78N, /38` ? ,8  .,  'N,  ., @T, @A,&,aP  $aP @aP  8N, /8? (N, 8  ,@ؖ  *     h, ,,@ǖ h#`@     ,, @,㳈 ~bh #8'@n!8-+)'%!o@cp@aa@_!Ȑ@n, :@=؀ @R0@ڐ,O@J"0〢  .@C"(#  O逢 @8"8 "`@3 @`@,,&,& ? @@"㿘 @ ? ` ,, @ ? 㿘N@`/ "@l$&@Ւb@ ?  ?*@  * . ?*@ .   ~" n%?a8''L@, F D@3ժ  @ 2  ,@` @* @#@p  %?Wb@ Z L@ @"@  L    ʐ    2ª  ?@0,@` @@L  @,@L  $Ւb@ % O  O耢   ~Ր#c@ʔ OՐ#c @–O耢  @L"@  ~" @?%#0㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @n:&* &y xxxx㿘Ւ @ʐ#h  "c @IՐ @he"@Ӑ  L@ ֢ @D 'h %hJ?`/"?@  $֒` @ϐ A @h"  /* " \@N &+@a % n!@`ݐ#,*` €Խ9h"`֒`P@ א S㿘 hh"b̀ "֒`p@ 0֒`@{ _@h"܀`@@> h @[   ?@ؒ @P   ?@͒ @E   ?@’ @: 2?@ @"    h"@   h?؄ ؔ""ؠ  '''@   Ȁ    @ Y @{  Ȁ    @p G @i  Ȁ    @^ 5 @W  Ȁ    @L # @E  Ȁ    @:  'ؐ @1 @+    @ ?֔@  xH X㿘 n!`` n@s 2  n!d` n@ې 2   n!X`" @   㿘 "S?N # na`   !=@p  $a`8a@N # \N  #" @ 2 ֔ax@ ^ ,?  @܈ @W!=@a`, @ " 2@  a`֒a@ : ?, "  "" 㿘 (!=@ na`* `"  @ 2` `2@ 㿘 "S?N # nad   !=@  $ad8aN # \N  #" @Ư 2 ֔a@  ,?  @ @c!=@<ad, @ " 2@  ad֒b @ Ȑ ?, "  "" 㿘 ,!=@ nad* `"  @ 2` `2@ 㿘  N bH@"Ӓ / "N,@`N & ?А , *: * :  .2b` 2b` @ o ֔J 2 @B  `b L@ 2$  *$ L@ & @֑*:  M"  c C"  L@ m2 L@   $   $ b@ 6 S֢`L@  @@t N$`$ @ 6 ֐ b $ ( nL $@~  6  ֐ c@ @$֐  $  @ ֖c @  @? naX $  n"!\"aX   na\ " "a\cH@  ? nX`AH@` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@N`   !J?   ` 2 .2? 2? J 뀢?@C&  @ɐ 2?L?Г* @L *`В@ `=r$@$@` kߐ *` €N Б* N * ?Д * *  * 8$` "NNБ*` N * `?А @$` ?Г* @N *`А@$` D  d$`N?Г* @N *`А@$` ,  )?$`N?Г* @N *`В@$` ` `""?N?Г* @N *`В@`$`  N?Г* @N *`В@ `;$` ?@G#&@?? 㿘1 n!h 2 )@ϒ  &!h ֒c@ ΐ ?㿘 n!h`r%`$`g )@ah-  :      @ 2  @ 2   , @0,l&,,&  `  &  ? $  $@&@$$ @P  @kl  $``$  `$$  - ah $ @ $  "@ @֒c@ U ?㿘! n!h 8#`$`3` / - +`@)!h*  "  2  `   @ 2  @ 2   #@@㿘 nah   h*@  "@`@@`2h㿘1 n!l 1B !G@  &!lג`@  6?h#  H H1h* * * * * * * * * * * * * * @'# n "a#@ް 0 @#X@ ِ ?㳈 ~" nal ' 2  1@'Gl- @`<+@2(``! n!  @ ` `  !@`@  ^?@6G@cW ```2@`  @`  B$`@ @2  1! n!  @  <`!@ڔ  @- l $`$@ $`!" @@ה@ V  `@xג`@  `?@ǐ? @8!㿘1 n!p 2 "@  &!p גa(@ ?㿘 n!p`גa`@ I @y"ap, @`0` `@@~ 2```@~ + @{`@iʐ &`a@ @i &@@i  &`ap,   &` " @[@@Yגa@ ?㿘! n!p @@+"!p* @ @~O 2   @~, &@&@ 2㿘1 n!t 2 !=@r  &!t גa@q ?㿘` @  ? 㿘 n!t`-!=@at, @` `2` " @  at, ""  "" גb@1  㿘 n!t ` }  @ 2  " *     +2$`& `W& `R   B`25 n"5 n@ɐ 9"" "$ 5 n  &z   @!q  b(  &a @  a"" "$  &   &גb( @ גbh@  㿘1 n!x 2 !=@  &!x גb@ ?㿘 nax   x*@       2<x㿘 n!x`6!=@ ːx,`@     2  2  @2  @hN  $x,`$ $ $ $  $ " @גb@> 㿘! n!x &!=@ !x*      "  2  2     "@ & &@@0?㿘1 n!| 2 h @""p @@  &!| גc@ ?㻐 ~" na| ' = n!,` nN / @ 2c@ n !ha"p@2 |@[*` "p$|* $"p|@gá, $@  @גcX@  "` 4` `($``  4`$`$" @6y#㿘 na| -  n! $+h) n' n|,`bЀ    !H  !H 2L    @)|@$|$|%㿐`@  @6` `   *  `'  * @ $@XpLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL||dLLLLLLLLLLLLLLLLLLLL㿘 ԟ$ $ J@" ?   " @   (  ((( ( 0(2    0( :( ?   @    *  *** * + 3` ` 03 *   0*:* ?  !    㿘a$?N גcؐ!@_%    j Ւ"?h "b ?㿘-h)'+/$%@zՒ ! @zϒ   n c@  ( #a@? X @  ? %o ۢ# 㿘" !ΰ? @-   & $ &`? h <,@j d&h@, ,`@b d&,`d   / &`l   (& `t   ,&  `|V  P 8  ` H&     ; @& 8&  :N` `2 `5`0"D., 4@., "5;`L4:., `K&7., N`(@  & X& @  &  &O& K  P@" a  b& 8 6: @&  &.&., &,K /`  `$` &  & & `P@`  a"@   b  `` & `& a : :K /2 +?& 㾈  ~Ē ` '-"@*` €h"`$%İ  ` ` ` `, dؔ, a%   dؔ a8 !@ d ,   :?, /,  2  1,,  d, d   c!P ,d  VaX" @  b a:!   `dƖ < (  `l 3 ,  `t * @  `  !! `   ˒!    ?       ؒax@C  b @3 !㿘 ?  ?㿘Ԑ ?Ԩ  ?㿘a$?N!Y N "?cؐ!@\  2?  ; "? 㿘ݒ"  ?# `@4 `$ & `& NaY    ,aY /, `? h ,<"@@a d&h@, ,`@X d&,`d   / & `| W  P 8  ` H&  @&  8&  ,.aHa)՟ 6 (`t Ҕ & (.a(a 1 ``l Ŕ &``  ;@ 8`0& N``L"h*` €  @K     $  &&  & L /2} &y,N` 4 `  ` `  ` & & aI }  aQx ?c , *`  0P&N` 2   (@ & B& `   `$ & ` & 6& N` K  P@" a  b8 & :`P@`  a"@   b  &` `& ` a: : 㽘 ~ "Ā`'`Ba``   , dؔ, 5aТ @> ؒa* !@'    :, Q, /, ?","  dܐ ?` F*`# € 54, ` 4 3, 0 ` I  ? @ `2 @Q     6, ` 1 2,,  d,圐 |   % `  0 7,! P @" a  b   ;@|    bגcؔ @цؒb0 @с`(l `  !h"t "tӱ"8?}hx "xb@@  "t D  k ,t 9  !h"| "|"8?Vh  "‒b@ "|   D!   d  : @     21 ( Ҡ  @  ,   @)!Y   !  e  ?       ؒb@  b @0Y"`da ?J/2 J"`4 ` 㿘` @v:@ &䗒㿘آ#8@  @lcH! n  $!ؒcP@d n  "a@z!@0h#` cXc8@0 ?㿘! n!'H'L'P'T'X H@|@S!㿘`  n!@[$ 2. ?@u 2* 㿘'P'L'T'X Lh "bh"̀` 5 ~1h#  n@!aT@{ &#h#8ؒcx@{9@|`@m 㿘'T'P'X Ph "bh"̀` 7 ~1h#  n@aT@R &#h#8ؒcx@{㸒@|7㸀` @kؔc@{㸒@: 㿘@[hhhhhhLhhhhhxhhhhhhhhhhhhhhDhhh|8h`hh 0h (8HXքִ֤֔$88<L88<Lؔ$ ~"Ē  '//'  @Ͽ  '|'x"a\ْ`(@ @@? nْ`0@ ! `# ;%+ n/'l; n't'p'h'`'d 3* @€c   #@`"`c``@ , $'|$,, @$,@Y  ,!٠ @jÐ @  ~`$,c`@Y c@W ,@c 2 c`@ؐ  / , , ,,"$,c@q # =ac c`@  a@  a@jz ٔ`@ 㠁)=a, $,, $,h/ %h@ " c@jZ ٔ`@    #@_vo c`@v , f$,,c@u$,_, Z$,, V$,, R$,c? #  @_M nE#!ca@L , $,c   @_92'xca @9 , $,c   @_&/ca8@& ,!$,c   @_# n #acaP@ @ِ@ނ@?? ~ t* & @ @aٍDc"``" " H    HD" @#!H+!H. & & & @V #a(@∐ 2 ْah@А .  @ @sO!"!(,   nْa@ ` "d` @w' ,ْa@k    n! @ -`@  @?c, ##` < 8 h %h!8"!8 \+a8 *" "" @ f  ,ْa@2 , @?\c @ , ?\c @ ,@?\c$@ , <  8 h %h$,, d $ dْa@: +\  @˘ i <* @ *@@ ix"``, |4 4 4 , , , $ $  $ , &<  8 2 ْb@  ?   '/?//???\ l @ ( 6h@pQ"8@,| h \  @v  hْbP@ h \  @f  hْbp@ h \  @V   ْb@x  '\!?##`@i ْb@g @'?\#`@4  '?ْb@V ! #aؐ< 'aؒb@K \ a@  a?@4 ِ"@s   t@U'ٔ8 na(@! X na(@ !p@ ` @  @ @2, 2\@b \ 4`*`@  ْa@ #',  @ ''@]\ 2 * +  & p  @! , '\ h@`  d@F`,@omcp,'@ h@ @ ``,4 ,@@] @+| 㿘@@<` @ a`!X@ ` @p 0!4`  n @ `"  n!ap@ @t@"㿘@ @Ր @"?c ~"+ na' --  n! 5 aX`!*5  5 @)͑4`: @)ɑ4`   *@d* %,!?# @#' ##' #a#* #* #*  #* #*  *  ** n! @ba,  5 i  5 @U5 a\!H @  ,@n#?#a(ٔ@uc@n@˝ ,  X na @˓ XĐ @ %X@*Ő#x@ۢ  -  @ !,a@'ِ#@0&@  @ 4ad   V"4  / / / / / / //?" "@ ''Вb@ ?? n*`" * "* *Ȧ :@B:Ȕ@, n naІ ! !B;a n( n8 n! !1 n !:1 n! @(: M@( <  0 !4`?"0'!4@(: !@(   *@ - !,`e` na @ϔ v@1'ڔ@  @  8ad` #@  @# ڐ @@ ۔ `@ ֐ X n! n  `@D @ ᜒ@  `ᜲ @ 6%#ڐ` 2 @  @ `ᜲ`@  %`@  ޒ`!,a  *  @@a @ڔ@ @c ,+h'  "    `D " @ l   ?  %#ڀ`' ~`` ?"``* "`@/     *   @ *   *  @ ?@I@ 8`ب?Բ`y?    @?mhcH@ `'cP@ `',  `'ڲ`@  R%`'cP$cH@-$cH@ ! %#ڀ'2 ~`` ?"``* "`@Ȑ     *   @ *   *  @ ؐ?@?@ ѐ`زմ?@ ʐ!?@ Ɛ ? `@ !  % ? 7 ,  ~ c``?"`#` * $#`@Ƀ @#``  ` `? (?888* 2 ?cx ~"?c' `/  ~ c``?"``#` * $#`@E @ؐ#` ڒa0@d ?#a(ڔ8@r?#@dx?#-XX@rӐ?c @dga4 ڔx@rĐ@d[a0  ڔ@r@dMX`:!4 ڐ@r*?'`&'@B' "@BH` B()"@B ڐ?@r~??#c @d?#ڒa@d !4f?!d``!0 nȠ @  nЖ@ @@ @[d n?Ḕ   #@ʒ  @#  #@  #@u n#\ #@#` #@g#d #@#h #@[#lڔ@r @c?#@@>  ~ @'r"8㿘     (   @n@B: 2   B* 2`@ : b`D 8 怢`  㿘 @   !4 @`?!4 @'`?㿐`ݓ*`! €@ "P0 `O!*` €@ "`0@ "0@ "0@ "0 `@ "0@ #0@ #(0@ #@0@ #X0@ #h0@ #0~@ ߐ#0z@ ې#0v@ א#0r@ Ӑ 0n@ ϐ H0j@ ː h0fc @ Ő 0`  00@   @   @    @ ! @ !0 @'@ !P01@ !`0M@ !p !@  0D@ !0@  "@ w!0@ s!0   @ j"80 "x@ e@ 0@ _"0@ ["0@ W"0@ S"0@ O"0  @ J#0@ E#8㿐ۦ @ =#P 2` 2`  @ 3# 8 ?۔* 2` @ *#  # @ ## '@V@ c @O' @ c,  ! ~# @ c`#``?"`#` * $#`@Ԑ 㿐!,` ' @I  @'!hٖ#x@pl!#x@'!h#x@p_!#x㿘 * `  * ۓ*`@ @ #0`   * ܓ*`@ @  ((N@ ĠȢ̂ЈԖؘܚ Hဒ `@ ` D `X@Ґ H 2H#l;p#\#`#d#h;x;#`@C ?#" 8 @ @ `. @ ( !,`@ H  @ #@ @c`@&@ 9!02 2 0((  ``? 㿘 ~ܒ`@p#@$ 㿘@PPPPPPPPPPPPPP 0D㿘ܶa`@m /%#)!+-1 ~'5 ~-9 8" h* ,@€ $!$a %!$!p $a %a %t$!p#`@O9   $!p h  ~#@pQap@$ @Ղh?А?t* `@! a  a t !p @0@h@o[#` ܒa@ @$v!x㿘 ~a# "|+)'% a @jpc  !@Q @ V$x  %|@ ?4 @o" 2㿘   % ~$` !`` 2  !`!`` `ܦa@oǔ `@2 ` ` !``` $?"``` $* $`@ $Ȓ``+!t``` ^?"``` ^* $`@Ӑ ^`` I?"`` I` I*!p`k`/`` M?"``` M* $`@ĩ M`` -?"``` -* $`@ē -"j ` a `  `  `/`` ^?"``` ^* $`@o ^E` ?`@``? "`` *:   ` * ``? "`` ,`:   ` `* $`@="  ? & @nZ  &  @ !|@*!  "x 6 ` `@ܒa@H 㿘 ~#R a "|+)' a @i   @ !@$x T` %|@T` @5 2( ~Rcn n"`)+@] ܒa@ d*$ @%al %"ܒa@ %"@@ç ?2@ @"@ Dal? 2  !|@! "ax㿘@14(44444444444444444444444444444444444444㿘      @ @"^ `@?J@ -D  J@ * ?* : `,#*`         "`< "a  @ɐ @`J 2   ? `@ @!@h  (?@b0@ !@h  (?@b0@t  `ޤ!!$! " @h @ 2$$!?`!  n""*逥   < @{ @O@!ސ ` @!0!@ڔ@!А  $ @b  @@!Đ !'"ؒ@g  2"@ @! !?" p " t@@gbP  @@ ?`@!  @@gcЀ@ @"؀ ` @! !`"@g@ 2  2 !| " $   2@bX@ܐ `4  2   "1? ?@` bh@Ð € ?`@` ``2 b@ €?`€@ x "x?` @  n"   n" ސ"@ "Ԁ @g !@  n@ 1!  nޒb@0  n"  a@f ! @ ޒb@ @  㿘! n"?@.! @  "a?$"$"㿘 n"#a %0ޒb@ @ 6V @f`a az@ a@Y"@ 6V @""?"a0a@z 6 @"""""a0a~@j 6 ""$""$ h) ~"'' Ȑ@H $ @fj%0 @K? @ "7?@  "1?@ )?b@ ؐ @ 'ޒc@x ᄒ@"?ޒb@m   `@  @4" @ P#h# ~b'7 Ȑ@HV $ @f!0 a@?2ޒc @: @##0@#8@#Pb @ !#X`% ~' Ȑ@H& $@eߔ `     @QCĀ ޒcp@D L -ް  @ec '@b ! a@?ޒc@  @ڐ#㿐    " @P ޒc@ϐ @V J? !     ?@Of ޒc@   `/J? !      @ez 2  @I 2 J !    "{  2 H ! @   @  @{ "ؒ  @А   @  @k  @e! @e     E &B @  ; "   @e 24 ` `!`")!   `V @2  @  !`! V @2 $ @  $ 2     W`@P`@͐  ~#c@jp@ 㿘А !a @d"! az@"؀?ޒc@֐ 㿘!a @d"! ay@u"؀?ߒ`@ 㿈  ?' '#0ax@_?ߒ`@ @ɒ  ߒ`0@ ax'ᄔ@I'?ߒ`X@ 耢 4' @ ` ~`` ?"```* "`@@ ߒ@^ x`@  ~``?"`` * "`@( @1㿘!|`"!| n "b2 "b!8  2`€㿘!` € 㿘!` € 㿘! "@Ғa @ 㿘!ߔؖ "@a @ 㿘@   n"""b㿘!| ! 2`6 !   @ `"!  n"""""ԁ㿘@ 㿘! !| #!|p% ~Ġ'"@ #a0a@e ޒb@ a @ctW`" @@"  7aa@H ߒ`@  @ ` d dd d㿘ݐ#@ 㿘ݐ#@㿐И"@'   @N ߒ`@ @U_ !R  ߒa@ c@c* !@" p " h@cc耢 !@" t" l㿐!R   ߒa@d ! J `@  ߒa(@W @Lǐ ޒc@     2 @ba 2 ?? @@ 2 2 ߒaP@/ $` @N $` 㿐!a' @b"   #@N"؀"ߒax@ ! @xa @!㿐!a' @b"   #@M"؀"ߒa@ ! @Ra @s!h# ~bĠ'  $@a@bW N @J? !    ߒa@ @b;  ߒa@ ! a@?bߒb@`  @R"h# ~bĠ'  $@a@b N @̐J? !    ߒb(@o @a  ߒb`@e ! a@~ϔ?bߒb@  @ "㿘N 0     X* R  x" 2{ zN" !@  D "  !@  D ߐ"@m  "@"a 8 `  !    Д `   X* R ?  `* !    Д `   X* R ?+ N \2 `" N @aH 2 ,  N` `@a9  $@ 6&"@ݒ &㿘 `   0    X* R  x#0 !@   2 ` ` !J   2 `߀߀ 2"#@0@ #  @# &`# ~bĀ`'Ȓ @y ! 'Đ 'Đ Ā b!/a @`"!Ƞ"$ 0a@} b@#b @א#(x# ~bĀ`''7@֐ ߐ#8@bĐ@ؔ a @`! a@}f?b@#Pb @#`% ~Ģ'@B 8x@B @ '̀'b'ߐ#p@D '̐!'Ȳ .`А?``"@ N#x@D  2NȰ !'N  !    ( N  :$ *: ?'̰   'tߐcEt /t.`" " `` N @|#'t +t t''a @_! a@|ؔ?@# @#x# ~bĠ'a @_ؐ! 'a@| bߒc@  @#h% ~Ġ'a @_#a0 a@| aߒc@  'ؒa@| `@֐  @Ȑ (h' ~Đ'@J %ޒc@ `8@C ``@@Cܐ ``H@  @; @va @_c!!0 a@|C !ߒc@  'ܒa@|7 `@  @t hh' ~Đ'@J %ޒc@k `x@C ``@C ``@  @ @"a @_!!0 a@{ !ߒc@:  'a@{ `@.  @  㿘  , @CG    h' ~Đ'@J0 %ޒc@  ܐ 2@a@6  @ @Đa @^!!0 a@{ !ߒc@ܐ  'a@{ `@А  @!0h% ~' 2a@@ a @^|!!0 a@{\ !ߒc@  'a@{P `@  @!hP# ~bĀ' ' v a@   a@ ''Ƞa @^6! a@{ ba@a  @S!x# ~bĀ`'?#@@Q?c@ !@~bĠa @^! 7a@z?b@"b @ " x% ~Ġ'a @]#a0a@zÔ?a@"0 'a@z?@֐"@ @"Pp% ~Ġ'a'Ԕ @]#a0a@z?@"0Ė   #@IԀ'b`@ a a@zx?@"@ @"x㿘߀  @"0  ,   @"ߒ#  㽀 ~b7'ؒ  @'$ ᘔ @]T%0@z4a  8@ᘔ @]D0a@z%X  4@ᘔ @]50 @za@  @Ґᘔ @]&#0@za('  @Ðᘔ @]0@ya  @ᘔ @]0@ya  @ᘔ @\@yےa'  @ᘔ @\0@y̒a  $@ᘔ @\ܐ0 a@y ` 䀢    `` ~+ ~"@c` Ȁ 4 c`@"~ɀ8` ?#@@Ð"'P7 @^  H $'@x7@Ƞ8@>ɒ |H@~ ᘔ @\~0a@y_ ,``(` "!''cc腠$"7ƅB' B'@@u"`@q"`   "@c` ,  , $    $@ !0a@y?"@hc`d   `  , @ "  "  !@     :"   #p@@w   @#  ~`` ,?"```* "`@ܐ ,,  ` ~#p@c`    ـ h ! ~#@#`h l"@#`~ @`Ȁ ;! ~#`@#̔ `  8@ْ#`ߔ#̀ #(@ #0@̒#`Ѐ   x@Ē#`ߔ#Ѐ "#@@ #`@#P#`@#`؀`   ~#x@c`䀢  P T@|#` W #ߔ @l#!0a@x(؀  ~R  ``?"``` * "`@+  @c ~``?"`` * "`@ !  ~@  ~" @6#Ё?cP!- ~Ī `'%?ސ! e %?@=/ )! @Z' a@wǔ  @ L`@#G`@= Р@=>>'!' @ZĐ0a@w @Ɛ ,`  @Ր (  ` @̐ 0?#А@& ~`` ?"``* "`@  `|` 8? @ @㿐 x %  4 @ X@  ~``?"``` * "`@_  >@} ` x  @= @s p  S@5 @k  S`" R'ᇠ'apᅠax$"7ƅB' B'@@I  d R@D  d @>  B  B `2`@4  ~``?"``` * "`@  ^?# @`6 ^@b` ~``?"``` * "`@  x    v* * 2 @DaPh# ~!xbĀ '"Ȓ  (@ma @Y!0 a6@v  @f a@ " 8 8 ba@  @ʐ!㿘!x !#`8`@ * !$`8a @Y"`8"!0$ a5@v` a@ 㿘!x  a@ݐ  a@א %b(@ѐ 8 `4`@,`$8㿘z!x )bX@  8?c 2  @b@ ,  % 8㿘T!x  b@ "b@  8@ "a㿘:!x  b@y "c(@s  8@ "`@㿐 '!x  cX@_ 'c@Y 8?# @ ` `    @DCc@C *` $8Ȅ 2```2@! < @2  22!0㿘 <@N? ΐaH@ 㿘 n"@;? ah@ 㿘@Cѐ  ޒc@ #$@2 ?a@ѐ # @ ߐ@{c @Z㿘  `@2   @< 2   2?㿘` i@M!"! m#@?b n"`@` 2` @ `!@% 0#$` 2*`?# @ # 2!` 䀦!!ߒ @ b#ߒ `@ @?# @ `` 2@6 `@!p) ~"ߠ' // "@_a @W!0aK@t : @ #\! @ a@W! ! @y#\! @ a@Ww!"@" @"() ~"''@#!#@<"Ѐ`@t#"$`@m## ~c``?"`c` * $c`@< ``  `  2  ` @@@I#  @Ȑᘔ @Wh%'0a@s  @ @-#@30 Ȓ  (@ᘔ @Va6@s 耢 #@b뀦 @E  c@ a6@s'쀢 6a@ @#ؒ  ؀@;c``?"``c` * $c`@ c``?"``c` (* $c`@ ( w c``?"``c` )* $c`@ )% ~``?"`` * $`@  Q@ "4 5 &"< @2!"4,`  2 " ߘ   @ ` `  @z ` آ`"4,` 䀤 `@f ``?"`` * $`@6  < '  @   2耤2@@ ( @< 0  @5#P`@ ` `@ !  @ 0!` ! *" @  $ 2 ( " @ @x1 ~"Đ '#a  %@ +"ޒb@ +a @UƐ)" @  '@@ڐHa @Ua0a%@r؀ 6 @Y 1@ X @F /"!l/᐀ )" @ݐa0a"@rr? a@8 12 @' a@ ha @Uwؠ" @'ܒ@ x!l@ ᐀ 0#b @!0a#@r@? @ 1 @ @U "ؒa@UC b    ~'@ܒ@[  ~``?"`` * "`@* " @Q 㿘! €  n "b ?? * " * h+ ~b'' ᄀ   @ +,bޒb@& ސ  #\! @~L ߒ`@Tڔ! @! @В ! @ua @TȐ @0Ha"@q @j 1"@ А @V  / / #\! @~  ߒ`@T! @В ! @61! @T@є 0Ha%@qf   @, 1 @   @ߐ@! ! @! @Te @0HaI@qA  @ 1)@\!& @m!0 @g!@ @a!P @[!` @U!p @@O! !@I n" V ! @Ő! @T @a0HaQ@p 6 `@ 1">@!9ހ  "2@F; @!` &@"!@  x@!@!@ &@"!@ x@!@#Pb @ !㿘 Hp n"ܓ.`# ~ bĐ'@5  `, , `$ @A /  @ ؔ @XE b@ @4 '$  @6( !b@¢ @@ b@  #@`  @wB$ ޒbX@֐ b @ "㿐 n"ܓ.`   '  @> b(@  `, ,     @ؔ 0$  * "@  * *㿘  N 2 , .`"8@22, "@@+2q ~``?"``` <* I"`@ <FN, 2 : :  ~`` ,?"```* "`@֐ ,* : $  ~#``:?"`` #`* ##`@ * :  ~NN 4N` ~``?"``` >* "`@ >㿘`U O`. 2 : D  ~`` ,?"```* "`@t ,@* :` . :`   X* R  ~#``? "`` *:  #`* ##`@O `@* :` ݕ:`N@N@ 4`N@``` n".`' ~ Ē '@Ք   '̀`'А@R / @R!!( /ޒbX@ @R `*@@?  n""aȔ@ՖĀ  @q&bH@q ` "`ޒbX@h @: `? ?  `  ` `$`4` @4Q @ "P㿐 n".`  '   @=1 b(@1  `, , ``2   @S 0 @N ` ` ,` ` "@ * ,      " 2 "   2   :2" 8톀2  &  㿘 ~b`@W#@ ah) ~"Ġ'  $@a @QG'%0 @n'?@ C"@ ="b@f  @z4` 'b@\ ᄒ@n?b@Q   `b@Q,  2@+"!Ȥ@& 쀤`@#P@" @ !"㿘!!(@U!㿘@ !@L#00a @PԐ"ؠ"ؒ  , ,  @rʔ ! a@m @̐#P㿘@㿘 D@Pϒ`D㿘 D@Pɐ`D㿘`@ @ (`( 4   ? ,`,  ?㿘`@ @ (`( 4?    ,`, ? 㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ 0`0 4   ? 4`4  ?|㿘`@ @ 0`0 4?    4`4 ? i㿘`@ @88@4 2  @<<@( @ `@88@4? <<@?>㿘`@ @88@4?2  @<<@( @?`@88@4  <<@ LO O O O O O O O O O O O O O O N@O LO O NO O O O O N O O O O O N,NOO O O O O O O O O O O O N<O MNPO NhMNxNO NM<MtMNNNNNOMO O M㿈@p   @#` @1 n"c`h @lT  ` n"# "b"d "bD@0)   "bL#!-' n+7 ~/9`G"*` € %"D""8""$b """8."" ?$b$""bx""8" ?$b$""x""8#"#bo%"D "8"""f%"D """8"%"D\$b "bx"$bT%"D ""<N"` ""`H"< D"b| A ="bH  8"bL ""@2"H ."bt *"bT &"b$"bh!  "b "bX "bd %\ $  "bP "bp $@r@ch?X?t"*@& $"b "`b"P`b"|` b"X`b䀢 "b  b"@`b"|`"b "P` !"h@"h &!: $"h\ %䀢 "  @"D"D= 7#5" "``. L"<`"&!$# "  "D"D "!x"`` #"<` # "b,"D ""`!|b  #l"8`#<# %(@ "l nc@ "l㿘"t`! @I   @  @~@q "@`j"H` `  @ /-+L)倢 8`D  "N`D0B3 "2N`D0= . 5V`8 "L`30 `@뼐 $`@뵐c&0@;@-"H @" 0@#0N`D#``D`@C`@%l@̐ 2`:@`c@  ~"'H'D' U "` '`"` "P`H '`H'x'|' ''t'p'l'h  'd'\: D@CnD@# $  ""l2 LD2("@`2($ .2 ("L`2( $ | 8'|` @@D (D 8' x 8'x84 8<8" `z'"x` #\@Q~ @Qx# \@' @T @yh4'h@rl 4'lb  @3LN #@^p@ 4'p   `  @{ː  `  @   @L$@ @  $` @L{<  ‘ 't  ` @  $`@LdN`-"$@|k$d 'd2(:d`S|'`'H 7't''! #@P@'l p''#@P@'x# @P@bT ' @PҐ@ݐ' 'h'"(@"  "b0H  ~@| ~ @)#㿘 :"0 @`: )   "  ?("R 8 "@`2   ?",@€㿘;㿘  "  @  ~`` ?"``* "`@   2 x ~"Ķ'R8 "`"P` bh @@韐#Ĩ+<35-/ "`@ `@`"P`h ; `@ @ 8@cC @t`@ $` @j%b 2  , @a  @] b   (@T `  "`2 `? 2  ` @@ 0    (`8 @"@ @3P (`8@`<"``@I` 0 "<`@B`00@?`(@Db|  "X` `  2`@``(   ~@ ~`` ?"``* "`@ѐ 2]  @ X㿘"`  "P` "|`2"X` n n#`*  @o&@@kې 㿐̒ # o `4@!"4@{k*`  @z4&4& ?$`4@遐 0{ &4$`4  4.`"@`2 @/@ 2R 8`"`"P` bh@~Y@`# B7) ~    ~#` `?`$``@ #`* %#`@ 4,  @ِ#`` ?"`#`* %#`@ Ĥ㿘" ``@  @ "P`h ;  @@ 8@bC  @@b`Db| "X` <   @ 㿘'D@ D# ~c`  L?`&  @  c`* $c` @  $ "p`  ~#` L?`&  @  c`* $c` @  $ Uc`D;!@;  ~#`  L?`&  @  c`* $c` @]  $ 0c`c``?"``c` * $c`@E  ~#`  L?`&  @  c`* $c` @.  $ c``?"``c` * $c`@ 㿐Q iR 8`"`"P` bh @}@# >' ~ 6􀥀`` ? "``* $`@ݐ   􀥀   ~#` `?`$``@ `* $`@ 2 ``?"`` * $`@ 㿘"`   "P` "|`2 `M% ~` E >`` ,?"```* $`@u , `( nc `` ?"``* $`@^  ` ?"```* $`@K   P ``2` ``?"`` * $`@3 㿘<@ ~@ I0?(@ 0@+ I07``?"``@ /`9 /``?"``3 |`, | ~``?"``% @` @ ~``?"`` =` = ~``?"`` *` ** "`@  㷐 ~V 8"Ā'2  h D@Lo$  p D@Le$@tД#@W@= ~#`x@MVb. @弐 @(b @ 㿐"T`@MG? @坔0 @喖㿘N 1% #*`: ?  J   2Nbd  ?N ~#``?"`` #`* ##`@C  N  㿘 h  ~`@L#@; 㿘@Ko0o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8no8oo8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8o8no8o8no8oo8o8o8o8o8o8o vDvvv v y y@ytxx㿈@  L @{J?`d  o "   - o) o# o' o!+ ~`<!,*` € %  $` $`  %  $ o "` @ؐ@?ܒ?`t *`@&  `@`  o "` @ /   @3;  o `` * @3A?   @A  @> @$ @ΐ @  @ǐ!   @ @r 6   aP@X@N ?7'@'耢 "   aP@p@>  `@ @ !#@f " `@ !P@qa@$ @ @  ' aP@^@ =#!(` `0 "@`P 2@`6 #* $, @}, ?@}*  @֌`@ֆ@< P@%a0 @)@є 㿘@#  a@  O?@O`  a @ 0 @tߐ \   aH@ @u4? \@z:  $ @F@= "   $ @P$ ( (`$  <$ @א  $ 02 $ 0@*a( 2$"a( @ur?@up(`"  `2@ `2` 㿘@    bhx @   @t{& T    bh@ ?*@& X*`*`*`*`*`*`*` `@i  㿈 @2 o`x ( `x'쀦 ' D@ H@ of D4d D o `  0b @P  0`Q" *` €@L    D& 02 @& 0>& 0 @ & b  @)  & 0  ` $ <"@`& $ & $& 0 ` o `@0 & 0 4@0bH@ & 4& 0@_ D耢   H쀢@&'  6' H' 2 Dxx 쀢  bh@Ԑ 4 @ @ @ ""`""#@ " b"b # А"@# &" o ` " "b@ "㿐 <@&  03"4* € 8  %& 8 <& <& 8, o o `  o x x& <& @!@w,"@@{"@& <"@@Ґ& @ o 4   & <  oc @^ 08`x <`x @@& D& Hcؖ @I 0#@  <Дb? @& D & H?/a & D& H o `  @c < @& 㿘 ! ~N @xJ?`d ! ~`@Is##@Io`@0 `X@Ij##@If`@ 㻐 o  ~b'P 'T'X'P o 4b! ~ @Jv##@IG` bĠ$@H:@0=b @ 㿐! o ?' o? $ `*`@sv  ??$  "$@sk$$@-C z  P) `F`2E`2B @"> `29   .  @CR  2  `2(  o `$@ `@t *` 2 `@Q @.u$ *`" `@E  $ 2 `"`@s*` `@0 $* "@ o`   !.   @X @.9p o`   @r @ $`a o`  @r @  $a@ ? o"` `*` *  " " " " " " ! @&!` ah!` ~?  @ :1 &!,@D?@8a 0i'Ԓ ) $@o  6!,@/@8 a̔@ 'Ԓ ) %@o|  6 @@8 a@i  ??`@??'!, : @o^ ?"!"$ ``!, || @" @" %#`""  """ "" " @۰?@8nax p  o"`' ` '' ~ bĘ '' ''' X "  T" ` 8  . $ )## # #  """   "  ?  @     /  # # # #  0% 'a, @ْ  T@" 4@s`2 o `$ 4@h@7  4 & 4 @Ԑ"0P ~"Ĩ'! |@     @@@7b@FP |`  `)%  )  . )`$ )` ) ` /``"` ? @   `2 @` @ "@ "Đ | @  .`@s `@l4@   .`@s `@l#@m c"  .`@sy `@l @ V L"Ā`1 ? ?  ܒ  .@s\ `@k@P`  . @sJ `@kݒ@( "Ē ܖ .@s9  0@   P 0 ` $ P``"Đ$ 0o$ 4" @ݐ#,  p ~"Ġ' @T#`0a@]z @@?@6cݐ JĀ2!7` a@]` <?@&@6c. 0 #@T  #P   #x   #    # ? @f H ~"Ĥ  Т '???? @ܐ) 0a@] 6@@6[`ؖ,  A A2;  ( 6????? @ 0 a6@\ݔ @У`"& (@Н@60` 8?bĀ` Đ   `   b @! G  㿘 .@ G.` ` .` * * * *  * a0@@ H   ?''''   @rך F @n A  @rɚ 6@@%  2  @`" ` 2 @t" 2 @# *  @n @s @@oR0@oO 㿀   )'''''  @r} ?㿀   )'''''H' H@rf  ?h ~"Ĭ'  @ @ϵ@5H a`Rp@ @(̀ @ϣ@56 a`@@ `K)+@s`@s2=@`@s@# 23@`  2.@ ? ? 2'@ ! @sg @u @@s0HaI@[  @^@4 !`a@ @)@u `@)@u? @! : `" @ ``@ "` 㿘 o`Ā  @m @  & aȔ 6?  @B ;`"! @?@4aȔ 0  @      @" " " " "   @?@4yaȔ 8 ~"IJ  '` @  @@4^bh UbĒ !(@rb @>0JaJ@Z @έ@4@b J 04`( 1  /-耤"" 2  @ 2`@ ` `@  .@pA  %@ `@@ `  ؀@ub @"0' ~`Ģ'  `  ? ? ?  `"/'/''''#@`"``  ` .#  $ )## #  "`"`"`"`   ?``@     /  # # ##  .@o֐ @hh3b a  @d @hV@@3b  @o"Ё㿘@?t4dDT$4dDTl@@@@l@@@@@@$@@@@@@@@@(@@@HX@x@h@$8H\p҄Ҙ ҼPذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذذ$8L`tԈԜ԰ذxנۄ۴t<\H ~",'@" "b0b0"''''''''"@" " " " " "H ')4H'''' ;5%%4-4/4''''( /%* @€"* h%"L  * :  2* @€ 4 4 4  4 4 @4@% L  k@8"㠒'@ @/'`J` J`Oc@x 㠒@$~ 4  "bJ`J`: ;#c(@xɐ " @/%"@!  "@ "cH@x  ~`%"`@В '"@㠔 @$H o"!`J J`ch@x !c@x "ܒ@㠖'%"'@Q+㠍 J !J`c@xs !09F@?  @16 c@xb Fa8 od"'"d …DB'$` ;#c@xJ  "! #@"@;c#$`" %"@ " @m "`@x- @#̔  'J`J` ;#`(@x Д~'"@*@y%"";"@<%"o" j%"`H@w   ? ???   :'''' @BЀ  @Y`x@wߐ 4b@n, @"8" :%"㠒@#n  o "!XJ` ;J`" ;#`@w #Ѐ `@w "* "!%""* "* @ %"@@ ?U? ~`t* & @ @ ? @X~  `@wz  ? '"@ . @@   @ . ?  ?  ???  :??@Ѐ " @Xa@wK   4"4" `2 a@w: 4@n h @ %a @| "@,"8 4@Ⰰ a(@|ې 䀢 4  ?p?h??x   :'l'p't@` " @Xa0@v  `"!@aX )` 0@f` a@| @"! ' ⠒ ) ' @fq  a@|  ) ( @fe  a@| @#@]?"a@||  ` a@v @( oX  4"4"""! )0 oaX!04 o""X)0@h] 'b@|Q "   /  @v ?c 4,b"<*b *******@kR$  " `@ '?⠒c @e 4 "p @`'⠒ ) @e ?b0@| Ѐ`  '⠒ ) *@eט ?"bH@{  )'⠔ +@eɘ ?"bh@{ Đ   ?`?H?P?XX  'XX 'X @mC ⠒ :Ĕ @e "b@{Ɛ ! '⠒ ) &@e  b@{ ܀ (' oa`?'@g  o`"!b@uؐ ,@"  " ܀ `%`'"`"`"` "` .%` )%` $,@%@``8` `(  耢 o@! ؀ "`b@u  o` )%`%`  /,@%@%```(` `   L@V   ) 3%@%`%`` @V 'c@uy  6*@'%#, @ @Œ "@W@uc   `  @u[ @VvԀ cH@uS @Q ߓ, @,b@  ?@ @ "@| '  @ 4ch@z h4` `u`  ``" * " " " " 2 ؀  ) .@d   ocx@zѐ  oa`?a` ) @d   oc@z  o`?` ) @d  c@z Ԁ  +  )@d| 3 4c@z 4@nⰀ 64`@z @ `@z @n`# oX @`(!?##`@dK  `X@zm #`@d?   `p@za  oX@@(0?'⠒c@d&  '⠒ ) $@d  @`⠒ ) %@d  @ @@ (?@4b@  @4h@  @  '@ ??',$@T ,$@T} "`4,!$@Tu  oadad'' ''@gԐ 4`4@4","b\,  "`,\ 4@,""\,b ,@ɐ 4",` "@Ԑ ,""`, ?@ ⠒ '7@mɒ   @-`,$`, '4 $','('<?'0'8? ''@z @ `,@]@c ,@ ,"!@d,@4⤀`,4 @q 4☀@6`?  ,   40 ,0 \ \0∄ 0` `㿈@; 4"`  o!xB!@ąB' ' '3bx'''@S  @g 42 2  (   oXx4"`4✀  ? o!T8"*8!, "h. . . . . . . @o: @k4b    ,* &,4 bb  .   . 4 bp  -"8 .  . . . . . . 6  . . . . @iє  o"aX 4 bb  .   .  o   6  -"8 . . . . . . . #X. . . o. *4"4  `* `2.  ` . ` `2 ` `-"8. 4. bp. . . . . . . 6  . . @i  o"aXD 4 bb  .   o.   6  -"8 .  . . . . . .  X. . . #. ,">4̓*`,2`2  -"82`2 . . . . ` .  @ ''ܐ@V  o!X`4b4,  h?#@@ "`"8'? "`"` '@ b 64@ސ!H4"!P@b    oa] @   , (b<`?㿘4 b@iv `?㻀 ~@"Į' .S-ꀢ   `?$  '$ @*Ӕ K`M @2J &@@`+=`) '7 !@J   နሐ@9$$ې@*Ր  * ` `@x@*:  ` ``2  %@ @]!@ ~"Ķ' '@3  `?@ 4` 4   4"as@x!p ~4"ai @!@ia ~@o@_!W ~@ 2@U"M ~ 2  4 4*`  b̸  /" @UȔ ''@ݒꉠc o o ȅ ! o?ap HD LL? :!H:a:p o!x -:!x/ o, T,2`"h @O: L@J <  4 "`?"'"@:: T@6   *@ , 4"`ܸ` oa\ @^ " @6`@у"8@"X"a  ?Д  ??'//  '' ' ' @['@a"h4b̀ "p@X @S" 'bH '``:q" @  "@=g" S4_ M'4 , 2 # o,"haT$@뻐: MaT@붐 <  4"`""$aT@릒: @뢐   *@ -4"`I @"@  "     @""@" "#@ "  * @`"``  `  @Ő#("@%@"@%@"   `?!' M'% #! " @J  a!@К `  '4" 3/-)`@ @ @@g  @@g?, '@`H#P@p Ȓ $ ٤@ac8"!@[#X   %@ #`#h@K %@ ` ~``?Q"``N`0Q @6#H   #x#@)`#@$` `"@#H # '`@#H#@ ` 뀢  `@#H #@ ~``?"``` )* "`@ǐ )"4"a) @Ր@ڐ"@"  ~ ~ c``?"`#` * $#`@ "!@@S.#` ~" @뿐#؁㿘     3'%#  )2  2" 3 # 1  @ύ@ @χ`@M   ?  @   2 㿈 ,  @k   ’  @̭@W 8@̥@O ` @I @: ؖ ` ~  bĖ '*@- @O & @$@   @  @%+)'@O a@ ` @cO . !@ .@`@ @!(㿘 ) %뀎 # @@ސ!8    " 6 6   " 6  6  `6 `6 ``$    *2 2@@@ΰ@@6`ƀ 㿈!H@Ρ 4b !    "@Δ!h@@ΐ!@c#   &? % @#80S Q O @/ `/ `/* ` B/.*2  * @  6` .@, ?#5 @*`  '`,`,`` ,X` 5 , O  ` * @* `4" ~bĴ '        @#` @#h  @ ! ~ c``?"`c` * $c`@א `4@!@  " `9/-+)뀤  @b% . @j .@ѐ !@ʐac`@ƒc`` ?"`c`* $c`@ `Р  @鹐!؁   )  / `   2?   )  .$ `   2 㿘    "F # @ )/` ,+``0) ?4"p@cޔ   4 `"   @4"a"  @@#a  $ ?  @   2  `  " Є@"" @ "㿘@ @L{ @8@K  4" @Mِ`?" @̐`??cp ~?bĐ# 4?'#b/@3_@$%40@3T@$4b P@3H@$4b  h@3:@$ '☀@$ '@3*?뉠'녠…F?@3??#c @$?#b@$☀=?4"̀`7 o"' o!a Ƒƅ HD @ o??@8^8?# oax';` o ?#apat;h#\@2ː@$b?#@bϐ@  b ~@O#`b @-#P ~"Ē`'*`%" € `!%"*` €@#`p @#k @#f @#a @#\ @ X   * * *` @  H @   "  @ΐ `< @ʐ x8  @Œ `3 @   "     @ˮ  @˪   @˥! @ˡ!  * * *` @  !(@˓ @*b@ˋ!@%b@ˆ!P b@ˁ!`b@|!pb@w!b@r! b@m!b@h!b@c!b@^!  @_ . 2a@ .@L"  @_ . a@Ք ."@;b@6" "8@1$  *` ` *`%" €@""@4@"H4@"`4@"p 4@"4@ #h4"a"b  "   050    @_8 . 24 @"bĀ@ o@"zb!@ڐ"Ƞ' $ "@̒fb@ǐ"abĀ L  @_ . D  o* "@ʱKb@ʬ#@ʩ"8  *` ` *`%" €@ʚ"@4@ʕ"H4@ʐ"`4@ʋ"p 4@ʆ"4@ʁ#h4"ab `@v"b o!*` @m#b@g# b @l#8X % ~,  *  *`@Ĕ *4 #? '*@G#H  +     2`#\@9#h  @^} . 2a@ .@'#  @^l . 2a@ .@  @#㿐4b@ `?#\!!0! @UC 1!!0㿘&@ '@#p S ( <G& * € # #@Ԑ#: #@ `1*`@Ő# `)*` #@ɻ0@@ɷ#0< * *   @ɫ#00 * *   @ɟ (0$ X@ɚ 0 &@  &@  ~``?"`` * "`@] 0@{ p(N@ ĠȢ̂ЈԖؘܚ Hဒ `@ ` D `x@h H 2H#l;p#\#`#d#h;x;#`@O #" 84 @ @ `. @ ( 4"`@  @ #@``@&@ " ~"Ĭ'@*Ւ . "@_"`?Z@Nx,    a@  `   X*  R *J 2   ???????????@އw/w@ޒ @ގ@` @   @L  @\!  @֐ @䠐!㿘 ~a@0 #@q 㿘@㿘@:#:"c(!`@$cH ?L " h $cH h @*ba`?#:$cL@K %:@$,@F@5@ @" @/cL @-|!@-y"@-v"@-s""" @  @0 b(`@*. ?@-[ @J@ - +J` 2@@// 2@@/* @/2@   ?@@ "@@`@z `?,  o@  @A @N0@  @G@א  @  o!Ԁ  ;  cL "0@2@ @)@=@ @= @Z  @  @a 0@w @Y @S @?@S 㿘@^H  @@)㿘@RҒ  "`@2 @6  JJ "  " J@! J ?( J@( 2  `J@   㿘 4""": "cT@  o! :#, @@@0f@. @=@' 0llllllllllllllllllllllllllllllT`' ~% o' ; T@Js# oa 4"@]' , $a@bX"h ;#`n"Y ;`2"Q ;`"K ;oĀ`KJ ;jĀ`"K ;`E ;aĀ`Da,E ;Z !@"J ;g"@ ;d: ;KĀi`"9 ;"@6 ;A%"@"5 ;#@- ;48!@"* ;p"@' ;(%2#p"       ;               2cp:̐ Ӓ ~Ր ?':: #t"d"''////4b@\ ,!; T @p(@ T$ @_"x㿀# ~bĠ'b @(" @m@ِb @D"㿘 " 5J    0 @ # 2 @0㿘͐ "5@ . # 2?@0e㿘 "5 # 2 @0i㿐`h @D     2 2 :"#`@x" "@  :" :"#`: "c``:"#@_" "@  :" :"#: P"c㿐!4?#`'2'9!`*` """ " """##~    #,# *` 㷀/ ~'@ # #!5$#@/ 4 $#+#  $#`-:@0#:#(:"c#0:"c#8%|#@$cx #H:"c#P: "c"cc:::::::##p"cX#ch" "㔀  l;" 4c8'#X5`"#8 @ ;*#r#`5 "c#h"c#p5 "c#h"c:#Ȁ 5:#L 2c#x5"c#5"c5c 25#h"c5c #h"c#˒!5 $#PJ 2 #h o "$#P#cx5`"#TJ  #h o "$#P#5 "LJ  # o ""L#+5 %cHJ 2:#h:%cH"c\ "c\)!5#5#h#\#c #X@c\#Xc\55#\#`d@c%#Xc\55#Дhl#\@#Xc\55#ؔpt@#\K#5 "cx#h"cx# 5#8 5 "c|J #"c| )좒 "#hcHJ@  #h @. 5 8@%"@Z @'@q5"c< 좒 cH#hJ@ :#h#` @.ϒ 5 8@%ϔ"@Z @'@G 5"cD (ؒ좒 #h 0ϒ젒 |#h| 5 "#@@(h5"c@5#@J  p "` @ 85㔄 㔝㿘:#`!5<@/3$##㿘N  N@ *` o "a*` "N@  ސې6㿘\t &&&k &#d& #h&㿘; $  ;5:i#<@.c`;  2  o5:i#<@.c` o "aЁ㿘! o!Ѐ ;   ;5:i#<@.c`; $ 2 $!5:i#<@.c`$!Ё㿘5i#<<@. 㿘5:i#@<@.c`㿘5i#D<@. 㿘5#H@-ג i<@. 㿘5#xJ :#`i @.~<㿘@,% 㿘:# 㿘5:i#L<@.cc`㿘5i#P<@.Z 㿘:#x 5i#T<@.M 05i#P<@.F 㿘 o!؀    0 @(@P@9@)8@J@: @[@K㿘5#Xi @.< o "a؁㿘5#\i<@.  o"!؁㿘5#`i @-< o "a؁㿘5#di<@-  o"!؁㿘5#hi @-< o "a؁㿘5#li<@-Ւ  o"!؁㿘5#pi @-ʔ< o "a؁㿘5#ti<@-  o"!؁㿘5i#|<@- 㿘 ?@-?@  "! H `@K ? @c @ #\ x@,Y 0A    @ ?@$?쀢 @,: 㿐5#d$` ?, @  #  @# $@ #( @E5  #5 @ !:`?#`?5# $   o!耢`5#$ 5@} 2$#5#,    "`   "` & > @ & & @ " #@ %5 * 2@  * @ @B ? 42?@(?d2d d@ od 2d ?@V ? 2 :$ @+ bs?:$ o!䀢? ! `  ?*#!  5 #$" @) ?倣  5 @+} = 5# d;  B;d   & :# ;d0  @0m' @+@O  ; P 2+?5@, `"` @ "@@& &@" #@  "`   "` & &  " # $( @[%5  㿘?  o!䀢? @+   o"!5# `?( " # #  2 㿘@ W? 4^ @ 8Y  c @ F%5*2  $ 1: $$@) %d45 d8/  d@?; P d2 d@  8  +  c @ F+ 3` @* @ ( 㿘15#d @d#:0@D?   P  @L?; 㿘 q 5$ #2 5@4  2 @( #25# "(: :?50?5$ ( 0 $(( @B 㿘!5# @$@ ( ?#?(#@`"( "(`B : 㿘15#d( ? "d(d 4#21?d$  #d  #d ̐B? # ? B?"(: 5# @$@ (@    o ? o 8   㿘5# 2??0:0  !5??:#2?!5#@+$# ;$0$0 $4;$ ;$@#$($ ?? ?#$ ;$0# $ @T ?!@)w 㿘` @J8  5#?d? "d;`#@``#`` "`"`#`#` `" "`   5*   ?㿘!5#@ c` @"`@@P"c@2`#"$㿘  @Ta ?  㿘# oa@v!5 $$#$8@Iא   ???:$ "$:$0"$ $#" ""$:$"$(` aӐ a#d ?"d a@S#5#d?""d:㿘!5#$  # #d 2   2#@Wd#?"d` @PD# o!$#@& 5  ?  H  ?  " ?    㿘  !   5# 5# @$ 155@ !@    5 #(@$ 15#0@$~ 15#8Hldh Xxd56666"!("a""ḝ㿘66"!"a㿘@&@T6!6@"@T!@$!㿘5@S#㿘%6@&@Sa@$a$%6J "#6@Sݠa:@@ @㿘!6#6!a@ 6!a? $!6!5#@6"!㿘):'6+6#%5" 2  a:  @ J L@S @#"@2`@:`@ L $6a%a㿘):'6+6#%5" 2  a:  @@ 5?L@Si@#"@2`@:`@ 58?5#$6a%a^㿘%6J , #6@SEa!:#@@ @S8#a@@  J  "y`@%$@S#a @$a㿘#6a5#@JP!6@S!!6!@ aa@S$a!"@$!5N   㿘!5@R#!h 0@R#6ᰒ# @  @*`@ : @ᰰ *㿘16!!5#@ !*@`J@ 2 `!6!  !#@ L#   㿘6!J V 㿘!6!15#@J #!#@J 0 !#@J  㿘16!J  !J 0 !J   㿘5J#  6"!6a*`a6!   o6  ἁ㿘 @ Z?`dpB"*` hd16!J  16!J N !6!15!#@(!6J !6!15!#@(4 J . 6,"!6! 0%16!J  >- [6 "a 㿘6a "a@C  z  㿘5H㨴  㨳6.@.@H@(0?д(`? H@F265#`|@PP (d'p*-&X1421+\'&*|-H,X+2d/P/+4|0X- +12,()D-2&x'42220/@)33--.l.144*,1T224444444444444444444444444444444444444444444444$㿘@*J@#㿘6s""$z76$ @ 㿘!6"( 6  W"b$"( @Z!@"(!T!P"( N!`"( H!p"("B!"( ";!7!!8 㿘6" q !* $!㿘@Nc? Lݠ?:L㿘@!6"(!! @g @j "(@Ɛ0+  >$"(@  @  ` !6"(@++"( `$"(`瀊``" @! @㿀:#`6 2  :  :"("0 e6""$#;`P6  6:0  *8@,:#T ?I`P 6 e`P;`P 26 e- e!6"$ "/ "6 "$ "/ 6 6)/@'쀢`H ??`cF *` b8   `P6b0 b0 !6 "0b0 ;" !6"0  "0` @: <"0; 6@"H"0  @ G d66b0 b0 !6 "0b0 ;" !6"0  "0` @: <"0"0  @ s <6!6"0  "0 `   <"0; 6"0 "0 6` (66@"H6"4!6"0  "0 `   <"0y"0 !6"0  "0 `   <"0g; 6"0 "0 6` (66@^"H6"4l !6"0  "0 `   <"0B"0 q !6"0  "0` @: <"0,; 2"06@-"H"0 ; !:@M`P :$#  "  @  `P  ; P $# " 266b0 b0  b0 :"#0; 2:6@ "H:#0 @ U r66b0 b0  b0 :"#0:#0 @  Z6l x@/@&@II6!6"0  "0 `   <"0@ "06660   :00 0 ` d  d:06@%"466b0  b0 @  6@ b06u60 :  :00@46f@$'"@^>6쀢 J 6606 0 "b(     :0\606 0 "b(     :0Jl!6"0 "0 `6b(!6"0 "0 "b(    <"0- "0 G 6%6( ( ?  ? #6b0b0"%6( ( ?  ? "@(#6b0 b0$(`     =  @&$ $$  ?㿘 p  #@Y 㿘 p ֔ # @K 㿘ɔ #H@> "@ >J@H  @3` @ "` g .`"+ ? & +`J`g+` f`J@`J@J@"`J@?`J@2`?`@ Ɔ d㿘 d  f   d f" d㿘 p 㿘 p 㿐 p ؔ @H 'N   p ǔ  p:#t) ~"Ģ'@ :7 #d@ 1  +, ,԰ ` ` 6 d` d Ԁ"Ġ?3L ?"Ā "C" @#㿘@ @Hi@H&@@  0&  & @   @  ?@   oJ!N@ "    oJ!N@@`  ".@ `@ Հ㿘`@HT@ @*N@  N@ "`@ `@ J"?8J?   ?J?8?㿈# oa "@6耢?a쀢?a@-@! p "  o@a6bX@ @CL $  o"!㿘  o!@0 @㿈+ oa" @aa   @^ @'@ @ V c@  p  L'@ڐ '#@}@B耤@f@B@U@B@B@)q @4  '@!'#@\@B;   @ @ #'@耢 y Y@JĀ@B o"!@ p6" "bX@%aa:@yc8: "cP  o! ! o!@ˤ`?:#, $!@@@!!< ; 8 #'@@Bw 㿈@  @ |     o@! @BN ! o@~ !@! @{@m 㿘 o"!@2 㿘 o"!@: 㿘 ; P  @@퀤 А 耤  㿘ݔ 㿘 o!Ք 㿘Δ?㿘 o!Ɣ?㿘 @^ "  @㿘1 o! "!@ !㿘 @?㿘@9@D}    ` Z 㿘 p@3  " #@ K J#㿘0@?@㿘@F1   oJ!N " N`6 oJ!@2N  2/,  ,N`&  oJ!@2N  " ,@@FN ",`@ " ,N  ,㿘   㿘1 p 2  Ӑ &  0&  㿘. @> @ 㿘٠@EL    o*`J!:`@ oJ!@ L 2  L   `/ @E U   o oJ!JaH@vN*`:  @"@ ,N  ,㿘 - L@ )@E^@E[ @9   P X@<@1 @@ @G@@㿘/ `˒  㿘L@) *`: `#`%2 @(L`L "L`L@ `%`#2  o! o! "@`@E`L@  @漒 L@1*: `#`%2',@(L`L " ,L`L@  @`%`#2  o! o! ",@`?" @ @Dɐ `L@  @,P% ~'a !  @C ?   @ǁ @   @    @ h㿘  @C ??? 㿘 d9  d@ ,,-@@?@D`, ? $@  $` ܒ$,㿘@ x )L &x  @D6@D3  @@@?n`@@?g0@ݒ`h:#H WאȬ( @YؖȤ  ؑ,7@ "@C@?>Ȥؐ宒 Ȥ 6Nؑ,@ "@Cې@Cؐ$@Ŗ@?ȤN  @CŐJ? @C*?@]W@?@?㿐:# Y :#H 2h N? L/@ఀ "Z L |  @C@CP   2 L %2 J  s2 @@Cv ,@Cm 倥`"@>  V @:  @ O&&@ Ӑ@L@  㿘:#H K"@0 A@C/ @C,@C) " 4 L %2 @J  s2   @@@C`.`@B@ ݀ @>C @Z(@ϒ   <  `?@>*(  @BҐ  䒐@  p`@S0$@Ŧ ;@L  <  @B * n@  p`@/@=(@Th 6   ȝ㿘:# 㿘:# ; P @??  :@ :c "c㿘:c @U"c㿘    :#`?4 :#쀢  :#`? 2?3:c:` "#:#`?@ @ @c耢  p 쀢 T@Y? @ @ "d?@ @ic耢  7S? p 쀢 2N?@ I? @  @   :#` @ߒ S:@<.  p 쀢 ?:#:#耢  : p!Ā :: "c:#耢 E@:# ; @ "?8? ` Ţ @Β?  @Ր ? :# :"# ; P :c "c  p" p@d p" @ %?㿘@   :#`?: :"#@Β`@G? @? `@#@ ?㿘:#Ȁ :#  k  E 0A@X??5 3` :#` @ ):# @   @9     @1??  S:c  "c| 㿘@ ?  `@ ?@1U p耠 :̀  :耠: #`?㿘 @j  p   " 2 㿘`2@ p @ && @" `&@&  pa  "a 㿘? " " pa ?"a 㿘 0! & ??> . & & Ȑ㿘 @ ! o!@'$!ΐ@; @; 2 p p  2  p  p 㿘 2ސ   p 㿘# p `@ ` 2`2  㿘  "   @: `: ( :@ (:` * J   "   " 㿘?;-  p!0*  ::@ F?  @F耒 @@uD? @?`? 0#;- (B? @ ;  :#   ? : "B?  #;`P ǀ ?  @?:#Ԁ  0`P   ? 㿘 ;`  p!0*` :  @ @ f   @?F? x:#Ԁ '-;נ  -;0; P a  ?0U`B -;P K ?2-;s 稒 9 @-@>眒0%_B? @ ;  ::# :!"#@ ~ۤD@F?P @? ?D  @y㿘?" oV 0`F ?   o:!`F ?   o:!ȁ㿘  @* 0 ?   :#`  @0:#`  @㿐@r?    ; :#@0`8?{  :@n!@ޒ 0?!@@ْ㿈@@@[㿘?  !`@ -z?  !@ 0@   2@ 8:D?:# @ 㿘暒 ; ? \O ; #@㿘@ݐ@t &@ߐ?     8 w;@Ґ     ! k;Q !@F 0@  @??   W @8R(:@8#`"?   0; ? ܀@ B::::#`"c""㨚%? И 054@  ; $@ 0 %:`? =? ߀@ :"#@{`?  㿘!6 "bJ 2 !"b ޡ$ p"a( ޜ$ p p$","0㿘% p0' p* (@8 ) p  !,@8  00@8 $( @K,   $@<@0 $@<%!,$($0 :666666 ` d""h"bl*x#"p #"p6 tx# ~!:bĄ #'  @  :#؀ 5 p!(6"`  o*aa`? p p o` o!Ȁ@!2  p   p p!, "`* p!,"`*@66`d `"`"d#䀢 56ؐ@2 @<< $  p!6 p"`!(a0 "@ @    6"` p a,*@666`"d@bp"`#"d#bp66bdp@b p!(6` + pa,`* bd`p #bd "`b @a!㿘L   N  `@  "NN `4N&J 2 J `JJ"  㿘%6#6bpd" 4!6"`" 4 o!쀢  p!(ѐ  p!( "`@4"  6bp p!(@ @  p* bp,@ @  * "`" bp6:`d"@ #""`$d##  :    0   0  h::l:  :    0   0  X:::p㿘 o!쀢  "* %?`   !6"``   p!,@J?` `"`` p!,@J?㿘6 p` pa(?,"`J@!6K"d"@$"d㿘6"`?,  p!(J   @  2 ? p 㿘6. "@:`@ 㿘` p"!`B @W 6bt  "bt5;   {  pZ6bd:@@@ 4Y  p!056`?@ ` `J `` p!(@J? 2`7 p,@J? `  ` ,6 *?d?"d`` p!,@J?   2 p`2  p 6bd ?"bd p!(6"` p*@"`6, *@d"d㿘6"d: p!6cp   $@ p?4* @@?? p*`!4 p $@@%$ *@@  4* @& pa4* @" > 2  6b` `"b` 㿘%6Lx  6b@2b ",x+   ; 0 6,x:" @::#㸀@:#62  d: @  p!(6b`*#"@㿘 ; 0      0Q;  6"` 636bh + o?`(&bh %!6"` # pa(. J?:`@a("`J@  Y"` $"` a&bh쀢 -  bh ( $!6"`# pa(. J?:`@TRa("`J@  +"` $"`6 2"bh쀢 ,#6b`(  6"h " ! p!(. J?:`@$!(b`J@R  b` $b`6 "bh쀢 !6"``  p p!,@J? "` ِ ~  p!6"`. !(: J@  _  p!`j _  _ /`_쀢  `  p"` p!,"@ @  *"` !(" J@ "` p!6!("`J  0 "쀢   6    6   6 "bh i   $; [  Y"` c$"`  ; 0 \ F 2X ;㞐 8;  A  ">㝐 oa@8T6bd:@@@@42 N -*`: l 6"``""` N       M 6b` "b` 㿘6J"x  6 !:6bAb!::##@66G" 6"d:c:#  :#  p;  6 p!(6` + p`a,*@` "`6 p!( p`:*@a,`* ؀  6"t !( **@a, *@ 2$#6l "@:܀ H p, pH"@(6 : l"#㿘??m  ?9?  ?&?!(/*  ? p !0? p  p B? pa(*a(&㿘 42 ?`0F? # p?/? & a0 p!(? * p!("@@67 p!(?*  ?怤  pga0 a0`B  p!(&㿘56 18   6 38"&`  > 76&""  > && > 6 @b:㿘6 b2 Ob 6 4  8 6  @"8 " :`:`"@"`$  $@8 #6␔␠@    4 2   8   2 8  " "㿘"@   p "a㿘!8   d$ @$ 8a` ?$ 㿘:#䀢 ?   62 `b  bb 4 @8 @6b8 " b@ f4; 9 2M 8"  ;P= ?"9 D@ p"!47@50D 2 8"  ;P ?  SD@8 p"!ߒ㿘  62 `b ~ bb 4@866f"" b@ f4- +g 2=?B@@ ;P) 2`#`D (@%? 2? ;P 2??D?@U㿘@ ʢ ? ? ? 3:@ v?   ?c`& ?@B? 㿘N -  ۱@"0@@"8s  @u= @ @-U @7} "@@!O 6@-Iؐ"P ) L@ &N օ @4Ɛ@4Ð  ւ.X@@/ N 2"h]@5@/@75 @-@71@3  ` @G@D"p@H@) @ډ: "c@   48!   ??:㿘? . 16*  ? "@0  . 17* !x㿘 '"19 . $0,! ^)8 o!  > & 1"{ '":` o8!> & #!!8!@ A  o!$!"  ?  ?"@  㿘`?㿈  @  o> &> 㿈@ 耢? o쀢?  o!8! "$:$:$㿈 (9"2?2 ?2  o!:##"  :" o??@"͐ 㿘[   o! "@r ??  48   ?? ;`㿐 b'@  2` "@  0 p"aӐ㿘   p "!ɐƐ# 㿐 6:  "@098@?Ñ* : `:c"*` ; D`; H`; L` q#L ` q#P` q#T`; D@.@Ԩ &#; D*` '#(@㿘    :0:#㿘   @㿘  o d "@m#0 q@j#x@g#8@d#`@a#@^#@[ Ԫ ' ~Ā 'C  0İ  d@А  *`, @@*`ВБ:  @ p!4@. $@ EN@ ,`  T?* @?*`@  p p" "aI"ᴒ`H0@ % p .0  `X0@֔ 0@2E@2B p4.   "@@+` 瀦 0@20@2- "@@h0@2$@2! p "@@ x'(#(@( @| 㿈 + o  "N@00/N@ @ o o*!&*aN`   oN`  @ 0 o*!N` ` o*! o*! o ! a//' /@㿘:#     @ 0  թ@׸  o"aӶ ; 4:`||||||||||||||||||||||||||||||||||llllllllll㿈 'D+9b "J@   2%b € %b @JD@ b `"@%b %b   DJ ?`03'De"<*` DJ@ +`? `}'D p D"aĠ@| +@ 'DJ@ + ` ' od"aⷐ aDD z?'D @]? @ @< 2 '! '@Ғ '  "    5( D/ )%`? !@ J  D 'DJ  D@U 'DDJ uD@ "@€ DJ lD㿈@'H@ @'!P ` @@' !h2``!" `@ސ'!@\0ɐ `   HJ " `@  "{``  "&   o`L Ci`"_`"```" ` \` `?V"``?Q"@"H`?I`?E` ` !      !    ` @f`)"@4(`$!"` ``H@Δ쀢 2 `` "` "@!@̒ 09`  €H `  @  `  "`  `` * @'@`` : "c` @  ` 㿘19"@ "㿘@א    S@ 㿘@ː  ` 2`9 @ 㿐'"@U㿘9" J㿘L@ 2&@u &@+*`: `$ "$ @ 2 N $". -  & &.   &@@U@@*N 㿐  L -2    ?А  &%?`'"(@#  А  * .  @*`: В@ Ѐ$&`2 㿘 pJ!Ѐ`,!:#L " L d2 ;`Xx $ $ $ $ $ $ $ $  `"  "@ "  €  $L : pHДJ@   `  ~*`P  $J2J ? ?* 8-`? 㿘@ @v:#   q qc "c"# q#  Ј  @n? "?㿐@㿘@_@@.j@.g  &@N㿘6`.  .`@B2`* @ *`B2*@* @ d  @ d  d@ @ 㿘 ( >@[ @2 @2  @ d @ d @> 㿐; P : v"c M >    0    Ի       Գ  Ԑ  `@D 2    ;" @ ;" @Ԏ ;ԡ ;Դ;k;" @㿘% q9"(@ o!    @S: "c$㿘;`<  "` `6pl!*` :":"0 e@ Ð?P L:W#:X# o9!@}aM:M#:#䀢 H Ҥ?2C /  $< 0::8#P? 0Ҍ 4+ )`'% @  | `o@ l ?2   o!@  㿘?`6l"ȓ*` T? 0:+#0s  `:#` F?:. B 8 `   |`z:#`?: F?@ `ߐB 0 o! o!$5 ^͞ B 8 Q`O   H`FF?0gFŞސٲ ? 20 * !    ̐ѭ  ^ 0'::"0@ J ? "J? 0&!0  o! x  J:" ?." \ J2 02 0?㿘?* : ` &m p*`  ?* : `2l#*` &@?&@? &@? &@:#&@&@?㿐#:b0%:$N 2N1N!`:&`?`%%`.2* 0 `\* Ñ: *  N%  N '( 2  N  ?'  N 2Nb0` @&b0㿘 q#L 㿘:#::c:;#p D"@ *"@  :"cP㿘:#::#p"@ "@ qT㿘N@= ` !@   @ $  X* R  N@ ?"@N@ 2 @N`  `N@ "N``, `N@ @(,L? "?,: ;02 ;0" 2 ;2 ;" J    J  : 2 q qpt@ 㿘:# ':z 0 $:#\ ):l&$#` ? #`  @  拒̱W#` ?$㿘 o!?!`?E: o#\?Ȑ?!:Ȁ;!-:# +:&c`* n?  c`e 4?2c`? 42 c`@( c`;ac` ?㿘f :! 0  `?d"㿘b! q Ǥ @Lє   # q@!#! ?cp "$cp@W$cp! q#t @!w:$#t"c  㿘! q#p " q@W q$#p"#t㿈:# "  q#t@ q#p@  @z耠`? &@ & 㿘# qcX "?@  ??:::$cX::؀%; oaa"; oȀ2; ;a"; 1a;+;-  q:2'  qX"" 42 2" 4 2 ( 2 㿘  `@ 42 ` @   " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@ "0&@#㿐)  S`   ` `>    2 J@ 2J@> J@ 5 2``'D J`  `'D 鵐 J@ `D` D 'J '`J@D  J` ` 㿀'P>'T ;'PT  $ PT "@@ 8 F :`@ F :`:`5T(N  PT  Pj q'#X`2@㿘:# :#:"#h㿈7耢?쀢? Z? @? 㿘~; :`"#㿘 ` V ~?P M&sF ; (  ` ? 9 : #` ) ?* '#:c` "? c` 0?? ? ?㿈\! ; P ? 4 d d 2+:v4 ̔ `D  D?? : #d 2:M#䀢  @, $Pv# @ 2 `  ";  ;`;;  `` 2: 㿀`N@ 'e 2:]!# "@U!3;`  \ `  ::c :"c:1"#(!:#Ā   :U?`"##Ā :"##:"#!;  ( :""# ??? ?+"c &??#\#`#d?  ;   02;:#;    x#:c-:?耢 Ā ?? 굔 ? ?@ @c cc`@ pB!0*  : 9Fc":c2`(  p!0*  : F:#@#2: : p!0*` : !0*   * @ :`@ f # 4 (:(&:##\#`#d ! :##?"    : @?::#::J@+`H8 2 H "H`HK@2 `2"2" J@ @ ;P P;P P;P P㿘  ub@o uc@k uc@g 0 @d  @a  @^  @[ 㿘; P Q "" P @N  [Æ  @C  @@ @}@ uc@8 v ': "c #:%:c `c` : 2  : : "0" ǃ pa :䀢 "a: "c""0ƒ x'''@ ؀ ?؁㿘 @ L"H; "`T "`T㿐; T4 ? ?O̐ O   /;㿘@Kۜ                          ,            Pdt  ܄ <  L  `  x  P᨝  ~ "Ĕ!;$! r'`0''@ X5 r1 r! ;' Fv* @€  aH@( &  "`aH@(   =&$` #  @ܘ  #ap@(ܐ `@$`8s$` r n"` j$``(f$`#    @ֹ #a@( @R`$`4 O$`#   @֡# #a@( `@$`(8$`` @4$``@ /$`# +'/@-)+ ' rX@h"p`4" `"P``@`"D```; > "S``` < M{ @"V`@"M`40@Bj @)e @"N`@@C[ J@OU  O$ L$``(H$` @E$` "A& a@(!  "`a@( & =3$`0$` r-"  *$`  r"`%$`  r"2 $`$`H$`L$`P$`T`$`$`H$`$`L` $`$`P` $`$`T \}#   #@Κ";#a@'ΐ i"#   @ջ# #a@' `$`$ S$`` O$` $`   rI" #   @՛# #b@' `$`, 3$`#   @Յ# #b @' `$`  $`#   @o# #b8@'o `$`0 $` r"`@@Tٔ ?T? ~`t* &@ @@`@m@ @bP@- @  @Ր `@+ @zp`-bh@'- b@, @ h?'; @駔 [ Zb@' @镒 @  @鏒 : @C"  *#;@2`\  r@X 2@B" `\@  r ` ' ` Ԑ =$a&`'   'ش ;!7;'a `&h9; X-a+ r h; r   o-  5`   ؐ@䘒,    r` 2ta@g#oa  X2`''` 2  ܘ @ߛ   X''@ ܰ  ` 2Ja@=# Ea@P^& $''$'' #\@yz    2`؀` r `wc0@C@BQb` 2ac8@8@BFb a @ @$aa? #$a1 r  ?@#&  ?cH@+ @ @@  @  @  @ϐ#P `& @h <a N rh h r `@ @yB h"@h#X@A0; X2  &`&`&` ;&`D&` 㿘'HH@F$㿐@遒 J @ "`E    >  &` `@ꑔ 6@Q` "1 `  ?+@ꃒ` &@B ! @@8 `@"` `2  ` P`  P&@ 㿘 h  ~cp@ΐ#@ 㿐@n ' @+@ @ `@㿐 # @` "L " n L  o  @Ԓ = ",@``"@4 2  . @ @ @` H P`(@%*  2 &*@ &"```@% `"(&@ "$&@@xC"@Ц # 2&@@x/`"2 &@`@$  㿘@/㻐# ~bĠ' @V ?6  $@p  , ( & J  !  J   2`J  !    2`J ݚ`@ ߖ@b @Q   :+  J   `H 2J   ` 2J   *  㿘 ;! @뙒$0! $@뒖@  @S&& @ V & @ܐ 㿘!;Ȓ$@w! @  ! & @ &   &@& & @ 㿘  "   `4 z @$  㿘   @͐  @ `@# 㿘  `@W 0@l 0@#ߐ @s(((((((00(Lp(((((((8((((((((((\l(|((((((@P(0`p(((((((0㿘 h  ~`@#@ 㿈<!P  %<`<#x << "cx<Tl@ `*``!<"l#@>*`$#`@J? "<# O<# KN ^`?` @J? $`?#<c   `@@T<〓*`" T * ##c ##c&@"#\###`###d@Dp<@ː`T!<#*`" T#* @̔T#* @*<aT "aT㿘l$ @c 2@(`㿐c@̻ cД@(   K @X 2J @cД@(y @(㿐 h )<%#J f g e    <c  "c<c "c<c "c   8 `S,| <*` `"< :"ch< 6"c< 2"aL< ."c< *"aP! ;#@&"؀  r" #@  # r "`@"Ȁ  r  "``@!d < "c ~ t@@   r  r@NҘ  ~ t<#& *`` @h`@Ӑ 2@   <A?<# /<<aX "aXT@$<"cT@ T3< 9&cĤ   <#  !<<#<#@@"T#<#@@  #<cģ- @@?0X "Tc!<!`@@Ԗ"cД@  T Ϊd<#   ~@|#`  <!H  < "c 2<@ @V`?#d "?@Ԑ ?  @??@A`? @q @Z ?'$@)?  <  Ė $ #\   @Ŕ  $   $ $ @+ @\@ 㿘 @= @Q@  <"(H "   "J  2( "@("<< 0 ,㿘@ܐ㿘@  $   $  $ <  @<, `$ $<","!0<a0""a0<4<a@  "4@<,`<  4@ 4 ",< 0 㿘0@% -  㿘0 㿘<#<c@   <#p 2  ` @VΔ  @%   0  `!@؏` 8@ @`@W 2`:@r `@@%k 㿀   P`h< `hY <# 2  p@# k   r 䀢 3< 3<a@+%<t <# 2@̐ x @Ȓ#<c   @!<#   @ t 2c 2# 2 r 䀢 2 <#h 2 @㿈<#x <!LLE '<T ?  <# @<#Ą  r    ?,`@? @kX <!P 쀒@2   2     T`@Ơ$<!L `?   r 䀢 23<`A3<c|`< 9#t 5<#h 1 )!<# `<<!@<!8@ <!D `"<@  <!D<a@ $#`&c|S<"!8@u :0@q -c|?&c|㿘@<#!<#& &$ &$&$ &$@  &N@   ~!* R *  &N@  *@& *  "    "  #* `#    X* R  *`" #   &㿘@7& &$&$ &$&$@J? $  ??  & &$ N@ ^<  ?& &$<#  <#    *?"   $@`@Č  2 $ @ ?`@Ā    ?& &$ @i $@ @ @o&  *@ Z<  !@   2<  !@   < _ , = - : / .<# "'    ~!* R +  2  :  `&   `   @ِ &a? &<# 2% <#t 2  2 2  `   ?"6   `&$"@"@?@&   "* "    6 $< " c*  `#    X* R  *`" #   &$ "  @ 㿘??>>    $$ "$  &   2@@ ?2< >   :>$ "t @  ? !@   c ? _^    @  !@   G@ _C 4 ? @:@  !@   2 @ _(  ? !@   2  ? _  @@/"@ ?2p  $  < ; >>$ " @  ? !@   2R  ? _"M     @  !@   26 @ _1 4 2.  @() @  !@   2 @ _2   ? !@   2  ? _"   $  ? * @$ 6  @@ ?2v < >   :>  "v $ "r @  ? !@   2T  ? _"O     @  !@   28 @ _3 4 20  @(+ @  !@   2 @ _2   ? !@   2  ? _2      @* @&  (|㿘@  `@  㿘@  `@  㿘@ `@ ڐ  :#? @ @ <<`."    ~*P@"    * ?2`@ 8  @ @ 8+ *㿘<#    ~@c` <#   ~``? "`` .`:  `* "`@8? @{] ؠ <#   ~``? "`` .`:  `* "`@8   @{:   ~``? "`` .`:  `* "`@83 ~  @c`c``?"`c` * &c`@7 㿘@LLLLLLLLLLLLLLLLL<㿘@G %<#(' ~`#"H*` € <"c ;# $ r#` ;`@ @c < "c@9@G`耢?Ւ?t* @   @#Ԁ   r#` @! "@@   @8@ 2 `@ 㿐@P  2 @  ,`"* * %  @ Z @H @  2 > ~"Ġ'@{ǒ @В` h< @   @ؔФ  !()@!H#Ъ @ƒ  2! @   @ 2 @  !(@5^ 2@  a@*  !<@ϒ @  ,@J @,@Ò :  @J, :, @ <#Ѐ`!p@yؔ!<#@ !@zY !@  2S O#@L ,  ? ?/7  @> ?H'D'H'Xab'\'L @tD @ѩ!( @B$ 'H'P'T'L #\c   @7a   @ @  @y!㿐@/   @zH!7 @64  ``@J ꀢ ` `@o  2`@4 2` `@Y  ꀤ@Ҡ! 㿘 r#  c̀`?  #<@;    2c̀@ 㿘 N  na@N  $㿘 ~a@#@g 㿘@?#p#p#p#p#p#p#p#p#p#p#p#p#p#p#p#p#p#p#p#p#p##p#p#p#p#p#p#p#p#p#p#p#p#p"#p"P#p"#p#p#p#p#p##p"#p"x#p#p#p#@#p"d#p#p"x @g    @ #????@ِ  6  -@y" -@y" -//=" "=#"#"` #T+ ~`:O |*` € rc G"c rc B"c rc "c! r#/@J 6$# ;#b@.ې܀?! rb@ # @7$#@ ! ;@c r"c ;#J`"@耢 ! ;c@ @##@g@Dbؖ`t*  @  rc r @R??"N795-+/@(@   @@ +@@@ 2@@ 2 2@@#0@ʐ ` @i   @ch   @]cp x@@ @@ @, ??`㿘   @>c`  @8ch   @2cp "   @ 2㷀 ~"Ī'@ c@  # d'@ϐ!'Ȓ$'@ݟ r*`"  ` '쀤`  @X `@@i r*`"`*`'"㬀 ! ###@vԖ  6#,   @vȐc쀤 &@v @? 0K@w @@l 㬀 " r@ #'9%$@*@u@i"` ` @wt 0@wo  2@i `` @w]0 0@wX@V @S@Q耧 "'@vX @wB 8  `2  b0 `  @  @@1  b @G H㿘=#耤 # r@V  2 c`? 2c@ 㿘=# "1@=  2   21#㿘@ؒ : 2 ,@`P@Q @V $ =#  `@  "   2@㿘@ @$@$ $   $  "& 㿘 'DJ  n`h@   rJ o r r "c'D"#D!#ϔ x@u =㿐 N  `@,? b@ @q ' "@s㿐@'")@ 2@A, N  -,`$@A = `,` .$``,`$$ `@u: x 2ܐ?&@&&㿘 h  ~`@#@2  r r   r r㿘 ~'H'L'P'T'X#@H@ 㿘   r#Ā` r#@u%!H@  r#Ā` @u!P h  r@u!X@ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘@g@!㿘 'H'L'P'T'XH@Ɛ (@wU / @W <   L` r`@ c `@ P㿘@w6 / 1<$#@֏, /,a$@א## @Ӕ$# H r"#!!@  !@t!0E@ = '< @@#0@# %#@  ~@tn!!  @td!@ `ˢ @ `2 㿘 a@X @[ a@P 㿘`a@F @  @a@9 㿘@Z b@. 㿐=" "=c" "c   5/ ~-@V  `0; 7Y`@s   `2     0  `2 @b  @E@ À Ϧ``@`) r##̀@4=  #@R eu#`` 2@`@."0e  2  ` `  "  @s ` `  ~ # b @  ` "`$`  "@$c $  "" @F @D @B rc` $`?"c#̐?%#̀ @ Q#̀="c " 2@t2= 2c 2 #(#0# ~c8@ڨc  c#X%#    hcp@ږ 20 "P@.Ebp @p 㿘@  %= J? a   ` " @ l  @ 2 J` 2 o & *&  & & && "@" rc̐ "ć㿘=#`)'`@r#x`  % @r 2 @rp@`2`㿘` % @p 2@-0 2 # H$ E$ B$ $ $`$ `"@$`㿘` % r@  `  @  Ȁ   rcȐ "cȁ㿘@㿘c@F  h` @%c`? ' ;%+ ~ m@㠠 2c@k @%!@@@>ה?倢 ?`t* @ @&@`  `J`p  &` @ "!@< @`@@@㿐 J c b @@c@  @-3  @"J@ `@   @-"  @"J@ ` @ ?# * * 2 `@ ? 2`  `@@ @n ``@  㿘  #@> 6 @r\``   㿘  ! h h  ~#@`h0 # ~ `@c c@`@; 㿘@"=>X>X>X>@>X>X>>X>X>X>X>X>>X>X>X>X>(>X>X>㿘 ~a@Ő#@ 㿈!F+F7F)F#% ~5F-F'F%/` !,*` € ;#$  %` &  %  ;@"c s "` ;@c s"`@=ǔax?ؒ?t& tt* @& %  `#$   ''1F'  @ ?a@    a@  "!$   @p!@p!@p! @p! @Ҧ᠀  %`@Ҟa  @Ҙa  %`a@ @Q蠒 @w  @ b@ @ @e @  `2"@b(@  @s b@w  "@  2bbH@j @=S@- 耢 bX@] @ y ( s @`x "hx ` " ` x " `` `"@+r 0@) "@q @ "@p0HaB + cB + 3`  *`  @5  "@+G01@p: Ā@pА"0@ F`      ! !?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?#" @!  ?"  ?c@ ! @  @!  #? "? ?c@ ! @  "@! @#@"x F    @   FF# " "`"؀#  #(@o@@2 F F`"  @n#P `"##@n#h@n#x`#@n&@ @a &&  `  㿘. >@4 2@c@ @c@ @@u b@y @  s`@o ` F F "" sF" ` * "`F ` @  F ` 8@n4  @`)F', *  "@ `  @n P @` @n X0 ``@5   `h@.  `p@ R @* `@  @_ b@ @>`  Q@0 2`@ + : @Ɛ @ꦒ @* @@ E @ :`D @`R@x`* @d@皐D  0 ؐ@`@xF`* 0"0 ;  @ C@꥕8 F  F` @ ސ  F"@   @m ( (  `3F+d,`*"@ `  @mj`P   2d` @mX X>`  @mO X0!t`+F)d,`*"@ `  @m3 Pt 2d` @m  X` @ l  㿘@x  ?  ܘ @. ?@ܠ  ܘ @  ?a( '''' @ @ΐ @̐ 㿘@[UVUVUVVVVVVUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVUTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTZ(Z8Z8Z8Z8Z8ZZ8Z8Z8Z8Z8Z8Z8Z8Z8Z8Z8Z8Z8Z8Z8Z8ZZ8Z8Z8Z8Z8Z8Z8Z8Z8Z8Z8ZZ8ZZZ8ZZ8Z]d_]_^H__4_^]_]L_4] ] ]][[[_^|[]$],]<__[_4^^_ ]\0\|^_`]p]|\_4]\_4_4[_4__4]\]ccccccccccccccccccccccccidjjjjjjjjjjjjjjiHi$jjjjjgjjjjjjjji8ffgfgggfgggggggfgggggggggggggggfxhxxxxtxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx$P88㿘 " h@&  h ! ~`@!##@`X@n 㿐 ' 5/G+G)G#G' ;%G!9 ~;F7G-G "* @€ %ؐ %`, % $  $`(@ w $D @8 ?ߐ? t* @ @^&@'c`(`&`@I %@  @' %@@?2@`@F   @ ?`0*` €&@6'&@\0 @@0w@@pG  ` `@ U Gc@ @8 ) %`@J@ - @ c` G  G0  G0 " ܐ  "`G  "`ܐ !"`=@;@ s"d   ?'''''  Ԙ @ `@̐  "G@ `@  Ԙ @К a@ @k!h!@j0yG`$  @j!(G`܀ @!P@j`g b  2Z$ " @[ ,NG ܀` X  2G  BG#D`2? . & bd @6 @'&@G ,`+`$ " @-# @   @ڒ @j5!  ? @ @ ݐ @j'a@j$!* @㿐`* 8*` €G   G  a@ X GG cH " G䀢  G`` "`䀢 2"@&@㿈G a (  '`@ , @M@ g"?Gc@@6 ? #G/G5Gg7G`@J@ -G@ 3``3*`  €G  s G G  s  G  s $G ! s "8"`?2G@  ܀`!"`a@ @@ &??2G@  ܀`!"`b@А @@ ?G ܀`!Gb@  *cNG ܀`!Gb0@  *cNG ܀`!GbH@  *cN` $` 7$G "`G "cH| %|ؠ ՠ ҠϠ͠!ˠ"ɠ(?2`@ @ ?2`@ @  ?2`@ @ @ ??2`@s @ @ @?2`@g @ @@?2`@Z @@??2`@P @ @ p z&p?2`@B @@pmi,d ?2`@, @ Z??2`@! @    ?@쀢H @b`@ @  T    @6  @0?@ ?, @@ʁbx  "b@h  $`  , 2$`@hq"@hn"$`@ @h ? 4`| 2 p 2  G T`b@   ` "  /  ܀`2/M@L *`"(M@` ""`F#`@U @Z"M@@86` "M@@Z`3G@Z`GM@ g@ @Z, J""#@gL` #@g` G ܀` F#Ԑ@'@g#(  @gܐ#0  "  7 "0 "0 #8#H#X@@g#p@ 㿘? ) `@J@ -@#`?`!*` €     !  G "`@ ? 4ܲ` s"d@GT  T '  ? ( ?* ??* ? *  ? ??? "`Gt"`(t*``H 8 *@㿀 ~"Ģ  ' 2  2   2    2    2 "x    ?? @Ɣ   #x c@ G T`@Q"T b @#pG܀  s  #"`"G`T?܀"`T"* €G#LF#G#tG  0G X  F#c@& "` ,c, @Ð  ",   0  0Gp "p  ð ,`"*` €  ??  ??''%'ܐx@BԀ x'ؐ@:Ԁ c@ِ ` "`c@ϐ  "`cȔ@ǐ  @@ ? ?  ? ? ?@    $ 4 ؀ 2f  c _@Z c@  $,@O 2& + G |`' @3Q  •  @M " G  * G#p``@b  @F  @7   2&  @ $ `(@I `8@D 㿐 sG "cG TG ߒ`L*L# T,` %@Dz  `@v*@   #@``P@ *` 4` $` 4`$`㿘@ӐG ܀  G   `h@ G`T` "`T@c@ <`  ` @- "@?G* "t t*t" * " " " " " " " G *tt`*`"`& &  &  @?#:,@`?x   ?''''  ܘ @| `@ _  &@_ `@ S  ܘ @c `@ F  @*@ 㷈 ~"GcDG "$'+G@ )'c@@~(? @W`"c@@  @ '@Ő@d @ؐc@㿘G'H'L@Wu!@"? @g"X`a`c `g  G X    G`T  "`T *+ XG G` sGT`f'FG`( `` ` ` * H" L* " " : (: 0: 8: @: H: P" $2 * $" GG#Lct@ GT 'GG #L ?   cL@G`$  @`G`T F #Ѐ ?   cА@$`@`GT G #t ?   ct@x$`@ɒ`G`T G 0 ?   `0@]$`@aGT G X ?   `X@B$`@aG`T F # ?   c@'$`@xaGT$G ?   `@ $`@]a G$`' 2`@G#D`4 Gc@ @  G ,`'?@d!0"?` 'F#@@}."X  F@#@@#@?@d!P @=  @@*@ J "*@GT % !  @  ( @? * @  @? *㿘  ` G   `  `   `1+1#, "%1c4 "#,.2   2 `4   2.c41#㿀G $ ~Ģ `'b `" @X#{b sh* @c#  "    &W * "6Q @b#G`؀ 2   @ƒ #@bߒ | @bؐ  ~ s#`@ @ @b@bʐ   ~ s#`@ٔ @r 2b  8@b    "  @b P @b X @b h@b#0b@b p    @b  ~  s#`@@+b @~  0(  !H      #!㿘G@#L@bY       ` @#0@!@ "  @a @!H0ђ X /53 ~7 s96;  ."#  "  @" " ` @"  @  2 @ ` 2  @ @ ?` @` р  ,  @@a!` !G ؐ $ @@a!x$ ؀     @@aҐ! !@a˔`"  @y@a! ;@a@a @ʐc`@a#0"@ab @a (@@a , 0`  L 4@aH 8`" 0@  8"@& 8 0   L 8@aPG $`" @0?H@a|"X  t@c`c``?"`c` * &c`@G 㿘@ac"h 0! ~# sb@r#`@aZ"x $#`@kb @ X㿘 `O' ~@aI" t`@Y``?"`` * $`@  @2 `` 2  ?  @ @쀌@ 1@``, @@a " ?  @ @而@``?"`` * $`@ϐ @b`㿘`Y ?N>@ 6  , < ?`&  @  * & @N !  ?`&  @  * & @N 4 N 4N  ?`&  @ >* &@p >㿘 s  " @ 2  㾈 ~  bĀ'   ~0   ~@| " @'"@`_  ~ @!"@`T ~@Đ#`" @|V"Ё㿘@@ @Œ    `А *`: ?А *`: ? *`: ?ɀ`2    #ؓ,  €* ,`  *  **".@㿘G " * *@є Gb@A `T$"`T㿐    @+ s"db @* hpxp   '''''''  Ԙ @   c@t Ԁ "@s  @h  Ԙ @x 6c@[ @_C#Ȁ ` 2 @ `X 2@@@@@*`@  P   '''''' Ԙ @? ? @Q`*8c@   @  @  Ԙ @" ?c@  @^   @. * @@` @G؀  !  " ! " x  !0, `@#\ `8H`X@^ 0S!#!a #\#`#d;h `Ȕؖ @^`08  G ؀`     G ؀` `!ah#\#`#d#h#l#p#t!0H@^Z :  `" @`` "` P ~"Ĥ' X  z ߔG Ԁ`   n t @ ""@@ _  ^H  @Z   G ؀`"  @L  @ap < (@]!x 4`@]! 0!@]a 0   L ~ c``?"`` c`* $c`@  @ @]ΐ!c``?"`c` * $c`@  @yŐ!! t D 2p  D $ Dp@ƒ @Ġ` ̢`@AȠ` ¢`@7 `` @Y@]!㿘?`#*` €! ! !!! `@]b"0"@]]㿘` @@    G"(@]B 0 ؀`"0@]90 "@@]1 㿘 @]*"P`  @h?@]"X" " @] "`@]"h@]"p @\"x@\"?`%*`# €@\"@\"@\"@\ߐ"@\ڐ" @\Ր"@\А"0 @\Ɛ"0@\"0@\"㿘   ? ?   ? ? ?@& 2@S `@K@4G"(@\ 0 ؀`"@\0 #@\} h ~"Ġ '瀣@" +    +@\Y" @x^#p ~"Ĥ tH' F"H"@! 2,"В .@ "В "В`@!,"  !Fc!@!c!  `!R#*` €@` T  ???ؠВ'@3  /Ѐ/؀``ِ ``ِ  ` ِ   耢 /'/@_!@֐@  " !F  @  @ `!F!@U!! @wɐ# 㿐 'D # G ؀`D @.  @t . Fb@  ". D'@Ȑ1F!@g!!Ё㿐G ؔ `  1F#\!Ж! @濚 c0!@!!Ё㿐 ` `G ؀`  @ْ  2  #" @[ !"@`!F!@%!7!Ѐ` `!F 86 !@̒!*! `6 !F @6   6 6 !F#\P6  `!@!!Й6 6 !F#\#``6  `!@!!Ёh  ~"' '  '  ' `' ' ''T @`4 `@ A ؀`@ + 3 "$` "` ` "``"` " ` ` 2 `````2+ +  IJ` * (* ` `؀ ܀    䀢 $#@ؐ#pG ؀`2 #\Д! @Ú 0@!!F!@!! @vq#㿘    !  ;@:@p @ 1F!Д@ƒ!!Ё F Q( ?Fφ:* c0  .*  ?** *`㿘 ``  2   1F!Д@!!   @ @u "   "####h ~"Ģ  4 '@c@̀?2  @В c2 @Ȁ?2  @Œ ! !F!@/!@@bİ! @u ,((("` "` "`L "`T"`X"`D"`H"`P((" 2㿘@.a㿘 !!Z@!p@`x tT `T!p @ג` ` Z!p@S $[   tZ!p[`@[6"! T`"@` 2  2  Z!p`@`[?"a J  @ސ   @ِ  [ @Ր! RR"""bt㿘!R "԰ %RȀ/`"$" t T T` "2  !@0[!J! @  @ "$$"ԁ㿘 t ``"`Z 㿘 t p`"`P 㿘 t 8`"`F 㿘Z!pQa8@'[?"a㿘Z!pRa`@x[?"a㿘Z!pVa@ [?"a㿘@ 㿘 'D'H  'D` &`D  D@3ҒH D  DD@3ǒH D $ HHZ!p@Ւa [``@5M` H[?O"a`H`""`H@a "  Q! """  X# H@  H"`  Z!0 H@  H"`H` `"` `@` u  H:"`@X ~"Ē ? ~ ;" t'H'" 'DD@3KH HHZ!p@\b([?"aHVY "# `@@ 'Z@!HZ!< H V"## H@4G [! ?JJ !    "J ) *` !/K !    " K   X* R +  *` +X# Z@ R Z!0  @ ѐ   Q! """  R"h  @' 1V# u   :Z!D H@3  &#H @3 2mND @ R"܀ NV# H@3 X# H@ Z!0  @ s   Q! """H  R"h  @Ȑ 1V# u  }:Z!D xH@3j s q&#  ,@?H, @' H 2 H@@"H@XD RM# EH@3? ?X# "@ Z!0  @    Q! """@  R"h  @a 3Vc u   :Z!D H@3  &c  V@D`@= @А V"# ~" @rJ"X㿘 u""`"`"h@ 㻐% ~Ā 'D''H  'D` &`D  D@1H D  DD@1H D $ HHZ!p@bp [``@3` H[?x"a G [! B  J  !    "`-   *` "/K  !     +`:    X* R +  *` +H"   X# H@  H"`  Z!0 H@  H"`H` `"` ``"@ u  :@` @q|" 㿘@7 !Z!p?`" * " @8 !p@!V# Z!D  Y @1 Z!H@Է Z$#!H@Բ 㷈 ~"Ē ? ~ ;" t'H'" 'DD@0H HHZ!p@b[?"aHYV ""@Wr$ b@# `@Ԕ 'Z@c!HZ V"## Z@2 2 HZ!pb@rZ@1 lZ[! 'N     !        X* R  +K@`*X# Z@ Z!0  u@ 3  u""`"`"h@ R"h    "@ 1V# u  :Z!D " ZH@1+ "Z &#Z!< @1H 2tN@ V"# ~" @pw#  㿘!Y `Z!p#@!(Vc(@ߔ ZZ!p@_#PZ!< Q@&    VZ!pc`@0Z!p@H#@% Q!$'ZZ!,J p#R"@cR"lp@cpQ[RVcИ"x@bR"ԤX#R"hR"ܚp`@Q!Y p`P@tQv ؔp@l`x[n![j!p`@_X#  [Qp`x@SZp@Ԑ Z!0  ZWp`x@AWp@!W#<'ZY 07!Z!8pa@+Y ,pp@"aXR$"ДZ!( !!(@ax%RĀ p@琐!Ġ [ Q(p@ @aĠ `["!㿘  `? & `@c   & Z`@c Z &!p@@Βa?" !Z!pa@㿘XĖ["a㿘RА[Z"a"(㿘Rp ["a㿐  W# `?9"# Z!p@@b0([`@)c 2`W %"c@c 2`W"#   @#􀢠  Z!p`@_bX[? "aZW "!8"3WcW1Z!p@Mbxc Z!8!p@Db!p@ǐ"c["!㿘RB["a㿘Y 6["a㿘Y0*["a㿘Rh["a㿘  Z!p@@c[?e"a  Q!$ `?1"!$ `@c  Q $"a$ `@c  Q"!$2 `@}`R "bؐ @P `!G#@!#ZQ "a,"$!Q!$ Z!, "ZJ  !$Z!p@c0$!$!$ZapZ!,J R#c@ Q!$["!㿘Rh["a㿘Qx["a㿘'H  'DD@-\H HD  HZ!p@jc[?."aH`@#В`[!!`R"Ԁ HZ!p@֐#H `@ ` `[!"&`Z"!@Z "a@㻐# ~bĀ '  t P &`  Z!p @@%`[`@.` [?("a@`  ` @Rd 0[?"a@Sђ$   Z!p`@@[ `@RO X["!`b@Hb  @md h㿘'H  'DD@,ŒH HD  HZ!p @Ӓ`p[?"aH `@ 㿐'H 'DD@,H HHZ!p @`[?B"aHVY "# `@И 'Z@g!H&H 3VV"#c H@-   @Вc HZ!D  H @-  &cH @- 2N@e V"#㿘'H  'D D@,IH HD   D@,=H D  HHZ!p @K`[? "a `@ H `@ 㿘   &`    &`   Z!p @@%`[@ @a   !(!0`! @v " `@-` 2`[?1"a @g "``J |"`@-x`  `@-!8 2`[? "a`h @R Z@!p`@1@,㿈'H  'DD@+H HD  D@+H  DHZ!p @aP![ H*  ?`''"?@  HJ |H@-  @,!8 H[?J"aVY "# `@{ 'Z@J!HV#%  a w/H.`@ !0 @ޚ 1V# VZ!D  H @,v # &#V#` D?@؀`@F V"#耢@@ថ 㻈' ~Ē '@4  @0 @쉢 I @Ґ   @"  @  @嶐!x  L@  !@R / " -/ @Y# @qa  +/   Y $@M  @M  !@PI?["a@kD @ݠ쀢@ې @ؐ ?[ @P2!["!"!  @kK!@# ~b'H' 'D  D@*HD?  HZ!p @a[?^"aH `@! ? D  H @ΐ"H"`D 'DH `@ߐ" + D !H!Z!p @"!p@j1 ~ P@C#  #` ?2` b(@Ac,H" D 'DH ` @"0   Z!p @"8b YD 2 ?H ` @"0Y?"`b  @jȐ"H㿘!R"Ԓ  $"@"P 2$"[!!2 $"Z!p @"X @z"$"ԁ㻐# ~bĠ'@P$   Z!pb@#b @Oq"b["a @j"㿘'H  'D D@)H HD  HZ!p @b[?"aH `@6"耢 [!!R"Ԁ HZ!p @i"H `@!# 㿘'H  'D D@)H HD  HZ!p @Ēb[?"aH `@#( [!!R"Ԁ HZ!p @2#0H `@#`㿘'H 'D hD@)H HZ!p @c[?"aD!(@#H㿘'H 'D D@)`H  HZ!p @qc[?"a D#@H㻐# ~bĠ'@$` @`  $" @ @U    *@ .  !/@} b@ b  @i#㿘'H  'D ȐD@)H HD   АD@(H D  HHZ!p @c[?"a ` @@`㿘!R"Ԑ  $"    (@0`$"ԁ㿘!R"Ԑ  $"  8  H@`$"ԁ㿘!R"Ԑ  $"  X  `@`$"ԁ㿘!Y   @  @    @ @i 㿘#Y`  @ h!\" "Z@Z!< u?"a$"$`R""ā㿘  Z!p @@`p[? "a2 `@  @Ɛ"0㿘@. Z!< Y@ Y  [ "a["!@ R"@B 㿐'H 'D D@(AH  HHZ!p @R`O[H@$ ? '!Z!p @̐ @!!p[h"! !Z!p @ཐ @!p1[J`  R!Z!p @ఐ @!p$[@" [b@ @K J Y  3V!Z!p@#P@!p@9 @ [?)"a3V a@>c  !V#@c"c@DH? €`Y  [ "a["!@ @̐ 㿘[ ޖ["a㿘[ Җ ["a㿘  XZ!p!X !@@;$##["![ ""a[`!x@  Q* ` @ Q` JH&`J!$J [xJ@` J2`@  ` @* 2  * J *`㿘'H  'DZ!p!Z !P@$!0!0[C"!  D `D@'4H D   HZ!p @Bah[?*"a[1YZ"a $ @t"0Za<`  L " & $@f ,Y $#Z@!!x L " W#@# Z!x   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   WK +`" WJc1I  . cJ [  \ $"J+2+J  +J $7 J !    * J 02?L  @`+J@  l +` f @ "`  +@  W  *`G: :  \ $?27JJ !    ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J d  J2J 2J  ]`\J BKZJ ,V ]":R !    ")+J 02?L ! @`+J@  +`  @ "  +@   J  +N  0Z!p @$!㿘R"Ԁ  ! Rl["a㿘Q ["a㿘Y ["a㿘 @ !ؒ``[!!`R"Ԁ " Z!p @! @ "`Z "a@㿐 Z!p @͐"0 `@d # ZJ Z!p @ݶ"80 !p bX@( u:"㿘 @ d"㿘!R"'H 'DZ!p "  D ؐD@$H D  RHZ!p @b["h Z!p @z#"#Q*`H * a(@/ "ĀR ""@ Z!p @a#@[z"!" " `[$"q"*` *  @* *  "@"Ēa(* * ` @'%V`? "`@$   "?̑. :  .@"Ėa(*` *   @ƐN "Ė.@`@ ~3 ~c`? "`@ c  &c ?23 ~?c`?  "`@  Z3 ~c  ` &cZ!p #h@[?"a㿘'H  'D D@$8H HD  HZ!p @Fc[?"aH @% ?  [HZ !pc@.["!㿐'H  'D D@$H HD  HZ!p @c[?"aH @% ?'H@ld@qZ !pc@ ["!㿘  # #@ 1`㿘h(? Z !pc`@`㿐'H  'D D@#H HD  HZ!p @’c [H @%:   [?;"a@@  J    ( `0@?% u `8@]  'W)R  <"$H%" `" @ @< H<$%" @5 ~'H' 'D   D@#PH   HZ!p c  1R"Ā HQa(  @ 2 "Ā(HZ!p c0@C[?"aVc@$-Q(,`* ` @ NN  !    2  V`k#*`:  $ \"Y XN    !    .   ** :` ?а N  !    , D?.?H,  V&@ $Ȕ" @H *:  i2D  H,V&@ $Ȕ" @H@@.@`N 2 N @#.@#[a@ `Z!p @&#H[S"!2N` Z!p  #` Y   RZ!p #x@[?;"aR"Ԁ  !Z!pV@#!p@ų a!Y` € ,X#쀢 VN`  Z!p`?"``@* "@@ V$@#@ ,a'D@'H(* `@2 2ND&-Q  @b#㽘 ~"Ē?' '#''@Ȑ''     ' c@Ԑ  `@Ք    `@˔    `` @     `(@寐 `@) /  L 2, 2  % H L  2   p'0@ۣ'  J  `    @rh``e`@U'  `@f  `@g     `@\  +  & L ! /,@ƒ / L 2,@ @ "-L (,@ : M@   @"K@ *@j@Ζ *`@ :,L @ *`@Ⱦ '? !@F%@ ?2XY??Y: @a   ~&@ȝ!' 6[ R#n'[!'@ `@  Za8  Y ':`; @#ې?@֍ V'  a8@ Y@ B  :@ " ' W@,ƀ`W# 6Y 0 2Y  + 2Z @&Z!p #`?"``@* "@@ #Z!8 :Y@ F Z@(ZZ@Ȑ!p@^ 'W# FY 0 2CY ` 2<  (8Z!8Y  :`  2Z ZZ!p?`"@  #* "@ #Z!p?`" * " @ Z@@!p  @E!x>@#( RL [@G6 ] " J ``:2* @G( : ,  @(  u"( ' 'V"@rA`V"耥`   P@@r,  @}  !@Ĕ?'`T` `#\! @Ϭ  a@:!R"Ԁ Z !pa@``@` '? *!`@b`  ``#\  @π  @6 @6@Z@6"? 'a``2`@n  !@D @la!R"Ԁ`'Z !pb@ *"Ԁ Z !pb@` `  "` "h#\      "` bh@) Q  "@ @ :  @  b@ @ % 2*  @@՜  @   b@  @    "` "h@ R"Ԁ Z !p@c` ' @ ? @De# @ '      ?'*@ "   J? "  @. ̠Ȣ` @/ Ȑ  !@ `2 / 3- J #@ J  `  "  @}#`#@@x@ Y??: @T '      ?'*@   J? "  H  c@X   `  ?@=Yb:  c@> R" ` Z !pc@k @?@@ԯ@ԭ('I  @a  ~&@ź!'  [ @C!( R#n'[!'@   @  `@ Za8  Y ':`; @ ?@m @ӛ '  a8@ΐ  '  @Y`B :`'$  W@3̀`2@ W# 7Y 0 24Y  + 2Z @&Z!p #`?"``@* "@@ #Z!8 :Y@ F Z@(ZZ@Ŗ!p  W# FY 0 2CY ` 2<  (8Z!8Y  :`  2Z ZZ!p?`"@  #* "@ǐ #Z!p?`" * " @ Z@I!p  @B#G@ 1 Y  ?R RY   R@ R"Ԁ (Z!p @Ȑ##"Ԁ Z!p @վ!@' '@# @B~#(  @Bx!h  0@ؒ`@I 0?@ڮ@c @`@] ~"  @]w P㿘@# !Z!p @| X@!p[!@˒ 㿘@# !Z!p @n p@!p[!@ p ~"'DZ''H'L!'@  Y     a@ גa@  @K  M "  @A y M "u t Ԫ H* @@I    `@Y  `@Z    ` @S    J" LY?F0B`@B  l LH?501 /@ :@@ @ 6 42`/`*  @,@ @ @ 2 u u@!0 M   H*` @ 0@@` :@g@c /  * ` , @L :`N@ ǀ`Y,@``L@  @Bߒ /  * Y   8  h '''   L "!R'' !R "$" @Y   $"  @̐ 2   @z0s R"ܪ  ` L@  a@@  `L  a@ 2 `L@   !'ؐ ''Z!@ J"I?L RC?"Ԁ  Z` "`ap @ra   0@c$ !8''܀  '` L!R "h!@'$"h  $"h " ''  z[!@_ d ԰ @ёԐ 'Ԁ YD 6 YԒ :H* @j Y  ? n  ~"  @[!H㿘 F @@А    aX@䄐 N 5 N + (, %2%,@J !   D ",J !   D `@,`,`N Р $, * :  ` :  ` "ɐ? * (:8   ` * : 8  ` "??ɐ?Б* : 㿘 `@?   `@8   ` @1   @h'a   㿘   ሔ @ 㿘@E 0 㿘'P'T'X P@g 8+ ~bZ'"a()[  @"  @ u"(  ''''@l3' ?- a/@u  a@o    В @ OВa@a  O В @ POЀ @l ? !@ [@L !@[?"a `J @!J @!J 3V&c ^?     #\! @d @!R"Ԁ Z !pa@  @ 6  2!@   @0 "  (`     #\! @.  a@! "@>Ē @0f" @@0a?"  `6   @>"([?@"m " @ @ '[b'@@? 6  @>"0E[   '  @̋    @>"@ b`@![$"` bh@"`1\ &"`2R @Ґ"p"`"Ԁ Z !pb@c@ "` ""@4" [@.[?"a '?c!@G V#@։ b  @Y["㿘@ !Z!p?`" * " @ @!p u ua `"["4@ 㿘!\"# u'H'L'P'T'X  $a @h"[?"a' Òa,@ "@̔H" @$"@y"Q "  @bЀ@p`?a `@ @x 㿘# ub  u"J !\"@$b @T"b  ub $b  "b 㿘 u" @  u"b㿘# ub !\ u""@ܐ@1" ub $b  "b # ub    u@% b   u"" 㿘# ub ! u" @ "b" $"0@ $"㻐; ~bQ'bh'D @$9Ð @!,    ["!  '@"``݀` `@"`!\ "bؘ  4![@"`!\ "bؘ  @@"![D  @,R"Ԁ !Z !p@W"@!p[!"a ` >R"Ԁ`4[5 541R"̀ ,[!Ȁ  Z` !pZV !pc(@Z!p`? "`` ,`:  @* "@@Ԑ  ! `    [*` * ?А"  [!?    [! " d   ! `   2   d`  `) R"g d--  d`("  `- ["! "![,![@"`` `R"Ԁ 4 !Z? 5R"̀ !Z!p`?"``@* "@@G@!p $8$["@8 [!`"#ٴ 1,Q"!  @ђ[!!a u@( u!  !,@`"?П@ ?b   @W5#0@ [ "a 㿘@Ɛ !Z!pV u ""@/#@@!p["d@~  ~ZR'!8Y 0:?` 'T#xXY  Y?? 8;`'D'H'L'x  LJ -Z !pc@sL`Z !pc@jLZ!< DH@ [L ~RRbt"Ȁ  ђ 't'l'h bh'p['\@"d /Q$ Q! 1 u! @?&!l l@$ h h@ p Tp@ TY[?" 0k"a@  'lҒ`@ 'p H@rc  HY ~0#'|`"c"00aJ@ |(  @ H'h b`@7Ð'|| Y "(@;?l@ܐ h@ِ p@֐ [`0 ""`0"h't07H@{b`'|| gH @; #l@ p@ [!h't|@R  <  "ZH !p@cl@ p@ |@[Y:@  [l@ p@ h ?h@ ?["tYT"`0@L"d 3 ub b K D@ݒcЀ D @גc؀ @LR"Ȁ  ?| b@Rb ? ?| bb@nR ?2 ? ?  uH @:#tYT`A" 0b b#  tYT`3" 0#'\L D #pL .l@ p@ hYT`" 0 ^"( l@ p@ hYT`" 0h@ t S ~t|@M ~\@ 'xx @Ð? @ Rb'h`H€`` 0UY >`B; ` WxR @  4&@W# ;Y 0 Y 3Y  ` *Z`  Zd !ZdZ!p #`?"``@* "@@ #Z!8 :` BY?` @k!p|R @Rm$ W@+v'PW# M`Y 0 YY C`Y ` <`  8`Z!8Y  :`  2Z ZZ!p?`"@  #* "@ #Z!p?`" * " @y Z@ !p` @P H@ܐ P Y0` ]W#3   ` 8`  Zd /dZ!p #`?"``@* "@@: #Z@!pZ!8W :`# B?`  Y 0 YY Yx @:x `?"``@* "@@  Y`B :x`? "`` .`:  @* "@@Y`B :|@z| @x @W@*'PW# BY 0 Y :Y  ` Z` Zd ZdZ!p?`"@  #* "@ #Z!p?`" * " @ Z@&!p| @ @P H@ x @@*-  YP@ @ Y??:@ tYT`" 0t|@x@G l@ p@ h "Yh@ Y ` 2O ~  K ~@ G ~l@ p@ hYT`" 0h@ې Q! 1 u[?."a! @v?&!x x@ t[? "a| "Yt|@Y ` 2  ~   ~@[  ~"  @S" 㿘@ !Z!pV u ""@# 0@x!p["@r Z!8'H :Y0''DQ''?'@Y?? 'DhXY  :   ;'L'P'X`x'@Ԑ`?'܀ #R"Ԁ  ZH X ZHJ -Z !pcH@RL`Z !pc@ILZ!<  [܀ [HD@ 5L0'!'䀢 ' ܀@ ['@"Ā +Q Q! ! u! @ϸ?$!䀢 @ 耢 D@ DY"`0@Q[?"k"ጒb@ 'Ғ`@ X'耢H @Sc sHJ |nH@՜  \Y@(  @( H @7%#0sH@8 / 2,H  H0   @t   /,YH @7#0R  Y@(  YH@7x! YH @6#0=  @( H@ 'HH 0*   H@ 'HH ܀  R"Ȁ   0Rbt"Ȁ   L@ Y:@  [@O @L [?"a@"Ā k܀  u    # L  D #{   0c s"(  0[@"`' >X 2XH @c X ~#`Q'5"`؀`#HJ | @ 'H  @2ђbh' YH "(@6L`0`0 ""`0"hQ"`H@~P' g H@66#0!h'X@ݳR   1J$'1J!@!J@ !@N $! @6 &!&!`<  Y`0 ""`0Q" @?ER"Ȁ "  uf d b u   R @ʮ H @5#YDQ@" 0"`+@'~ a"F JaR @@?2 @'l  & PY`W >`#B <;`Y 0 Y 3Y  Ȁ *ZȀ  Z̀ !ZZ!p #`?"``@* "@@{ #Z!8 :Ȗ BY? @!pJJR a@N W@' 'HW# M`Y 0 YY C`Y ` <`  8`Z!8Y  :`  2Z ZZ!p?`"@  #* "@ #Z!p?`" * " @ Z@!p`H  Y@G @o Y??:m  @8H H@_ 0bH@[ 0^"" @ @~Ք "   @h?  @@&{""   @~  @&j  H@4#0H@ #YDQ@"`0"؀ @` q` Ԑ 'l` #3   Ȁ 49YȀ  Z̀ 0YZ!p #`?"``@* "@@r #Z@!pZ!8W :# B?Ȁ  Y 0 YY YY`B@:`` ؀ `  @< `?"``@* "@@3 `` W`? "`` .`:  @* "@@Y`B :@k @ @@%'HԀ  !Z!p @` !p@. W# BY 0 Y :Y  Ȁ ZȀ Z̀ ZZ!p?`"@  #* "@ミ #Z!p?`" * " @ﮐ Z@@!p @H  Y@ @  Y??: @ @H H@ @ YDQ@"`0 "@@% @"  @ @U Y ` ܀ ` Q Q@ Q ؀ sg!h@mL@ ?h'L@ 'PLPH@'T?]@VPL@[Z !pa H@<YDQ@"`0 "@ΐ  @˒ Q!  [?"@ @ 03@}1 u![?`"!@\ &!쀢   @ "Y@Y `   @F @ @ 㽠 ~[bĖ  ''P 'H ? ?@ ?@R @3!PRl  [[" @  @  u "a @2!*  u@? u R""l$"   1 MR"Ѐ %'Z( "!R "Ժ!?$"[a$"Ԑ@S   Z!p  @ų! $(! ! !c[a@4    Z!p  @Ŕ! !K!V"   u@ʚa? uR" l~$"Z!p @x!! u` a@L D [b  2Z[! @  h Z!p @X"! ul#\#`Q "hb0ptx@| Z[  @ǩs[w*`* k@o*{*@  ( @ 4 , *$ a@  [! @ʴ 2 [ Z!p @"J! u["  ? u ![x|\hl#\#`#d#hQ #l"hbXTp@t PZX ^ZT ZZ\ VZ  @Ls w* *`k o*{ * [*b 6.&x|\hl#\#`#d#hQ #l#p#t;x;;;;"hbȔXTp@ft Z!p @Ģ"H! uX  ZT Z\ Z!p @Đ!! u  @*(*+ s* w {*`, @k+`o@(+(@+ @ [(, @$ @6.&$R$a@, ! u[!'h@ے  c Z!p @=!q! u#\Q "hc`ab@l ZO`Oa@ ZOb@ZOc@Z!p @#Q! u["[b@  n4 @"  !V"   @0ѐ" 9! u u![a "@" "  7  u 'P+[b[b@ )Y 24 # ua?" @  @쀒   $a @0!H %  b ?c P@  b @0#(! u     # u 'Pa  P@z  # u @0q#H# u'Pa ) P@k  # u @0b#p# uba@* b   @0V#! u'La@1L a @0I"0! u@B  6  @0?# @w  `    0R"Ѐ )Z!( & `"'    #\!@q   #Z "a( @b    9   # #\*    ##\#`#d #h #l#p #t #x #| # ## # # ##  ? % 'H'@ H` %    'Pa  P@    @/"@ ! u@!H?$!Y "`   ~  @J h[ "% ~R'blĀ`' u'!# ua@Ư̠   @/j (@Dza?$a @Ǭaр $a 'Ȑ  @Y  6a @/P"@a@Ò  @Ji 0㿘@ Y `   @ @ "㿘@  ua "a㿘' uҒaL$@   Z< LJ "<#0 Z< JL!c0"<Y %V&@"   @!`. `!["$ @-! a @) ![" @#!a @[`\&!<a<R"`&!@a@R"t"&!DaDQ#"t&!HaHQ "&!LaLY!" &!PaP[`#!&!TaTX#`&!XaX!["&!\a\!x" @!`!xa`@ !Q  @!q  @aqZ0!Z&!a!x"0$@!!xa@$!W#$@%e$@}# @& $ 㿘@< !Z!p?`" * " @` @!p[\V` u["\##""4@ 㿀'D'! 'H'L'@b x   xY    @ #'R"t  1RQ!  [! 2 1R"Ȁ" V  ! Z!p @X H0 Y   "Z!p @K  [?"a4  Q bh [@u"4 ; Ӓ`@ '! D#L @ ̐ 0@ ǐ #`'H  ! u! `d$! ` @q  Z !p$!H`@tL0@d  u"! D@Β`x  Z!<   !Q D@`x  !QZ!< !  !Q! 2!Q 2 !Q #H &0! "Z@ Z!<g`?! 2#!Q 2!Q #lH "!QU ! @Ӑ M ["\ [?"a@ 0B! "Z@ Z!<7`?! !["` R  '7@ņ  6[ @-B ["\ [?"a@9Ð  Z!<     ["\ [?"a@ 㿐["` R 7' @Q    `@-[?@ "a    㿘@. /  1,     @M   /,`%O @,ݐ#< Z!p  @  04$@Đ@ƒ  .* `&   d,,:   9, 0@ ,:  02 ?L? . ? 1,?`,??`"ߨ 1O 㻀% ~!\"'  @ ["\ [?"a@[ ؒ$   @("R  @|  "" @,t " a@ @"["` R  ' 7V 7'   @ė 4 6[ @,S ["\ [?"a@J    V @DӔ$ 4V ǐ [!"(    @GM!(Y[Y[[[[[[[[[[Y[[[Z [[[[[[[[[[Z[[[[[[t[[[[[[[[[[Y[[[[[Z[Z$[Z0[ZxZZZ[Z[[T[[dp ~"  a'D[V "#"'H'@ !R  "bJ   !"bذ RRRQRYZ$3R#V%Q"a8#b h ""# 0&bl$b@$$["aRZ "b"(@ߐ!Р . hL * h a@ 2 &bl$ba@ 2 &bl$ba@ 2 $$a@  $b&bl!@ݒ h  @b 2 Q "a$ @"0Z "a,J !Q "@"a,!Q!$   Z!,J 2  @嶐"H$!$ @"  L  b@R  b@L  @Fb 2 ~  ~#@T Z "aDR "bԔ XRZ@"ap ` @m }Y z"`0`BuՐ!d*`  u n"b( u j"b(VR""e"blY a"`4R^""R[""RX""h! ;#   #@wL uJ"# 3"Y?B"`0R?"" ;# b@ 7  ~#Z2"apR V""l+" ;#[&"!! ;#   #@wR"# "@ @ R  "bpR "bR""@ D@|H ~ tQD* "@Y" HZ[  'D'H#a "<@#! @O @@@ߝ @b$ t" P@  `@ D HH@  Y"`4D&H &<Z@ESZ@Ð! @EK a@ גa@ H' h 'ؐ '`''D@ 1R"̀ !Y   Z!pR "@X#@"  R""Z@!`?  גa@ גa@ @H 㿘@ Ȑ Z!@ 㿘@#Y@  ` !\" " ! uR @ @"$"! u! & $`@ @/!?$!$` `  !\" " $`R @ @"$"$`["! @p" #(㿘 ZZ!p?`" * " @姐 {ZL dƀ`", Z!p @Ԑ#0#`? "`@ #  &#` v#s@#Y`, P1[!@r? Z!p @#PBZ2 L Z!p @#h9Z  Y   !Z!p @#+Z!X"c €`,X#쀢 " L  Z!p `?"``@* "@@3  ِ!@Z!D " Vj!Z@b!p@!pV#1 ~$@o#   @Ӑ nגa@ גa@   t- Ě   `"J@ KJJ@J`J2  "  " `2J@?㿘VY%[#`8XQ\""#"#`#Y$`, $`,@ @  `,XcQJ@ `܀!$ \􀠠 J@ `"#cJ@!  fdY" $J@ "` ?\\`􀠠  J@ "Y" $J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " `* `܀ #c\"􀠠    ""Y"" $ 㿘 T?@d%Z<Z`!p # # @Ӓc3 ua1 t đ* ` < L a@Va đ*   *@<@d 0!@? Z !pc Z !p`@ ? !p`   @? `㿘 h   ~   `0@#@BӐ 㿘@   a@ & & @  & a@ 㿘  @2 *@&  & a@Ր  * "  & 㿘  `  @ .` @` @*@@uv\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\v\uv\v\v\v\v\v\v\v\v\v\v\v\vTv\vv<v\v\v\v\v\v\v\vt㿘#Y`'H  'DZV!p a( D XD@ĒHD  ZH!p a`@[?"a!Q!$ R"[!H !$ HZ!," J  a@o x  t  !$ H `! R"Ԁ ZZ !pa@, R a $`@Ӑ"xV"Q a @ː Y" V b @Ð"Z"4[ b @!Y "('[ b @R"RR""Ȁ"btH  @b %RԒ? $蛐" "![`  1["@  "@  ZL? ."? ,Z!p b @8" 2,![ b@"@k”  Z!< [ "aQ "a`  Z!pbX@$!< ["!Q"!` "b@k 2$Z!p @"$ԁ) ~"Ģ ' ` *Y 4 $!!x @ؐ !@Ӑ@ɚ  !@@V 2 "!@i @Ȓ!  "5 3"@|  @@8 2` Z !pc@ !pc@ ~@l` P   c @,O 2`@@ ` #(Ӓ  2  @ή#0 #@Ē  ` @Ο#H #X絒  Z` #X稒  @#`27 Y 4  0 Z!<  *"V cx$@# [!Y ,@"3RbY? "` Qa( #p@ bĠ   "  @@#㿘#V@ c$Z!p @#ZZ!p @cc , $# ~"@@kc c` ?B2` @ ?L ", ` Y ,@$ $[!&@㻐V#- ~Ĥ'`R"܀ 2Q@" > @:&"܀ 2Q ""`"` ""Ā !P @:#  N  #@J? /  $d @| ? @G#Ȱ Ē@Δ$?L@ / /,@ $ "c@@@   @$Ē @ 1R"Ԑ?&"&"'W`$Z!<`? ` (   0  8 춚  ` @[!@[ d ["&`Z!<c`? `H&"$@lϐ&@$ 2!P  Z!p @ P  x& @jΒ$  @=&c @  *@   @?u 㿘 u, 㻐% ~Ā`' X# 2Z R"h "U ` Z !p`@ؖ!Z !p`@є!Z!p@# ~$@jc +O   X* R ?`:'ِ#*`  !p@`р`X  "!pa0@ R !p"h@&!X c V 2 "   !p@ap`   @>!hR"܀ $ Ȕ ,@i, @R 2Ȁ   @#!@   @p  & @ݒ @ 㿐#RbԒ?$b 哐! ?"?["@ %  @pdJ  !    2$b԰? ?  !Z!p[@"!p@\ $bԁH%R+[a? !ȒW$Ԁ i`1["L !    " LL !    2  aА@h~  2Z!p @aؒ  2 0, ,, Ĕ#\#` b@"Ȓ  ,@?'''?Ēx''''@J 쀦` Z !pb8@"$ @ !Z!p[@*"!p@ې $Ԁ"%a㷐# ~bĠ'$@ؐ@ @bX # @#` O "`@"В /2 @~@h 2  N /   b  @=א"㿐! u"0?@$"0`w @|? "0 `?㿘@: Y 0?@ @-"`7 ~IJ'!Q @ А   u Qb"Q# :Ȑ@t Y 0 /Y 1Y5 u @ B `5`-  -`@B2`* @ *`B2*@ *@y  d & d4 d "@ߖ[!̢?․`@0@ d@ߐ@ܐ `@""@  #\"@š$@  4`  <   4  a"@, @@ bJ@"` "@#\ B#\ H@Q ༒"@'ؔ" 'А"@''Q Ȁ Q`@Q"쀢" ; QИА  "В@ # 'Q В " `'" `'А"@@''  `ĉBA?ЋD.'@b @J@G""@ X@3.@<@9""@ @&`.@;(@,@)"$ <@7 <@; h@ %Z   `    `@(@@""@ @x]%Z @@""@ @ԔM%Z @Őb  !@?В. ȅąB'@ސ @Ɛ@Ð""@ X@.@@""@ @`.@:@@"$ <@ <@: @%ZpR @@ܾ `ޒc@o @ 0@ p?`" * " @ܯ @Bp  @;Ԑ R"+ ~bĀ`' b@쨒 Q В " `'x" `'|А"@@'x'|| !8x#Y`ĉB@ ?p p!@ B3? ?  @  `` `  `     @  X#p#\@;`  !H P B ;h ! !#p  @ d U` `P ` L  p@ DY`@ u"`@ D 49 2@ @b !@?hp. hąB'@ǐ.@9@@ d$ <@ <@9 @  Z!pR @@۾b  @:!(㿘   ,@w@4 *[!̬ @{ "  @ I 6C, Z!p@͐  Z!p `?"`@* ("@@} %@8,`Z!p   ?`"@ * "@` 逤Ĩ 㿐@Z!p`hR @,?   P["![ P"a@"㿈'''' @B 㿘@(hhhhhhh0h8hD`X ~" h`'J -'H\   "@aX       % %! / ~; 7 9 5 * D@€a   `  @  @H@Ô!`??t@@  @v   ah@5 @Ԑ ap@ . @#  @Ȃ@ ax  aX @lc "`  !@lE    ap @lR " ᰔ@l9  a @؀` @ @ ?2  a@¬ @  @ !@ܒ ?W?@n?Q ?! @!? @f"@E?2! @^"!@{ ?2  @T" @ @@  $@@Ő Ĕ`'Ē @   Ș " b(@Ӕ!@: @? `  2 ?2  ?@?@ ? @` @b0$ @ɐ `@!@  @,  ?@t ? @` 0@XH@ @a ?  p!@O 㿘\" h` " !@ ~ b@#@8А 㿘@ ~"Ĕ  ~ ;'"c" t'|) ;' |#  /  o#@\@P@鋔`(? ?t* & @ @A@`@ ' | ``0@ ?`' ''|@@ "@" "  - " 0 " 0  H ` @ @t `Ȑ @ʖ@8] 㿘 ~ `@#@8U 㿐@i ' @v @ `@>㿐 #  @(a "L " n L  o  @~  = ",@``"@bj 2  .  @ @ @`  !8!@ a@`  2 &*@ &"`aP@H `"(&@ "$&@@y"@fܔ #  2&@@e`"2 &@ ap@!  㿘@hhhhh0D|||||||T||||h|||pϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ` "?    T( 񀠠"     怊 ?`       򀊀  H+ ~bĐ '@nf u#@3(? @   u b ` ` "a  0o b0" P` bĠ`  b`   'ؐ@/ ؒ @) uc @#@ b'  @  @@ " 2zb  dؔ @  `@@~R " P` _b` 4 Yb"( T Q @!!"`P@2Hb` 4 `   T:  ! !"  !ؔ! @4!"@ " #"`T" @"`b` "` P@b !@  " ` @ !@ f@5P b  @5m!㿐 h  @g  @h   `#ԓ*`  ;# u"# "b ;# u "#  u"#@N @?ݒ? ~ t* & @ @= @W X1 &" @9" @M& ' $ @/" b4@B % $, @$"0" @@zݐ   @"@3 ucԀ c"   bX`@?  @"x  u"#@<#@l"b  @^? $ ,b  C, 4 @ "b$"@  + "?@p &"@Ub/!   ~ #b@K  ~  ~#@Cb ~#@," @  @B "@ " "T  ~ #@'b!  "@  u?"c "@" @="袒   @ѐ" @5#  @#(@? @#@@ @"b cԒ" @i ? c@x#H@ c @ach| "c c@j#p@@z #@  ` @ڐ!@ e  @  u?"c @N#@ @#?2  @C# @&#Ȁ?2`  @:#` @ϔ?2  @0# @` ?2` @'#`@? @ @="  @`" T  @"`0@ @ϰ 㿘 h   ~`@w#@3Ȑ 㿘!"@  02  @`@"`""`,@@" u c@ ","""`4"`<@|"`8㿘!"@" u D " ,c@Ӑ ", ""`"`4"@"`8㿘@q#@n#%   ` , @ H  X@ @ ~ $@@M@0@瀤``#  # 07a܀  u" "# $` c@  "   c  "  @# 0c @r " ","4""@"8D@j",@㿀#b,D@     @D@ِ @` @:@’ b @ p0v"`@ݐ!\b aЀ "*@b` "`b ` b#"`b ` ;b <"`b  "@b`"`2  : "b  "@b` "` 2`@ : @:@" b"` "`` b#"`b"` "`` b#"`b"`  "` ` #"` @㿀#b <",@ b    2         b`@`,b`" b  "b @ b `@ b ` @!@Sb "b@b a"" @b `@i@b@ `" @ b @"`@ E㿘#b@obD",a䀤 2  ua@D b" c@= ",b""`4 "`@"`8㿀a     ',D@  @@ @c!)",   ", * @ y` ",  "  2  `P@i  i  2  @@j 2a @- p0` # 0 $ 0b `<!@ @$ , @2 X@",b@?b   4@  @.  bb`$"`b  "4 b$` 2"`@ 2@"@"& &@  ƞ< !@ؒ0 !(@0@c@*#́㿘@e(4  @!Hm  @Ŕ(4 @`" ``$ 4$ 8&`&@@q K``` !" & `P @L !Ԁ "! 2"!"J l "!@- A & $ +!" @@2`l $* @@ $ 2 ! $ @S!@ $& $!Ԁ "! "J @  & ( ! !p@7@ " @` (* 㿀#b,D@+    ! @@} @6"b  @."0 @b"@@!\b "`㿐"+4%b,"@b  @ 8`b  3` !"`< "" "`<" < "" ," "0@`," @ "" <" `<`@"P" `<@"h@Y !`-%8 ","@ "8@2 `8@ޓ, $`8"#b,`8@@lb,2 @2`@@ɡ<  "`8"8 ","@"8",'"@b84@ "@  "8?# 2 H2 H#`Hb2`0"` '@3 `8`@obp"$' @ bc 8@u㿀!" @@X""` X`o %)" C!  "@@~@8 @"@`, @@E  ` @>!@ ""`6  "` "@ @"a@! 0 "@#_@ g@` @"@"`  @ 2@ "@" "" " % @ݐ#  !@ !" ` @!@N", """c|@Ԑ @Xx+ ~b%'!"4"@","@ " "@!\ib` 2`< 2@ ,`  @:"h@ `," <` ,@" @& #X@#  @@  ` @!@ #@  ` @r!@ ""`b8 ","@ "8@2 `8@^, $`8"#b,`8@@b,2 @4  `8@G< $`8`  "@ `8 "  "`8  ??  " @$?' C  7//   ` 2?`0#42`H2`H2`H" '@ @ݐ#` '@z"a\8@ b  @.Y#㿐"#b`' @w `@#"$ '@P㷐 / (@' %@ @!)$@ ", $ a!$@ b  $   @3& ! $@ $ "&  @ 2 ?", ?"@ $ `!8!,@? !,   @# 퀢!+"f!,"f *`@!" * A" * B@* C""D2H2J"L"P"T"X `\@`㷐 / (@7' %@1 @!)$@ ", $ a!$@ b $ `  ! 4! $@ $  ``2 "&  @& ! $@$  @ 2 ?", ?"@ $ `!8!,@? !,   @}# 퀢!+"f!,"f *`@!" * A" * B* C2H,?"D 2J L@e ""L"" P" T" X ` \@Y`㷐 / (@#b %@ @!#@ ! $ ! 4 #@ $ ", ! #@$耢 b#a$!b!,@!8? b!,   @ b 퀢!+"f!,"fb *`@ b* A b* Bb* Cb2 H ,2 J" D" L" P" T" X ` \@`㿘 $ " (@ (  @,  4  8@   , @㿘#|c  @ǐ @c@%@Zc " @   @ @cc@R   @ c@0R p`2  0!\# `$#$# 0 %| 2  @ @ @w`X 02  " @w`h" `x@w  @w@  @wݒ` ( @w֒` $ @wϒ` , `@wǔ .` 4  P 8   @   `@w``.`@4@ !| a#\l#` #d #@w@4,  a(l#\ #`#d #@w@4  aPl#\ #`#d #@ws# @woax@K#㿈`'쐆`" @j' '@e @'@͐ @  @ܒ쀢`@Ր@N'@Δ @ʒ" @ޒ㿘!" d&"& @̐ d""f"& 2  @! @\Đ!"f"@"& 2" @!"&! " b! a@ϔ` a@Ȑ! !Вa@Ô㷸- ~Ĥ0`' @@ @a`< G `@@t`<'ؔ @nؒ @h#@@ - @Z@ @ba 2 `( @K @G#@@   @9@ΐ b@f`( b0@_`$ b@@X  )", Q `4H-` " ", J  !0H`D@     P "P@(bh",Ȕ @",`8@@    P  "P@bx",`8@ې",@@@,@  `4 `8  P @!   @ w @`` H`  @u  b@Ԕ  @*}"㿀`(''耢 '@'`$  @'耦 @' D@  @'' ,``4   ``'@b^ "b(@F@Y @U(4@Q `(@L @H `$@C @? @;@7 `8@1" @B㿈@b! "b( ' '@  @1" @,@R " @Z ` @"  @"" @J 㿈@a b,b$ "('@'  "@쀢   #@ '@? #@ɒ@㿘@@#b &  &@S  b&J =b &  b- f "f@bd`2 @9  b@V&b "f#(@"fb"&"&b&" @@@@n #b- f"@b&   @e#P  `$``2  #@Z @֐*Nb@f@̐@ɐ @`@s㿘%&  &@&""`& "& 2 H-2* _* H* 㿘" " v  u "c"@ۅ ?! u @#! u#܀?@b #@_ #@\ @#ܐ?$#܁㿘 4.` 8 @  @`# .` @h   #@ @ 2  #@$@|   @ u#㿘N .  = L .4 .`.`?? !    !$  !     _ - _2 _ 2   0@  2L 㿐  N. !    2 *:    N " @P "  㿘1\#% ` @. x@ `  !@J     @@2 "$   @r~@$@ " ' $ ` \2 ,@ \,@ `,@`` @* 4,@ @ 1  #㿐@?  @  @Ԑ  @#Ȁ?2 @ː#"! u  @U`#@5 #@2 #@/ @#@ː 7' @?? @  @    @ ٬          ؤ0DXڴ     ؼو lڀڔ T < L\l|(0\\\\\\P\\\\\\\\\\\\\\\\\\\\\0\\\p\\\\\\\\\\\㿐9 u@ M#,"@ " <"@" "@!" """""(!, "@ "$"@"@"@ "@ "@ "@@*,"@   * ,`"   * ,`#  *@, "  *@, "   * ,`#   ( #Д " @Sa @ Ւ?@-@ @qe"L`?㿐! u@ ## @S̒a @ ? !  @~ @ Ր!@ΐ@qB㿐@ z>`%*` x ",@Ll0!",@G",*`(" !",@;",*`( " !",@.",*`( " !",@!w",*`( r" ",b  @5 0h"@0c#b,!! @b,"Y"@!",# @!",@@0L",b ",b",b",b", b",b",b @ڐ0&@pb,b$" @0@Ւ 0@ђ 0@%0 @ ʐ!@@@ ϒ ; @ !X@㿐@ ~ ! @ > .@ @ ) @ А`:@ `: 'a2 @ @/   !@0 ! !p !@ w @ː㿐 @ v!!!?  (!    P,  @O 2 !.@ !@ U ,"ۤ ;  0 @ A"0  @ <"00"H@ 8@ 㿐@ 9!" "`"@k$   @ * {  "@ @m0 @ "0@ @? }@ 㿐@  { @ "@M0}@(4 2  @ "Ȓ @u(4 0 * .`@$ 0@ ?Y }@c@ ޒ" `0S#"N" b  `  2 @c  2b "` `"` $+"` #b"" 6А  b@8   b  @ "0  "@" ""㿐@ ~>`I*`! `0 D&`0@ m!3 @ ]"`0 b@jW  3b #@ Q`@,`@ /0$`,@Q 0(@ΐ%&`(@ʐ!&`$@.&`@*&` @&&`@`40 @ &#(@z@ + ; @ "H@ph- ~Ē'@ ̠ !  !!?   @ #H ;"?@S?   P, @ì 2  @ #x0ؐ P ,* : `2!|*` $@"@ ؒ! @m̔  $̐@ @q؀ ؒܠ $@ސ{@ !"  @ # ;"?@ ?̔ @ז  @ ! ̔ @ǖ є @ ! ̔ @  @ {!!!?2  @ d  ;"f?@ b? @M`  @M`( ̐ / @M`0  @M`8  /@ > @ۀ ; L@ @  X0$`L@` @`AK?@ 3L@`A ,"<  ;  !X #  c@ #0 #@ @ e?@*@ $  @ (  @.&@  @#  㿐@   2 @  @ 502 ,( ;@ߒ!2 @t@   @  @h @h$$&@@ڤ ; @ "H@ p% ~'ؐ@ [ * @  2 @ !  @Ð ",b0 $" @ ,؀ ; @ "H@ ֐   @"!@@ v!@ ʐā㿐@R9  @ !X`:`  21@%`@hY  2)@`  2`P *`* @  @s` D 2@@]! 2` @ \!p`@h " D@`2`"`D  !@ I`@@@SZ|  㿈#b T |"#0 " @  1 @"0|c$"c "@ @4*`" *  * ?b "  (?2b @ !b u ( c''77@ @Y"?@d #"#@^ "# @!  b`T  ` `(?@   b |# |^|"#8' ~Ģ'@,#b@% @] @bL`@"L  b`H "&`L "b `@ϐ!b| ( @"b" ( '@  @@  @!f"p% ~Ē ' @ ? @f" В  @ǐ @g0a@? `A A`7 a@?@Z ?@V @R   @!$"8p% ~Ē ' @ϔ  @$" В  @ @fِ0a@?  ?7 a@?@@  @ "PH' ~Ē ' @  @" В  @I @f0a@~  "p@ 02 A A/% H .  (@+ @f0 a6@` @&  @   "@0  "`H  @ @   @ "㿘b0  "   2"b0 |c  "c"@e 2$  @d"$ 0`$ `  $"0"  4$  2"$0 @`"|`2 @ "0`|"@ h% ~Ē ' @ɔ  @" Ȓ  (@ @eӐ0 a6@?@z  @t  "@@  @   @    @א"X% ~Ģ '`  2@jI @ 6 #@=  @Ȑ#`b  Dbl@d  b #0`@  @#`㿐#b  ('" ,  @F ?2 @#p  @b ?2b @#b" 0㿀 '!""(bq@$ 6 @z#   " @o#"#  (bp@ 䀢 6" @c "by (@䀢 6" @X 0" (bf@  @L `" @B"8" "`4 `8@?  v" v l`"<"@ D"`D''(% g@Ҕ 6 v @(  v p v <#@''#"<"w (@ 6" @ " (bv@  @!P% ~`'Ā?'#@Ԓ#bf```@#\@b'@''` '" ,@h   @6"  ''''0@Ϗ ? @!  @! 㿀 #b<@@b8(@4 fb  ?"`@"`<b`@`<" 8`4U"`< @ @b< @ @ E"<@` ??"< "<4@͔ bb/ < @ " <# ' <@ 4 b< "<" e'!" %@ @b`<"`4 @@Y@ b<   ?"< <   ?"< # TlD@dl㿘@U@``O` `@   P*`  @!0 @!XB *` 2 @`    P @!p@.& @ @` 2   P @!@@&.@H$`@@ ` @* ` 㿘@Em`? a@n     @`* @@` ` ..@@N@  ݴ .h ~b;|' ? c'  !@$  , `P .  [ j P .   @+ @?* : `3="ē*` +;  @ ` !@J   &@  x t+?+` : *?ѐ t+ +?` ` `P` @  " @ `P .   J @  P.   "H@ `P` @  @ݐ!쀥@@   P.  & @͐"x@# @V!  P. @M& @"&  c @ΐ  ?* : `6*`!  > "- : `  !@J    @@2 "$  @f@$ " ' $ ` \2 - \-  -  @*  "- a-@'@/̒@aϔx$S@@ @frg?e$@@* : @* 2  Ȑ@f]R?P$+L      А@fH=?:$0  " "@a*$0 J@"@8$`@  : -  @8А - ' c @ː# "p ~"  @y# h" @ `  @ې#80"   @ \  (@Ӑ a!,@  #!0$Т      `   lx @ #`` @ "  !", ", "Dch #cx ! c`   "Dc","0@ @Ȓ @@   @ @ #@V  Ȓ@  ,   " @  , 㿘  573x9&@&&bD <"#"b8*x* '"L㿘 ? & @e  &c 2("c` 8# @ #x"bD"8 8 "##*̀Pb8*?b8*@̐ "́ 㿘<? !     - ""H"b4@Ӓ0G? !     ""H"b4@02""H"b4"*'+ ## ? !     # "@\ ""H"b4@\㿘cܠ#"H "8""<##"H""4  #cb8"b< #$㿘)#܀  %H'4#$c!$#gH%#c؀ "D""<4$H#$c$4$#Ԁ #&#܁㿘? 㿘  #* %%` @#%#* `\`" %2 @x#Р%#"c*!㿘#,c  Ԑ x  !   D  c@*  "cc* %%2 @? %#"c*!㿘!,#! -_ !     @  "c !   D "! #* %%2 @ 0%#*"c@ 㿘@@C3㿘 `T"x "@|  2 㿘!'H'L'P'T'X!@$1!Ȓ$H@Q!  b@KZ!! u#؀ " @d!Ȕ!@  b @   @KFb#؀  ! ~c@dG#@##@ 㿘!'H'L'P'T'X!@o$1$H!@P!  b@K$! u#؀  @.!Ȕ!@]  b @X  㿘!'H'L'P'T'X!@G$1$H!@P!  b@J! u#؀  @!Ȕ!@5  b @0  㿘!'H'L'P'T'X!@$1$H!@P!  b@JԔ! u#؀  @ސ!Ȕ!@   b @  㿘@" %`N m`@TJ @b? :&@(. *` 2ݑ: .h#'H'L'P'T'Xaʒ$"H!b@ aȔ$@b!Ȕ!ȖH$@P4a!  "@Jua1"<"@Jp 3b4P u c  @Jf ^ u#؀ "a'@o "? LqT`=_8a}lCw" L@ `` ? @ /??Ѐ@jL@` *  *   ' 0"  #x#  #H #x # #  #x # #  #   # %.| 0!h 00,  #   # .Z2`0F0h`!    ;" R  @<'!   ( ;" ? @<Ā'l'ܐ8'ܐ /  א @ ;" ( ג!  ǐ p ;"԰ а @;Đ?'ؐÒ /   ;"  !   ;"  @;'Ԑ!   ؀ ;"  @;'А :  } ;" ΐ }!  m! ;"z v @;'̐j :  Z!@ ;"g c Z!  J!p ;"W S @;`'''E ; 6"B ܰ. * *  ,ؑ: `  `?Ԁ`Ȓ v!H*`   ?. *  . "*  . "*   ?. *  . "*  . "* 㿘 @'    !@ &@ϐ !& 㿘   ( ! @ & 㿘` @P #" ` @J ?` @`@ @" ? ʐ!? ?`` " ? !Ѐ?ڀ? !@@@~㿘@  ? ,"@n ? " ??@ @ #? "@07 ~Ģ'ϔ  b   <  7  i"P @  Z"P``@k   N"p    @  6"P``@G   *"pw b@@Đ@:(4(@ "P^(4Z hD ` "P``@   "p? 8    ` ې"P``@   ϐ"p    ` "P``@ʐ   "p      "P $@&@`  2  "P @` $@ |"p@Ҩ ''@8@6@4   @, '  U"P_'  ?: 2 G!G C X8"x  @"㿘@ F㿘"X{ "x "x  "bp  @"   bt  @>k="x 6 @T  R"' vᴔ  =% v# vb  $b" @ 2b@T  @ "b? $b! v#  @ # 3 @O / $ᴐ?$ $b! v#  @ # @: "t @  "x@TP  "@ İ 0 >  B="x+㿘@   @T8  @ "G N 2 #&@ *")"p !"t @?6  @T  "@u"t:x%"p"t @ !??:"x@T  #@ u @)0 "x<@ $"x <`B<"x 㿘!@0 &"` "& `"$ 㿘"X@  XX@ @  @@@ X@ @ 5#?㿘 vb v!  )"bc : A! v!`"Ḁ@#!7b"\ v" /#!! "Ḁ@#!%b:! v! "Ḁ@#!b v"X "a  #!  `@""b? #b1 v#  @ # !@2 !㿘! v"#" c( @Uh!@Y/!?  @wc@ "bt?@@S4! @ #H? 㿘1"t "@Z.   v@S! @ #` ?&"t@!  :"x"bp 㿘"t @Z v@!@.㿘 ~c#@l   "X""X"`*  $* v!!Ԇ((  #!Ԁ    * 9999999:::0::::::::D:X:l::::::::::::::::::::::::::::::D:X:l:::㿘 v v#""+##*`*`*`*`*`*`*` @,@  㿘# v! vb"@#@$b$"" b# `$b?㿘# vb ! v#@c $"$b"  b#*@`$b ?㿘# vb  ! v# @H$"$b"  b#@>  ?㿈 ~"Ģ '@%#x " N @z  @ݐ@  ?  b  @V#㿘 @@Ja@ p?Ѐ6Q (K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?㾘N@ 0}N` x X25N@` N@@ '% *` : , ?$@  N@ @ *`  `,   "@` *  ` .  B  0AN` b B;` N@@ '% *` X: , ?$@ F N@ @ *` ? `,   ?"@` ,     *` . ,  $㘒@ 㿘#` v"     ` 2``$  . `$ @  #ȁ㿘`0 !#   .``$` ?@Ɣ  ؐ##,# ( (  (  ( ( ( %( "@)c. !#  .``$` ?@  #ؐ  @㿈 ~"Ģ'  @˖ J  / / / / /  / ?//@a  s#〔   . $ ** * * * * * * @ 2  N   K#?@` A  ? ? 9 8?b  @  P㿘#cJ   @ `9?@J cJ@`$c@!Z##c# )F #܀ `    @2 `?c@ݐ c@ 㿐  c @R` @ ?    @E?0  @ 1/+ v`"  @0  ~## ?4 @'cĐ@J?` 2 &?΀  @Qג` {  @Q͒` b\O@ ) v"`  = # vb $b􀢢% v" \@} 2b@Ol  @ b? $b! v#  @ # C?@4 ??%"`?$\ $b! v#  @ # "@ b\@b\"cL  @R & @ a &  @ #  #J`@ U 㿘c%   9#1 v"`&"c@,  2"@N  @s "? &"! v#  @ #  ?@Ɛ ?$?$c &"! v#  @| # @ 㜰 c* "  $㜁㿘. 6%3;cc㬵. c cc  ! c ! (#  # "#(@##㤀@ *``"㤁㿘! v"#`c$"""##@#c"$c? $"! v#  @ # @) 㿘N ! `@ @\ @7`ؠ 2@N4  @. 6N'? ! @o   v"@U(   v@N  @?0"`  !! ~#@U`&㿘Gc v@ #`?ܮ b  `  ##"U" Rb`&b b? K&b1 v#  @q # z?@ v?`$`` @) b? +&b1 v#  @Q # Z?@ V?? $3 vc  @= c "@r @C 3 v :?     ~! @c㴀  ܀     ~!8@͒c܀ 㴀  "    %"%b`&ܒ  " 㿘 +O- vic  ?/# vb  $b㰀" @C 2b@M2  @!Pb? $b! v#  @Ő # ?@ ?%c?%㰀 $b! v#  @ # @ 㰓,*` "c쀢 " ? & @T=  &  @ c  = # vb $b􀢢/" @ޒ 2b@L͐  @B!Pb? 4$b! v#  @` # B?@ >?%c?%㰀 $b! v#  @K #  @  2 #*@ @ @L  @ !`? /㰐 *@ " *܀`#` ?㿘N ! ax@ @@5`2@Ld !@1 6N*? ! @Ꞑ   v"@SW   v@LH !@?0"`  !! ~#@T&  㿘s vb  `'@&-+) U 䀦@ `c܀ # *@ @ 6@?`@쀢   " 㿘"  ! v# "쀢  N@`  N@@j` @KԐ @Ja?" 㿘#ԤJ Ԧ"@˒  v&Ԑ?& b >+ v# vb  $b"b@~ 2b@K  @!Pb? I$b! v#  @/ # Ұ @d ΰ %⠐?%b $b! v#  @ # @O Ԕb@ڦb @`* 5 ?@ `*?@ &  #Ĭ@ J @Ő  ?% v  $b"" @~E 2@K4  @!P? $! v#  @ǐ # j @ f %⠐?%b $! v#  @ # "b@ b@r`b@ b⠔  < # vb $b" b@} 2b@J  @\!Pb? $b! v#  @z #  @  %⠐?%b $b! v#  @e # b@ b*&b㿘) ~#  3/? %@Q#  %#X' >+! v"  cĀ$"" @} 2"@J  @!P"? G$"1 v#  @ # K?@P G?$?%cĀ $"1 v#  @ # c@; cē,`*` "c܀` 2` c&`*@cİ# @ ? @JB! @! %Ԑ ?6 ?6 +c*cİ%ԁ㿘  @g" ! ~ "('   w `@ @~p#` #` ^*`: \#``?"`` #`@ #`` \?"``#`* $#`@ \N`` "@K #`"@?M "`  #`]* @ ^#`2  0`"@  #`* $#` @̒ #` 82  0`"@  #`* $#` @ #`  0`"@  #`* $#` @ ``N?"`` #`* $#`@ J #``?"`#` * $#`@v  g0iiiiiiiiiiiiiiiiiiiiiig0iiihihii0iiig0ihg0hhhxhxhxhxhxhxhxhxhxhxiihiiihiiiiiiiiiiiiiiiiiiiiiiiiiiiiiig0mprz|{lpdjkhlpmopr8stuvwlxy{l|,~lpd㿘 w @J!'('D 'H@~"H"`@X   vH J r`? v""1 -' ;% v ! v) ~+ w"$ x p"0 0 %) $"H#`@P$@u H"D@T?• s ~tH*@'HD" 'DD`HJ@-D v `"""tH 'HD'D@k ! v $# @ǒ   <      @} @  ~$#@}#`@ @k *`@gĐ )c@g  @g )cl@g @g `    ~"@|Cc W"M ~ v "#D+HJ@%H@@ H |   v#` ) ~HJ@!# ~H v#@IΔ  ~D   ~c@|"H@J2 v " v#` ~  ~#`# v3 ~! w5/ + v) % '; 9   b cc@OU  @{Ւ@k* ?'  v"`c@{֐#c 2 b # 8 @O* B  ?&< #Ē J   #@ ? ?5 @T"#ذ ?@c & ? `@ ?" c??c0%$c  c&@{t#c c  b # 8c@Nܖ 0 c8c@NԔ  c@{Vc`o b # 8c@N– ڐ b 㿘"c"#"   # #&#$$#J`,`; #̐`;##$`@ #̀ 4  &## #$Ȁ ?㿘  #J@ `$ccJ? a   ` cccJ?`U *` €cԐ $cԔ !J@ `$cJ?   ` cJ? a   ` cԒc@1  @$ <#@ y#X - ^2x v& ? a   ` ` - ^2 b?YcԒc@1h  $ <#R L#XGcԀ . 4$cG? @@ / @`? 9cJ@z `w$cԀ+cԐ`$cJ``@$c԰ k (?cԀ ;̒` $c" "c#cԀ ?#䀢@  #pN?C 㿘   !J@ `$##J? a   ` ##J `p%$#!\*` € J`n" `p`l   2  $# $# $#԰ #J ` $# ##؀`@@ cꀢ ` @  J`n" `p`l   2  $# $# $#԰ #J ` $# ɐ##؀`2@c@ b &?@  ?` @  J`n" `p`l   2  $# $# $#԰ #J ` $# ##؀`2@lc@  zc   2q$0o#` v"`"g?#̀` ]##J? a   `  L#@ I J`n" `p`l   2  $# $# $#԰ #J ` $# ###@ Đ  &?@q &?F 6L@?  ! v#@F L@  @ vJ#` #Ѐ v#- &?@? w w""H""bL#̀` ސ##J? a   `  ͐#@' "˰?L@ !  #J`n" `p`l   2  $# $# $#԰ #J ` $# #L@ ! v#@F9 @ 5#@0#؀`  #@  g G  xG V` `& J`n" `p`l   2  $# $# $#԰ #J ` $# I#ؐ`%6 #̀` :# J`n" `p`l   2  $# $# $#԰ #J ` 8$# ##̀` # J`n" `p`l   2  $# $# $#԰ #J ` $# # v " " wJ` ` ~ #@K5c0#` ϐ#p J`n" `p`l   2  $# $# $#԰ #J ` $# ##؀`c@c@? `@   J`n" `p`l   2  $# $# $#԰ #J ` $# s##؀`@X#c h@ V #J c $# U#p J`n" `p`l   2  $# $# $#԰ #J ` $# 0#c@ S `@+ % J`n" `p`l   2  $# $# $#԰ #J ` $# #c@    ?`@ )#Ȫ# #̀`c` #䀢@6%# ֐#p %c  ̐ 8 J`n" `p`l   2  $# $# $#԰ #J ` $# ##؀`@@ @ `@  J`n" `p`l   2  $# $# $#԰ #J ` $# q#c@ e  k i?`@g a J`n" `p`l   2  $# $# $#԰ #J ` $# ;#c@ /  5 3?#̀` )# J`n" `p`l   2  $# $# $#԰ #J ` $# #`  ` ;# 2" w  "#̀` # J`n"  `p`l 2 $#Ԁ#J ` $# ϐ##`Ͱ? v"`Ȁq0#J? a   ` 2 ##̀`#"c@  J`n" `p`l   2  $# $# $#԰ #J ` $# ##؀` v@g vJ##` L@ ! @C L@  @L#  c#Ѐ## &[?Y#䀢 U R"c#') w# w- J` >#J`g" `p` "0+`9*`0&`r 0$# $# $#@+ܔ  @@`(X% ,% , ?$`( #Ԁ  w $`2  P w" ,#J@   vJ` 2 v  p" w`$ ""􀌠 $@   $? $! v#  @  # а?@ + ̰?@  w@@rq $ w "`% $? $# vc  @ Ր c @   # w w`,@ ]`( &?#؀``( `( ?$`(`( $`(`(  ?$`(% wJ@ n"( p l (`2 `(` ` ` "($#Ԁ`@m g J`n" `p`l   2  $# $# $#԰ #J ` $# A#؀  w@' w $`(@ ,) `@5 /)##c (#̀` c` #䀢@6%# #p$c J`n" `p`l   2  $# $# $#԰ #J ` $# ##؀`@@#ۀ #̀` ߐ# J`n" `p`l   2  $# $# $#԰ #J ` $# #@ #J`q`Q2J $#԰?#J? a   `  #@ #̀` %䀢 "#"c@  &? J`n" `p`l   2  $# $# $#԰ #J ` $# ^# vJ##` L@ ! @@ L@  @L#  F#Ѐ#W    # cA 3䀢/"##`+ v"`'`q%#?#̀` # J`n" `p`l   2  $# $# $#԰ #J ` $# #M v"b  "@` # ?ϐ #Ԑ @)  @<#@  w ː#X w" ϰ?"  J`n" `p`l   2  $# $# $#԰ #J ` $# ## w#c@&@  ? J`n" `p`l   2  $# $# $#԰ #J ` $# l##̀`## @( 0a#̀` X#@S U J`n" `p`l   2  $# $# $#԰ #J ` $# /#!# #@`#@t  vb " @ 0  "@` c @  ?  #  ?㿘#̀`"#"c#c 4   #䀢   #p?㿘 3?1?%)`  ?,䰒 `鏐胢 #܀ ` W   @o  `ڀ`  ?㿐#J@ A !J@ `$cJ?   ` cJ`   ": $cJ@ !`@r$cԀ ' !# #@2`c#Ѐ   ][ ' w4 9% w1 v""`&"0@o 2"@<ѐ  F "? &"! v#  @d # 6 @ 2 $4?$0 &"! v#  @O # c@ c'J@  w# @`0`* '##J@ #0*@@0  0㿐 v"`'    `"c? w `<  =- w% v  $" 8@ol 2@<[  А ? $! v#  @ # ܰ?@# ذ?%`<?%8 $! v#  @ِ # 8@ 8 !*@J@ f /  75J@ !T %`< < ! v" 8$"" @o "@< ~"? $"1 v#  @ # ?@ѐ ?%`<?%8 $"1 v#  @ # #@ #8 *@#ԦJ \ %# 8*@'#@ I`< =! v"  $"􀤢"8@nŒ "@; *"? 9$"! v#  @H # 6?@} 2?%`<?%8 $"! v#  @3 # #@h #8  *%#Ѐ 3J  2 !`< <%! v"  $"" 8@ns "@;b ؐ"? $"! v#  @ # ?@+ ?%`<?%8 $"! v#  @ # @   @:h# w @8`*c@@ [# vJc c@= @q`< <'! v"  $"" 8@n "@; |"? $"! v#  @ # ?@ϐ ?%`<?%8 $"! v#  @ # @ ?? ' w @8`*@??'#Ԑ`%#ԔJ` )  B3% v  $" c@m 2 @:  " ? 1$! v#  @@ # .?@u *? # ?0$% ?&cЀ $! v#  @& # 8@[ 8@pcc"#*@L@ ! % 㿘 ~ #"` /-' v؀  ?" ` Đ J?`  ` ?5` u s?cN   J ` "Ԕ" N .N  X   $! v "? $"1 v#  @ # ??@ ;? S $ @ q "? $"1 v#  @ # ?@ΐ ?? " $! v#  @ # {@ w؁㿘#     @T%3  )`"P@ =/ w% v  @$" @l @9 `? }$! v#  @7 # ?@l ?%"P?%@ $! v#  @" # "@@W @`@o`@@@ %P` =/ w# vb  $b" @@lj 2b@9Y  ΐ b? 2$b! v#  @ # c?@! _?$P?%@ $b! v#  @א #  @    (@(* * @F ! v<?"?`@#$`$" ` @| ""? $"! v#  @ # ?@ِ ?? " $"! v#  @ #  @Ð  㿘#c   #Ȭ  v  vb   "b "`S @"     @ b? %b! v#  @> # N?@s J?ڐȀ ӐА̐ɐ@ $@" "@ $$$" "#؀`b@陒b? " %b! v#  @ #  @*  㿘!#䍦 #c "@ ` U" S`& "@N` E1 v)"`@$&" "9$ @ "? &"! v#  @ # )?@ %?" ?%# &"! v#  @ # @ΐ  0  ` 㿘% v $ @B )? $! v#  @j # 9?@ 5?#`@  ?#؀`##&@?$" $` %#"##`$! v#  @6 #  @k  㿘  #p$?#`@  㿐@" #⮐ `$` @ &?@@ 㿘 a`  ` ` Ő!0?* c 2"c "c" 㿘? a   ` ` ?c*R@  !0?#􀠠   # "#``$ 㿘@h`     ":@6  m  㿘"  N \2 `?㿘' wH 9) w! v""`$" D@i 2"@6ϐ  D "? $"! v#  @b # . @ * $H?% D $"! v#  @M #  w@  wDN`\  `*  D*  D㿘@] v"`  v? * @"@@L"㿘@F v"`  v? * @"@B@5"㾐 ~" v'  vI  v? #c* * %" ! !H  ͔   `J@ /@8V   aP@. c 鱔 @W[ 㿘 v#` v@WS ? *@* " `@Uɒ?㿐@? v **@"`h @U   ` w" ` w" @"㿘 v"`" N !  ah@8! @7 /   Q  㿘J@   2!p `"J`   ! w! :! 3!5!@5  w. !  w `@t  w@g   $!@5  ! 0 w"`!@j ! ! w@o!'!@g $!㿘#ԪL@! ` "c# * :  [ \  L@p   _aL Y L@ ` * c) w$! =' w# vb  $b" @hU 2b@5D  칐!b? 5$b! v#  א # 2   . %!?$ᴀ $b# vc   c c cԔ@k*@#܀ %c ! ᴒ  J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] 㿘&@&#cJ c" 5 @7 c0?J` @ (&cԐ $cc @ϐ  @ܔ  @<#@$&@ !&@ ?*:  g2 `$cԒ & 㿘cԪ "cJ % J*: @c! `%c " %ccԓ*J :` %y) ` 7 ! v" $"" @gY 2"@4H  뽐"("? $"1 v# { ې v#% ?$ $"1 v#  ̐ #   * *:`$Ԁ` `J `\'c **@: $Ԁ `#؀`c ~#! ?6 F " #ĐJ?` 2 &L cԕ=J@   ` # vb   $b" @eÐ 2b@2  '"(b? $b! v#  E # ?z ?%`?% $b! v#  0 # e ܀ $ ߜ  @h @Ȓ R$?` < # vb $b"  @em 2b@2\  ѐ"(b? $b! v#   # ?$ ?%`?% $b! v#  ڐ #  ܀  F  @h$ L ?"`  < # vb $b"  @e 2b@2  {"(b? 0$b! v#   # C?ΐ ??%`?% $b! v#   #      $@2 ܀` H"H?܀    @h.   "h@*@"h @*`  㿘 ` -+/ M &A \` `" , % v `$" @d  @1 (?$%?%` $! v#   # @K @ ࠢ`*@ M M 0H 94G?Ѐ4C* @  "@@ + % v b$" `@dK  @1: 谐(?u$%?%` $! v#  ɐ # @ @< ࠢ`*@3  )# vb  $b􀤢"`@d b@0 8(%?%` $b! v#   # `Ɛ `  *@  `% & # vb $b" `@cْ b@0Ȑ  "(<b?$b 2'?! v#  Y # ? ?%?%` $b! v#  D # `y `*㿘% w# wb@! wD  "<d*@  *`@c$b@ D$"<*` * "ĐD*"<@ *` "ܻD*"<@ *` &  $D@0g  ܐ"p@˰ @b"<$"<$b@㿈 wH ` 䀢?  wbL?  "? wbD   "c܄  vb "D "b􀢠H w("<@*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?†"D2  : * w"<(@2*`8:@ @('`'`*'  #@ #` #`# # # #؀`G"H?L%%"H%c$L $1 v#  D #  y  㿘 wbD ??!"bD) wbD* @*`"<@ D@ ``@ D_@@a@D??$D  w#$D w"bH""L㿘@/``````````````````````````$``4``````H`T㾰 b@3 "`Ⱥ    -0#!'9% 5 w') *$* @€          %`Ȑ $`$ @R $  $`̐ $ ' @L@?Ԑ? ~`t* & @ @< ܀  `Ȁ   b@nt  b` b@ni  `Ȁ  2 @y?"@, @)"`ا. @ wX@0֔$#(P c(@nE  @e&P .  w*X&P,`P$ &@@a? @f`? c@@s <  -  ?@?%  ܀ 2 @`Ȁ  @ @3 @@yd <  2  `Ȁ   ܀ " @&@㿘@ / 2N  2  N /"?* N /2? (3@   @s}  -<3/7  "    0   @&t @#P ;' wV8 2 "$ " @00cp "  wJ$`/T"L? / /,  wbX$#  , #x@e а  @zk$,X@獒?:  H& 2@  `" @@| 2  X@@T0 @2 #@(X@`  @N 0<    2 @ #@ Xx @ @   @S @(@"@?X0@LR @`?Q Ȁ 2 ܀`2  @ِ @ @   X@dےa 7 c@X@r  .@ "  wc@X@r}  @ @ǒ`? Ȁ   @`? @%v -@H0  @3@ 2 @ 2:@` ` @rM @<:  " @:  `??㾸 ` @^)@ % `0@r `  @^@ & `0@r  @c|@ @O 2@ @Ԑ 8 ` 5 w ̀``@CX`2G ̀`2B Ԁ`9 ~ `@#@4cX ~ c`? "`@3ː c  $c ? ~#`? &`@3c  $c` 2` y YX@eА X$ X &@O?2  8@sXV@t     <   `?)(+ @cഀ >`  @b ? "?@@.@`8 `8@=X   @@ Հ```8@q~<`  @$ 8  @eh@ee 06 `@ 2# , @ @t  @ 8 o@Q   8@X @e8@e6   8@X 㻐 ~"Ģ ' @Z#?`   P, 3 w@HbX   ` bXbX@e|   p@̽  b ` @ @b  @ΐ 㿘` 3 w@bX    ` @bX   @̓bX   ` @( 㿘` 3 w@bX    ` bX@Pp    @pbX   ` @ 㿘 ! /& $  $ @e#$  (#$  ,@e $` w@`ɐ"X    @CbX `  @E   `0 bX@o  `@`  @(bX   1& ` @y  0 @̛bX   @bX @` " L@  0 L@`bX @`-  L   @bX 㿘 ! w @c"X   @`  @ޒ"X 㿘! h# ~  a@2c  c@2{a8@̐ 㿘@TlxxTxTxxޠڨڨڨڨڨڨڨڨڨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨ۰ܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨ$,ܨ@Tܠܨܨܨtܨۤܨ܌ܨXܨxx h  ~?bĘ#ؐ?'"a ' J g   ' ax  !x?#!) b$!$@,`%! 2 !$  $!$%!$ J@ u?J` n ?!$`  '$!$%!?# @,Ab   @,;b " b0@i @, #? c!x' @`P"Hc؀ '@c''  `@NӒP'  !"@ ?# #,`"@ bX@ia !?#ܔ  @NP#' `??#@,`"``` `E5#*`  !x@+Ô |? @0"px!# ;!?#c@Δ J@ k! cb@i! c a$ ^"a$a Y"a !x@+ Q !$ ` "#a,E#!$B"!  >"a  ;#$@+~#6  b@h ?."a ?## ;c'J . ./' " c@+`" c'$` ","$a   "a a "a@ @ ! xb* @ Ȑ@6 ?i? ~ t*  @ ?# "  "&@&` !   b@h !  @ )!,@  c@h a ?!$`?"a  @l    @n- 3"&a(L -2 :L  2  :  #0k&a(i"?` J5"*` !  #8@B@n 0  + @c .?#؀`' @*ג  X$@/d# @@P  < @  &@   #`@  @<  ( #! "  ## #h#a$ a(  @  Ӑ#23#!  c@*^$(#a$ @$ 2#! ^ #@U X$@.# #@D#a !( !   ~ #`@/ܔ!$ 8"8"D @@   ! !, !( @Ɇ  a    @0 " @O 2 !   @t @㿘 @P  㿐@v    !x`!x  @2     2  ?c!(; ~bĪ'`  @Vؐ @JԒ   5! %  @@Ȩ;?  @K !    H ?!   x@@`Ґ?#/  `   -!   @@o@`   O @)T$"!!, A?! #?@Vq %c` @ ch< @ `?  &@3 @`}ư &@JN `?!   @@"     ?#  ?@?!   @@  "? c! @  @@"  #`@G@  " ?c       !   @@,  !  ?# "% ' (' ' $' , @K @_    !   @@ǚ  % ! ?#   (' @  ! ?# # #@ b@b  @⊐ 㿈 X! T!, P!( " @ 8@Ϧ a@0A &@L "@ "  @6 3&@ϊ   @*L`"  @8   @ #$@_''(#,@_''@T֒耢   @ 㿘 ~#@IqT   1 a@-?P`? "`@- ?P  $?P ? y ~`? "`@,   "`  ~ y`?㿘 Ja !aL@@U  ' x⤀  , @'Ő   ?,  , `L@ 2L@ 㿘֐  @'$@  a @'   a r.  . a@' 2.? r. 㿀!!  ! & ! ~ !@@Yc` @j#!`!  X$!! $@C J *  0* @!@j d @@B  B  @?f? @@ے ,4 4@@В @#` !?@:#\%'@ B B@C ;<.<! )`'   ~!@Y6c` `d@ @@D   B@@? !'#\@㿐!,   ~"@Yc0/!( 2@@if "` B@@b? ~ #b ?@,f@!$D   ~ #@,Qb@㿘! " h   h0! h@[I  ~   #bh@,8#0   ~#@,1b0   ~#@,*c@{㿘 `"d N@ r w N`  !@  "P  @O `  L& P&  & 0& 4& 8& & & & && H @5  T& @*` X:  w. 0 ?@< @  L@V8$ & @& "N w&@   @  @   @  㿘  2? ,  XN w r?`@z ``L`T&@ `P&` &` >` >` @],@](@Uݐ㿐?#@?* @ .`@2@ 6`@'@  ? 㿘 H ? 2 @Z L"@C $  $ H ?$   ?$ @`$ 㿘ݐ ڐ * Ր * А* 㿘  Ɛ c( @ p   e`bҐ`P`L&  `&* `&`P  & ??`?`` c@.@`~`P  & `2.@``l`P  & `"  H][`P  &  H  @? O"p  #(#(! ~ ` "/'/ဦ`///666///瀦/䀦 2/  / P  /'&` ''@Y @&'܀`  @H? ?"  @#8㿘`H$` \$`Z!` `@W`L"@@@ $`  $`H$``@F  6 'T`@@" $@`@ @3  `$ P@) "+?@ `$@   $`H@7  @X $@  !`H  T` 2` ! T`@@D" `$@&㿘?4`c @@c@@ ? @ ? `  ?@@`?c@? @@Вc* @!G?"P![@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@ϲ`!?@#@#a L(7@@`@`@`@`@`@`@`@`@` @` @` @` @` @`@`@β`" !?@@`!?@=#@9#. @㿘?!? @=j#   @Yu@###6`6 ? @#  @& & 8& #…8& 8& .  x% x    H    (``    00*```  x 0 x㿘 x" 1!㿘` x` " G8@ * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6 @`"8@ * a@`6 @8`  `2`` 㿘  $ 㾘:;n # '  *`$``*xݐ`ʐ.6 > ː`.6 > ޒ 0         , |       p T  8 T         ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8*" <" 8 㿘 N 12:?@ 5?2 (1? $ G"$ ($ 0 , 2 (G"$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘   XcX  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4<  ( 2   $ * $ ($ 0$ ,  (&@@    4@Uǒ"@  (#$ 0 0" @8 4  @U"@@   4@U"@ ($ 0 0 ( $ 0$ 0 , (@@$ , 㿈  $`"Ӱ?  "ϰ? 2@  2ǰ?@ 2  $@   `8`< @`g@ *` `  $@"\&  @?*` * 4 @̒  :   6 4 `$  . * $`   $`& 8  $@ ¤ ",&  @?*` ?c4 4*`  , $`& 8   $@`   & & & &$`<$`8P   $`& 8 $@`"& `  $4 $@"&  @?*` $`4        4     &  $@4^ $ 4 "&  @?*`?c4   $`@   $@`@ 88 @T`@%"$`@@&@*"&  @?*`  a$``4  $`d4  $`\4ak򀢠h $@$`h`h`\@0 "o&  @?*` `h *# `p*  2$`h4`\ `he0 *# * `p2@ $`he0 $`L$`T$`l `p `l`T@Қb   &   &  $@ $@$`h "(&  @?*``T * ?`L * @@7`@7 񀤀  "&  @?* `$4`h* `p2@  c$`h   "&  @?*`` $4`h ?* `p @ 4/! `"&  @?*`` $4  4"&  @?*`` $4  4`h```d@ n??" ```h`p* 2  ??$`h```d`h *o`T@ "@e0 $`L$`T$`l`lb`` `p`T@ i `` `l*``p$`P$`X`d@  @`X X   $@ "b&  @?*``T * ?`L * @@7`@7 * (7 7ꀥ ">&  @?*` *@ 2@  `L* @@7`7$ 4 $4$`@   $@ @ $@2   $`H$@`H` :`H "&  @?* ``H *@`@  $`@4$  $@ "&  @?*``X * ?`P * @@7`@7 (7 7ꀥ "&  @?*` *@ 2@  `P* @@7`7$ 4 $4 @  $`D $`H$@`H` :`H "&  @?* ``H *@`D  $`D4$`,`D"@i $@`u%`D"`0 `4`($ ""@`@8`@&8`@&@"$`@ @?.``@ 2@ $@`H  `C.$@ײ` 68  ":&  @?*` %@B > `$``&$`& 8?c4 4 *` ,`   &  $@   $@ ?M?& & && $`8$`<`(  @ 8     $@3?  ' %  B@B > > ``` $` `M"@$`& 8` `<@@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?   .?      ?   $? ( @ 4@Qz"@  ( $ , 4 "@Qq$ , $   " ? $ " ? "?" "`0   0    ( @#㿐 N?`$ 2`0H 2 < B?   < 8 " * %% 8% < ;*  8  <2`?% 8 % < % h h@ h```@ @B "  %`%@=` h ?` `z  =`=`  % "? $ 2 ?   <`?㿘 `"\?`$ "X?`("T?`, 2`0N? 0  2 4E?   $ * `( `0  `0`,€?01@P @3 @Pa0 L%0@ a,@zА" ?%0@$`L P:А" ?%0@$`P l:А" ?%0@$`l $ * 4@P}$`4& $ P .ж6 @ Ѕ(`@`(@ 6  +`"@ 8 `Є @ // 70 0$00$%  +"@*  .@( S(.K`2?7  .@1  @(`@((6 12`@ (`        8v}!? (?    ?%(` ?(` &/7 /(/@7 `/7 ((&1(70 ( 6 26  ?  .( 6 8 @(@( @" "&@+  (. @  ( 4` (%< ,`(('80//7 #   /1(7 (06 26  ? ވ + $%  !    8(㿘@Pђ @P̒@I 㿘@J㿘@B $ % % $ % % %8 % % %8 % %d %d ! ! ! ! ! ! ! ! ! ! ! ! ! !( ! ! ! ! ! ! ! ! ! ! ! ! ! ! !( ! ! ! ! ! ! ! !( ! ! !( !( !( !( ! !( !(x b@  h`J o`?#a4J g`?" p @O耢  c@W1  8a'耢 9@ @?А &@["@  @Q ""@M` c0@\ː J`"' c0@W 3 @U ' c0@V ' a4  @@l :  @@f .  @@  @, @@ @@`@Ĕ   @\ ? :G* @€܀ a8@ޔ a8 *00r   @xcH @r0a8 c0   H @e @r0U0 Ra8 O`M0   @L "L @L "L @ L@L 4/ a8  @@T@w  ؀ " a8 0 `  @O  0 @[:  ؀` @ӐP @$ 2v :@p` cX@[ @㿐N "?@l     ?@􀢠 ` ?ch@V  㿐N ?@\     ?@􀢠"  cx@U 㿘!8 h!0` h  # # ~ #@c0!4 h`    @ ~ #@c@U 㿘@Ɣ㿘@        *    "     " 㽐 ~L4"Ā'"0  `@$Z  B + B+ 3` @; 2* @ * <!h`(4@M@ *   = b<9 $,@@ "(  @L$@  @3 , @L", - @ 2          @ϐ 㿘!4@M (@ ,a8  4  ,4 (/  ,6+ @}@ 2$  $ ` `@25@ܔ" ,`@6 "@. . .  ,   ,~B?< W$ ,  4  ,Q  M ,I @ $ ,  @ b !=< 9   3 /@/ * ,  ! # ""   < $b$ ,`<   `@1Ԑ@{`@ 6  , `, `@"". `*41 2. 2 `)   `` `` `  `J@/`  &J@J@`?㿘@㻈 ~"Ģ' @#7 @ Đ @ɐ $@0`!`@   @#-b@ @,, !aF\!T@ <      <     Ȓ   @"b  @"b  @А ؁㿘 @ Ȥ!h F\.`aT >`T !T   @Ӓ r `@ Ҕ 0l!  ah`F\!T@ <  "    <  2     x" @" @ . ah`F\!T@T  ah F\,aT:  + : "  @!a  J#耢`a 6 a @  @"h!a  @!0a 2ah @+!@  ah F\aT T > " @ a4 㾈 ~"Ģ '@J  /`  `    " 67 4   $!쀢` 4   2 , ,  ,  @I b  @Ͼ!H㿘    @JL  ! ` $  2 , ,  X ~"Į  ???????'@ΐ ah`F\T@ < `?"   Ȓ  @!Ґ!P@ _a  J#耢`ah`F\!T@2     a 2   @*!p  @A!`a쀢 G @ ! xXa"Ĕ  ''/'@  -$@!!a 2 x @*Ԑ! ! x"Ȓ @`  $"@   a  @ ! @ a $ @ 쀢  h!@@hF\aT  <    ;<  3 @!8! @*" 6 x"Ȓ @  $ )" x"@   "@ .#ibaȐ /'ȡ- '`*`1:`a2@    "H@  VĠ@Ð@p   "p@   @!B!ȓ.  ?82 ! @>" "@O@h F\aT   @ 4  aȕ* "`2 @ ǒ  @X"aȓ.`  2 a   @L    @P"Ё`  ? L??c?/'А'''???@w'@P ~"Ģ' f!`b``@^  L????⠔ ???/'''''@P ah`F\T@ `aB * 2` @ 2 2* @ * >`` a !h F\aT "``aB * 2` @ 2 2* @ * >`@ B@(  $@-@ @  @ b  @ͼ"؁㽐 ~!h bF'\!T@P  @-^ Ҫ `̀ ˺h` 8ǰ `F\!T@ -`-` (  ;   p   @ h`F\!T@2    @h @,`8: 2   (-``*`"" -` ()"  @ : C 0>  h8   @ 9& hF%\aT  p-`@`+` : h F\aT ړ-` p :h F\aT 0 @: C > h F\aT "00;   ;  B> h`F\!T@.`.` (@ : p `G %h` 8!  ` P@*ՐG  %\F!T@2   h2   h2  h `0 F`L!Te\ e8e@   @@ @ @ h"@Fېh`0@ h@F̔"``0# xb@F "`0   , h`F\!T@.`.` (@ : p @`G %h` 8!  ` P@*VG  %\F!T@2   h2   h2  h `0 F`L!Te\ e8e@   @@ @ @ 7h xb@F\  "@!`"  @(# @'ِ#  @, Z  (.`-`"" .` (+"  @ : c 2>  h8   @ ;& hh F\aT  p.` -`@ :h F\aT ڗ.` p   ;h F\aT 0 @: c > h F\aT "00;   ;  b> h 8@+  ~b  @ɐ#㿘 @C!` x x""&@&` @ ah`F\T@ (: ph` 4@ܒ   ? @E ` `4@ # xb@E b`4  @  , h F\aT  @6 !h e\F!TȀ2`@0g @ ? @ I\ @@}" "    ` @*   h e\ F!TȀ. 2 !ȓ-   2 @qh F\aT  6h`F\!T@2ph`F\!T@2t@x@Qh F\aT "&p&h F\aT "&t&@a㿘@3!F\aT ?@M2@א㿘!`` @DŒ  ?$, @] 0?,@D  #,㿘!! ?"@'5$!㺈 ~"`$' 2&`$ &`0ah`F\!T@2  >`h`F\!T@< @@h@e(@1hh e(Fe\ !T : 8U h   8M h @Fh %(`h%\F!T@2  h : @3h`F\!T@@Do h@Dj!h 0F\  !T::`@@+;B F!haT X2e\e8 @  :@L@ C 8T @( @ &`( 8&`(%\@2 : "N`48@Eސ: )>  @2.N`4 2@``&=`` @)ے$ #`@: @%# 2.`@ `e\`0@E: >  @ǐ# @3"a`%\@2: N`4 >@`@ u ` ` hF 8T&`( 0*` * %\@ : @bh `07F: T @; 9 %\@2 2 N`4 @"N`4%\@2: >@`@U "7E 22 4 `2-`8`(@b>  @)G$c`@@$# 2@`%\T "  @b>  @5# @"a  t` @*;  @d `   ~"  @##㷀 ~"ĮM4' 2 J'@ 2 ~!l'@(   !!h  0@%z 0` : t@)<  F@B@&!h  `t:   @ !h  `tF@B@&ؖ b!D@N !h  t@ I@F!T.`9 %\@2 ``,`  + @ $ $@"#a  @#`,`"@@)#  %\@ ` : -` ` t@ Ǩ a@%` @6y`!h  F%\!T@ 2 ``` (M4@ @ ! %\F!T@: @`=$ "<B`M4 264 218,@b: @($ #`@s @#Ȑ# 2@Y%\F!T "@b: @# @k"a`  f` @ `  ?%` ~  @#㿘% 2$ `(! aa2a@a@b:  @ 8  !h `8 >; @ @  ;B  h@(  `h 8  :`@#@ڰ   :@%  =@(\ @Ce- :  @ :`D @ D h2s @(p  @ =F 8@(9 @CB- :  @ :`D @ D 2 @ (  `h  :@(  @C-  `: @ D @ 8D  !@"  @ :F@'  @B-  `:  D 8 D  ! 8@F `@ F 8@'̕8426 2 `,h = @';` @B- `: @ D @ 8D  !@ǐ X @ F  ! x @   㿘 !`  ! @ג!D + ahah `x ?!ah    :`@@ @'h @@~ * @Bn   D:` D @@@n x `* aD  ?" 0@" $!x@@X @BIx%Dah F\aT x@! * x@! * 㿘! ` "!!` + ! @eb- Ph`)"༐ ฦ %" @@: @&`  @@b* @B   :`Db  D @@@ x `*  d@#D "@Ĕ ! " %bc!!H@$!H"!@h F\aT @ !"@㿘!H """D"b V"!h 8e<F`H e\T "!22""ah %)"@CX$ @9\F!T@%!**"!   $ "a""H  @:a %H !@  1!!`㿘!!H "$!H@;T$!H㿘!h 0F\  !T::`  @@&^B ` 8 `,` ( 0@:] 2 !@j!"@Ԑc* `$"$ $ $ $ $ !h $ $ e\F!T2  $ $  %'3 F\aT +  (+  (@ : p @ : `   !h` F Т!haT  X  `%\@+ : @;@ ` @`dc@;,` 2$ !@!8&cc* "  $㿘"@_c*    !   2  !!X@ߒ㿘c  "*`   @:c?@:@:c$c$ * 㿘 "aF\!T@ <  "  !  !<  2 ! !!x! !!p@Ғ@_ 3a  !@ ! *a  !@X!aPB:aPaF\!T@ c(@>k c@>e!    * 㿘   2   @>O 㿘  "  @   2  !` 8 &   㿐 !!@ b!` ^G !@! ah`F\!T@2  p@] !h !@!!h`F\!T@2  p !@א!!h`F\!T@ !@͐!a  !h@ !@!В!h`F\!T@2    ! @!ؒ!h`F\!T@2 , '@u !`!@`㿘 !"@ !@"`  `" ``  `  0   * *  !"@ `㿐!     ``]  !`  ` ` @  2 `!h @== ; @$=  @?$-  : @  D @ :`D @ @"U@  ahԀ "ah !"0@|ah @2 @"U@"\ ah @  *@ , < @ ?@ $ (@  @    *`$% @  *@%@" $ (  *` ah F\aT @! : < pah`F\!T@2  p ( : ah%  t@ ah @  H*@@=J'$ p@=?.$ tA$ R$ c$  :s< : |$ h F\aT 4ah F\aT @=$$ ah F\aT @=$ ah F\aT "$ d$ X@ah`F\!T@ :< ah F\aT "$ $ Dah F\aT  :< (ah F\aT "$ $ @ah F\aT  :< 0ah F\aT "$ $$ Hah F\aT 4 :< ah F\aT 4:  : < P`B :P!`6`  `  *`  i???ؔ ????/''?KaF\!T@c(@<  0c@<!M`   *PB?:P l m$ m$ m$ m$ m$ m$ m$ m$ m$ m$ m m$ m$ m$ m$ m$ m$ m$ m$ lH l l m$ l m$ m$ m$ m$ m$ m$ l l m$ l8 m$ m$ m$ m$ m$ m$ m$ m$ m㿐@r+ *!'% ;; !9)7 !5 x/ !#!J- ! +BZ* @€a >%a !#,Đ b@o " !@x0,Đ cc8@a ''#  #% !,P m@T p& !@#X@Zp a\,!H  ,a\ !H,a\ ,!H h  !@u#@r?? ~ t*@  & @$’  |@$ a } @$ }@$    ?@@`  @F ?b  '@㿐@" !J  !#ؒ@*㿘  !@c "    !@c 2   "@` "    "@ڒ` 2     ( ~"a ' }`@$Q a@` a  "@% @ ? aa  "@  !#?"!@=?$#!!? @=?$! y " *ah  "`@ @@ " " "@ X "@ p@` a  "J#耢`" " "@ΐ  "@n @ a  "@f @a  "@^!@ )a  "@V!(@ a  "@M!P@ 9h8 ; @!@ aFa  "!P!T#\@!p6`.  .`@B2`* @ *`B2*@ *@;$@6`.  @.`@:c3`+ 0 B+`@D4`, ,`4,@ <@@  @Ԗ ;` "!#\@ ``?!P@  b b ?!P " !@ڔ `+ -/l9!h,<8@ 8@ c !@ D4@ D ?:@=b8 @ ; D  ;!@ ;`!@ F b@ d :! "!@`  "@"  ' "% " ( @  2 @|0c  "@v"8c  ' "% " @nh 2 @h0%c # %a؀  @z ah : :d0 + 쀢 4!hJ 0 `,6* + < @ ;  @;, :  @ :`D @ d@D a  @ `,& a耢 *K#@lah@4!@4'!!@4"` cL@4"@4 #@4`a؀ 9a  "@"p耢  "K#  "@"@  "! ""@KC a`@@  !#"'''@F˖   a  "@Ő"@o°  ~  ~"  "@Đ"㿘!!,@:!` "@ 7(   `!h`, /53 y ``@:y``@:t- `   @:j`  @:d-  @@ @  aЕ<` ` +@`@* ``,&`h 4?L@<  @@  aЕ<` ` +@`@*   hbD?? /'?????`,]# :P:&`G%`U! a`@:N`=  @;  @:-  : @  D @ :`D @ٔ`e\2` x#-  " @  %`@`@ ``,&`w&`㿐 ~"Ĵ' ah`F\T@ < @`i!h!h F%\aT UcP(@8g 0 3 "cX@8_ + " ' " @" " U%\a ;``p@8G `  "`@8?    "  " ! "#@@ "@>#` ϐ!hF\aT c(@7 0c@7!  ``* `0Fe\ !T:"a@ B C?!h`F\!T@2  &   `-!h`F\!T@2  "#h@, - :<a $ <@2!!h "@ϐ#x !h`!h F\aT 4 :<!h F\aT  !o4!h 0F\  !T: :`@@B @@B ? `&? `\-!h`F\!T@2   "#@ŖK-@@((@-!h`F\!T@!h!`!h z`8x!h!h;s!h`F\!T@2h :@c`!h   \F# aTd# `(:   p@_  @@ " "@# `!h`F\!T@2 *!h`F\!T@2  " #@L!hF\aT  $h@6b(!h`F\!T@  <!h e(Fe\ !T :8(!h!h   !h!h@!h e( :-e\F!T@2 h : . @)!h`F\!T@2B*2B*2@  -   !`t@7Ò?   4+, ,  t`(F!haT "`%\@2 :@ > #`e\9:     !`t@9O   ., ,  Ԙ`XF!haT "`%\@2 :@  #`e\@t  #   @ !h aP`%\B FT;aPȀ . 2 !h`F\!T@T  @ @0`  2 #@   #@ 0 2@  # # @@ ``H# ""# "@&!h`F\!T@2  @ @@ @   @  *@ )$p3$t @  *@5` *`  *!h`Fe\!T#!` ? 5`%\@$<#4!h F\aT $E4  :P:X&`%!h  4`0@6:` &`0 e\FaT  : h:    !he !h ]Ē!h`F\!T@2h #`0 P@   # #@ 0$h@E @֐!h F\aT "`0`0 :<- # @ Ӓ @  *@ "@##`  @  *@!hF\aT c(@4 0c@4z!  #@U 㿘  (^ / # `P `B :P2  (` ( (  #@  !` # #@  @ΐ 0  @m  # # @@ ;`H ($+- #/ #3 #)7 #   z , 4` !K@ `:  < ! `B =! * ( d AaX `B =aX   #@ 8 !` #@}0 N @ @@ `H@.א  2 #@ !@k0 < @  @@ ڒ`H!`:#!" "@""@!!@ !`2@` 2@!@2  0`2#!` " 0#! 0`  D w& 0㿘!!,@5Y!l #@h   `  c?Д? 'Єh/?????c`, y   "ah" ,  `@6 +)h %al~   ' @    ` @  `,&& 㿘 (  ;5*  2 h/ +- # a a Vah < : $ahaa 2 a h@ D? ː   |  L L 㿘!t #ap@N   㿘!t #ap@>  @3DP ~Ġ '  ?`} c# *` € #@ " #@@"   @ߐ  # #"(@ b0 Ɣ!퀢 i  #@ "8 #@ Ґ"X #@'"p  #i   챔!퀢 T  #@ "8@" 2L @  # #"(@ b0 #@ " #@"p  #H   쐔!퀢 3  #@ n"8@"  @  # #"(@ bb0 ah F\!T /3ah F\aT  3    #"@ A ` `  *`#!ch"@x "c  *ec# y?c:<?  "p/' ?????؀$atF!haT3 #1 #t  `%t`!a  #bؒ" #$ @" X `%\@   ; ,I ; B $@ J#耢` b#@ "# +;  ;<` # #(#@ "#a  #@#P a! >`$  #@9#`  `%\@  ;  @1!`e\7`%\@  <` +` ,+``( " %\@+` ( @`p@ <`  @*`` F!aT `X`Ж \+`+`  <`` ' ~'Ф*Cc#|&K%t+ #) #'1 #/ #at  :$at  "7  2?0   #h'$ @b %#x   ȓ*` ?2  @b #x ȗ*  3  ȕ* ?3    $ *"&㴑* @  `"   "  $  $ " *N b  #@#x! ~Į   `'" 0 !`    @ 2 , 0 2 0 (! ##@| 2#     # 坒c  #$@)" " !`"e 0  ` # 剒cВ  #T,  #偒c! `' // /#@)!  ?   #cx@9  ##@2 0 6,  $@ 0( 0 "7@0O #7@0H 0`& 0 !ȕ* ?2 @0 #4@" "  0 4: !' // /+ #cx@͔! 0  ?   ` `@@v"@74 0 & 0 !ȕ* ?2 @0T4 cx@ 2 U$  Q $ ݒ``  #,@i" "F E  #c@   # ̔h $ x@?  # 侔h $@ ?$  #$ 䱔h7@/ #@2" "  0 & 0`!ȓ*` ?2  "  `( 0L .2%!`2L   $|` #$@ " "   .2  $l` #$@" "ܨ ݰ & 0a`   $  @ ` c#$*` € 0  $  D $@ː! 0 ` @  2 $ !0!` J#耢` $!8 & $@!``=!h FaT\ @  <    +@ <  +@ h *`\F!TaȀ2@  ) 0 , ؖ @$ @$ $ $!P`@!` $ $@!5 @P!`0` 0  $!`` 2`  $  㬔` #" 2`@., " !ȓ*` ?2  $!@ `2$    $@i!ȁ@((@b  ?4  `  㿘!x $b@˔   㿘"*` h y!H  ^"-x %x P? ) ``G @  @?  @  2 b  1     @  $  Y !aȗ*$ $  ?3  $  $ "      *j㴘x&  ( 4 㿘!| $aԐ@Fh   `  ?ahi?Д ?????/' ,h y#\   @ "`ah  @/wc,`    h` ^  ' @ `Ph#D*` €!ȓ, R `>#  ?2# `"  @)=##  $bĔ , $b쓐h F\aT 2     $  $  $ $b $b   $ "@P ah `,@ah& 㿘 (  D)/&  ?3 . 6`  Ь >  J@ `: $   2 2  < @(% 2`@Е>  @  +* +@ B?=`F Ð 0 $ $ $ 0㿘! $a@I   ?b ~!h`Ēa '?#` @-$c?b@ "@X $ !!  $@#! 2 %$ $@8#0 "X%$ ,` "aXX $  $ #H    $#P o `4 %$P@.D, *  `,`: `,`: 0``:@`,``:  ! ! ! $#X@=%$!  $@ #p 4!  $#@P@., *  `,`: `,`$:  `:@`*`: @L % h* "XL? ( $L?# T# &@"U$?P?"":`# %P?#a"?b!@`"@h`U\!@  $\$T,  $X@-P* $\?" `# ?\:`" $`? "?:`"  $d$  $h$ * @$l`:@`,`: $d@\"Ud?$#"@ ?## "@#?#  @+?!  "  , 4$ $ 8?  ?? ? ? ???? 8<  ?< 6, aЕ<  +@* ,i"!cP y"  @  "a?`   ;`@#! ! @,/@  : @  D @ :`D @ Д@"U@ " Ԁ  $#@P: @Œ @8E4 82<@(8$$ <,?@2@d44&@$$ $$8@.s $p$$$$$ (@6$($(,`&$,@6$,$,$0\F!T@24$x40`&@&$0x@($x$x$t0  &$0@"U@$4$8$<$@$D$H$L$P\?@* L2@"U$@,Uc/`   ? "` /`6" @ ` i#8*` € $ @bU? $ <b\  *@   * c $ #@Yc Π ` @"U  <b\ *  * $ x  - @"U# @ < E 2*@ aБ:J@ : 28@: ` +@*8 ܄8 $$`$988@-}l: 8@-w   *@ (,&$$$@"U@:c` 8 " $  : :@ 4@ 8 @ :E 48@88$ 4 lph    @  $4*   #  (  p瀋@ %?$4*  # %?$  ; B?   ; B?    ; B?   ; B? L@@)Ԕ   %@ɒ`  $@h$   $ $$ * X @);! ?@) ?c  % p@`0  ?#@)!  *` J#耢`?b@@ F?@"U\ \ $@"U  3 %,."`\ : 2 `@*@`H``? &?" 6F@"U` ` $@"U  3 %,."`\ : 2 `@*Q@͐`p``?"€@"U@\@"U\? @( $?c  % 8@ڒ` @"U@\@"U@\?# @'!  *` ?b@,@@&L y?"?%P#?"c@( c %@` b@@ @(-Вh-Ґ *`  ~  %@  x x   x x㿘 ~'H'L'P'T'X#@H@ 㿘   x#` x# %@ @   x#`  %@! h  x %@!@ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘@@ %!8㿘 'H'L'P'T'XH@] (@ / @ <   L` r`@' `@&㿘@͒ / 1$!@&, /, %a@$@n!! @j$! H x"#! %!H@  !H %@)!P0E@ = '< @@#0@# %#@  ~ %@!h!   %@!x@ `ˢ @( `2 㿘  %a@5 @!  %a@5 㿘` %a@5ݐ @#   %@" %a@5А 㿘@  %a@5Ő 㹰 ~"Ja?*#""  '@   @%@ %@# <    %# %@8#Ȁ " @  'c@@ %@q#ְ a   %#@fJ!\` @f   &a?`&a %# &@P   &@I ??"ah"!:, :h$   ,` $`@!N$ @!K  $``c &S @ "" ("a"@  qa y  2v c@ n &@ H i %#tah ,@ @l%!   4@20 A &, $D ; @ < @'’, :  @ :`D @ @ D %!@= D &0 & & & & & &#\ h`Ș @a  &!!P  `h  &J@!xh  `р  &! &! &!? 2h &!h $81 ,5:a @'d  0*@ *` t  :` :"`  @ C<` @ E h  ` &! &@ "`2h " , h  <`c &"  &@"2h  "`<, h   @  &*@ &"H  " &@'"p    &@Ր" 2h * , h `0`H  & w" `0 "`H &@"p    &@" 2h * , h `4`L  & T" `4 "`L &@"p    &@" h * , h  P 0,@ @  & 0"@V 0?`$ P &@"p 2  &@j" 2h* , h  T 4,@ @  &  #@2 4?`$ T &@"p 2  &@F" h* , h , $H0204h0 &4#( `:%0 &@p"p    &@" h * , h`F\!T@ x <(@ &#X``"%( &@K"p    &@" h * ,` h  H8%8: @ %< "!h%< &#  H8  :;%8 &@ "p    &@ΐ" 2h * , h  L8%@: @ %D "! %D &j#  L8  :;%@ &@"p    &@"   * ,   &!8  ::8 L8  ::@&!쀢 2h e,. 2  & &@~# + +#h` " ",` <:%0` "(`H8  ; 88` L8: ;%@*` +` 쀢 Sh eL2P  2  ' '@J H   Xh "X #%L "P#\"eT%`"X`eP@%`, *  ``,`: ``,`e$:  ``:@`*`: h L%@  $` * ( h `eP@%2, *  ``,`: `,`: e$ :` ``:`*`: h``Le@ B;   "Dh` ' p``eP@$, *  ``,`: ``,`e$:  ``:@`*`: h L%@  $` &@"p    &@" h * , h U\a 02 2 h` x@ '1 ``" x &@"p    &@n" h * ,` h U\a 02 2 h` t@ ' ``" t &@"p    &@E"  * ,` L !`2 hh  @"`ha@lh  @  "cL cL 2` '`@g 0ɤ : 3 '/ %5 '7 % ``0"4cL`8@$: `d: dH@ @2B c  @v 2 `@Ȁ  @ ]`  0  Ϫ``B 6+ `B + 3`@; B: 2   B*2@ *` @C "a '!@0h!` @6  "`!` '!8@`0Z!` @(   "a!` '`!`@*`0Kh` ,@! $#` ',@ڐ!0<`# b2 8"@ "@b` ""! $"@  "c" ' !b@  "cb '!@*`0@h e *c*# @   ~"  '@"㿘! `  :`!hc @ 2I  Fe\!T@OU!@K 'b %#d ?6U!ha 9 75F3@@!@%: 㰔@ Te\ 2`  < c耢 c쀢 cd`@?ר cd-  2 'bah $ :ah,   'b 4\ 'b8F!T@ah @"     ' , @"?  'bPah h  'bh0@2  'o@@$4 'wb2  ' 4  '`& : ! 'eb!̒: @ `d `4 @$p*@ : $!̐@ԒP=ah`,%`?  ; @;`  ,@"*@  : @  D @ :`D h@c 2]  @ $ `+ ' '@"  h ?' '  $ @q:`  c@95 ahF\!T@*  ::0`$ ; ;d8(88@`;8`0&`,#&`8&`@?@@!z&?`&<``* &@"* &|?@#(8?@##@!Z&@!T@#&@Z?@V&,`&d <`` &dP@!;, *  `,`: `,`$: 0`:@`*`:  8`( ( `(`:`: &&`( "!́㿘e!`e@ڔ! 6!  @{@. 'q# '#0` 2v `  2q ` 2l ` 2g ` 2b ` 2] `, ,2X `0 02S `4 42N `8 82I `H H2D `L L2? `P P2: `T T25 `` `20 `d d2+ `h h2& `t t2! `x x2 ` 2 ` 2 ` 2  ` 2 e\%\  㿘!h F\aT < @  ("$ 4 0" 0    ` h`F\!T@ (@P P 㿘!` ( ( h (`@8 (`?@: J!\` (!`  (@) ]*cJaH     ~J!\` ~ (@ L #`+ () ~@ `@ ~`$@   $ F.#   ` " %   ~`? "`@ 2 y Y n N˒@֐ y Y  -H*# 㿘!h0"a@"Ḣ 2 ( !??:  ""* $ $  0@!X($  1 (? ?ǐ Ф$ $ $ " $ % , <6a@ (`@`0 `2 @g@ea" 㿘!`'!d@S  2      2`   2  (w @    $ #   " $ $ "` "  $ 㿘!d@  a@$`"$ @G& & >㿘N` F` !@ `2 ( (!0!8 (@T!`@.` `@&`!h@( ` # '`#L@@ 8$H d@ : @C   0"@` 0  㿘!` (@  (!H (e  (א!`㿐 ' @a   !@#?$# @ܔ 0!hF\!T@ 4" 'd<"`$D"(dL"`"c"`"d "` Ӑ *'@![hJ#`(#a̒: @vh h  !!`2! (!x  a̒: @\=h! , 0!!,! !  @7! +`'5@"a!` @ `@ !a @"$ ("@;!  %ah  `р!` ( (g! !Ѐ " h` * !*`  !"$#*` *  b @*  ("$!@b @ ?!@&%! @ 㿘!̮ :`@ @i   ("  (@, (l "@N 6 ("ڔ @ (@" L '; (@ =@< E@ :C  @%  !` :`@I@ ; @B @8F (@XbH @ : F @LbX@ (@C 㿘 e!̨ :`@ @ٖ   ("e  (@A ( C"aؐ"`U@ 6 ( ("H (@"h ) (#+ (a̐@A̒à  <  D @ :C  @ !@ : F @bX!̠޲@ (@ِ 㿘!  !h `8@   %!h`8   3/@ Г: J :2  : J :!Ж   : H :" 6h@ @?<@c<  @l,  : @  D @ :`D  E U " #Ԁ  ("ƒ@ #=`U%  Е:` `(  *   @:  ` ` (*@ *`a `8B@ >a ?"%  $"% $``8"@n !h `8 !h8; ; bSP!h `?'`  y` (b`     ` ``  (b@ǔ0L  ?? $`/'?????# .#'X!''ܐ ''& "@d&@@ / @ .@܀X! (b''' X$` ?.@|@ǔ" 㿘!` @ 㻐# ~bĠ' (В$@@$@@S  "b @ b  (@#㿘@u@  @  @ @u"㿘 $ '   ! (# $N 4  (s #!`  ( (@C#  & $ #0   & $ & $^#8p ~"Ħ'@u y '€$ ! (#X@"   y '@ 'Ԑ  (ch'''@' (` '' @@0@u"  (@#p㿘 8 y$/  +-.` ( (㤀  '; ) @@2  8&/@/ 8 /`/  8܀  8    !* * "2@: @ *  (` @*2@: @ *  (` @2@: @ +` @ `? 8    *#+@ *+@ 2@:  @*` * **2@:  @*` *  *2@: @ +*@+@ 8     #+@  +@ *2@:  @* * *2@:  @*  * *2@: @ +@+@ 8 * * `?2@: *   *2@: *  ( @  `?2@: :   㿘@#  8 8 8 8 8 8 8 8 8 8 8 8 8  8 8 $ 8 8 8 8 8 8 8 8 8 8 8  X@,  @  ~ )#@Ya@ @u "  ) ~ )#@Ma@ ! @R @y 6 ) )@Ӑ! )@&:"  ) )@ʐ"  ) s  )!| y "` y "`"@@ )8@NV逤f ~ t" )@"X#| @R   #\#`#d#    @E #\   #В @< " @7       #\#l;p;x #`'#d#h#    @B  @   ?''' @  @ܐ @d @b @`  y@ @ 㿀  ?''L'P'T'X'H'`L?`' '' @  ?`?㿐'L'P'T'X'H L?`(@s " **@& ?㿘 'H'L'P'T'X@vH@φ@} 㿘'H'L'P'T'X @fH@vx )bt 'H'L'P'T'X@ @{H㿘 y  `" @㿘@) )ܐ"@E @㿈   ?'  @ ? @s?@د )"㿐'DD  ?   D@ ? @r@ؑ )D"㿘㿘  @s  )c@˔ 㿘@O@ @U ? )#_@5 @5? )#(U@+ 㷀) ~"İ'% )X$@ ' )`$@  @ ' )Ɛ#h' @]  ) )'' c@se#x@,# )c;`''@"Xc2X@ @ % y ))#? @  ?B$ ( y?@ؔ ?@? @rb  *% 〢   * P@} ? y 2"    * *ڐ x@Q @  !| y " "  *@ ȁp@x 4?  ?ؐ ''' @.  @*  ),#h y 1 * * ؒ '耢' *  '' @ ! )@~#X * #X{ @Q ? * ) *!cX? @K  ?@  \1@A ?@h?@q  * ) *!8cX]B1׀  * ) *!pcXN@|~ ?Ԑ?Ԑ     y "@?'@+V0 * ) *͐!2 21 y * * )"!ؒa@i1#h!|㿘1"0 "  @ "  @qn@ *!    @ǘ &"0  @q[ @ *"㿈 D"0 '''' 'D  @q>D@ * "(㿐 "0 ''   @q%@ָ * Ȑ"8㿀D"0 '' 'D  @ 㿘@ 2  @   # * @bH & @J  bH@ , &  㿘@;   " @5@3   @-@+ @)㿘 ) /  +@H , @ , &  * *&bPX@5 ? *b`@#. @    & (""(& $& $$ (㿘   *@@  *`bp@@4 ? *b`@# x   $   *"x @Ͱ %$ ` !   @@` $  *" V  $   *" @ $  㿘%(    " (P ([ 2 $(  1!|`d 2@ @1 H㿐@s?  * "0' @ː @I 6  *# @|@  *@#  @` 㿈@ч ` `? @??@=? ` *#Ps? o@|@  @s?0b@pO 1`  Z$`  W$` "1`@b` @4!?@o @o @o   *cx@9 @B@  *c@9ڔ @:@8@  ` $ 4 ` *`"#@  ` `@  ' @3 `@| @` *@#`@А 㿘#b( 4H /o   @K # $  $` ("`($b( (` $"`$c0H?2$ ! y"`@Ɛ $ ?~(  | y  y 㿘! y$  "(@Е &  ( "1 y  2 (?2& !$  1 y @|W ?"  ? y 㿘'( D  ?&  ( 2 0;  ( 2 @1` 2 (  &  * #Q& "     ?&   * ="x   @yj& 0Β@t (@"( "1 `2 (`&  @yQ  ( 2 1 H(   (2  H  ,㿘 y @ @" 㿀"(      @y $  ( 2 @Hِ  *# + )!ؔ@+` 1 * @ ?"A @?; )  ? ''' @E  @A  )C#h @ې ! ) * `ؔ ` @z#X + 0#X ` @s @{x 䀊   2  2  + y @ "   + ,  @xǐ??#@m & y$b,@ m ? @{S ?"b,{b, @m ?@m "  y  $ + +h P y@2 1!|㿘@HP "(`  *`  "` `(`2`  * + )!ؒ` @㖔  + .  @xw??!@m "%1$",@  ? @{ ?"",+", @m ?@m   $ + + P1!|㿘@ (   @*`2 㿐@  ' @ߒ @ `@ 㿐   +`@z "L@ " n L` o `@u = ", `"@Ր 2  - + @ @ @` + +   +`@̐  2 &*@ &" `Д@  "(&@ "$&@@l"@H #  +2&@@l "2 &@ +`@   ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` < L ` ` `   ` ` ` ` ` ` ` ` ` ` ` ` `  8 `    T  ` ` `  ` ( `  `  4X ~" + h '@Ja ?    y""P"c"@ +!@'܀  +! +!Ȑ@F??`5!*`   "c! ;#    @ y"( +#@~!`! ;#   #@" +#Ӑ" ;#" ! ;#  @@ܚ y"0 +#"! ;#   #@ʚ y"4 +#"0! ;#   #@Ƹ" +#"X! ;#"  @@Ƨ y", +#"! ;#   #@ƕ y"D +#v"! ;#   #@ƃ yy"H +#d"! ;#   #@qg" +#R"! ;#    c@` yV"8 +#A#܀   ; y y#a/LG`! ;# +@c #  y y"b@8"< +@c  + y y""<-"b@#@#()` y $"bP! ;#  ?@ : +##h@ ` ;# +c@ڼ 2 `@` ~ t`*`@ & #ܐ& @Ȑ @֒ +В?@S +c܀ 5@ @ + +c@ڇ &cܢ +$@% + +㰔$%@ @w +㸘$@@w +cȔ@} c܀ ' +c@Z "X @ޔ!  " @$.''''77ʮ?''77'7 /7@z / ! +# +$c@  @؀?2   +c @޴$ # M?@#  6 @j@6 +#@ڒ@Ւ   ) +@j@' , @˒#@$   %c#`@   r,``@ޒ  @ِ   , @!'c܀ #` "@c 2  ,`@ 0 @Œ 6 @jE@ +#@|@ ؀ 6 c@j6@ +#@mc܀ 2@!<   , H@^   , `@2ؒ@@Z ?" ,J?`` !    2 ,@@7 @M  !     *: :` @  B 2 `  ,@ @M `  ,@ @ M##`@2 ` ` @  B;#`  @ @B #耢 2` #܀   @C  , M!@@ژ c؀  % y ( "c ,@@͐!P% y, , `  ? *`2 @*& &,  y ((*($, y0 0 ` 2   *@ "0   y",*  4 "0c  y y",* "c y"8 % y<   y"@? c ,!p@1  $<c H y"(  y"02 "02 "cH @ #\ @ 1#  @ )  @0# @@@] 㿘e!`e@0"8 6"83`  `@b"  ,`@' 00  ,@w@! y"X@"8㿘# 6e6 e`g@  ,@w%! ,!@㿘'H'L'P'T'XH @    h  @Ŕ @ĸ @Ȟ@1v@ 㿘#܀   h  , ~#@ݤb0  , ~#@ݝb@ % ~'@h``,p`  , @܂@ @2 @hw"  ,@#؁ ~'D''H'T'X @ %  $@@  "`  ,c@ِ @܀ )#ؖ: @#蠒   @h@ " ,c@ #\   @ 1?"# ,c@  @ V  yb("` "c耢 c2 y   yc ,c#@А  y( #@ ' -` #@?' ؒ@ B? y"0 y y"D bH L   -`@@  y",  -`h@ #؀  -`@ @ -`Ȕ @  -`@~   -a(@v  ; ;`8@8 8 88 4 H L 0@ "`P@ `4`0"`T:  "`8 `4;  -ah@S @ "```4@@  @$ d<$8@ 4 y(e`$ |$ $%\$ X "$%P 0 2 2 <#$ t $ x?$%,$%( < $%,$%(?$< < " " $" D" "#X" " @"  0 2` @2` x$%($%,<#$ t$ x+`4? ; @  B @ = @C8 ; @ B <@@p  @?$?@;@ r0@+ @ *` :` ; <0$$  ` t @M;  %0@B?<%0# 4c" %c! +cT:@& x@ A d8< )d<  $<) `x`` : @ $```8@@@ @ !$`$` `?@ ސ`x?@ ِ@ ``< @ $```8@@@ ˒@ $`$` @ x?@ @ P, @ $*  `,`: ,$: 0``*`< , :`  } 4 y c -!@/&+ yb4#@   :`@$8 4)   ) 8@ j$x?@ e@ b4@ 9$<`8@Ģ<41 2 @ + `eP@ , *  ``,`: ``,`e$: `0``:@`*`:   ) () ``8"@ $``x?@ @ Qb4 $` -!@.  & % @  x?@ @ 9% %`?  ;`; d8@ @]C$`,`x```@ : ``8@@@ @ ; d8   d<   -$8a@t    $8>@4 @  @@2 8+`  -"(@.M y( `` |@  $ ``,"`"`"```eP@ ҡ, *  ``,`: ``,`e$:  ``:@`*`: @` L%@ $` x ` @ r:   ,%D*` L @ @; $ <$H$ @  "` -b@ `3DL%h "h"h y"8 yc < ` * `" <" \" "":$P"$X*`* "%H`@" `*``"`  4?@ .   $8:`  ," d@ [@ : d `=$@@d 8 @ @ :  d :` =#&:  D =$@ 6? >e  =$=$@=# y :(=$0$4% $D$L% (% ##% % $$ % % ܀ ; y`@$8` -48 "d"D@?xx? ؖ  -H#\@r ` -  4' 8$"D@ ?x , -x"?@q y( % @ # ,c@ 'c@ : @%\F!T@ ce $%\@ : @@`7@ s#: @ yb( `F!TU!5 yP "\ -@q#0܀  @ bD@& H" @ ``0#@4 *`*`  "c"#!#@# $c -c0@А &#@ `@QcG`" @ՐP 2=% ; @== @ E- :  @ :`D @ d@9D  ' -P@ْ d c8 c? -& - -@q;#X  -#`@q6 ~@#`  , y"P 2 -@q##X# #܀  y@  y( TX@d\  -ch@[  #" #$" $ "  " @ # -cx@H #` @ #: @` "D` T= $H :@  d@ĐC  0"   @` 0  `D *` % 8 4@  @@qG?`8@qB,  D ~*  2  -@#㿐'< >@h 8E 4  7<@$87 @N;  @W. @ :  :`D @ d@LD  #@ Ж: #袄@ D #  @ -c@ ( @.  .@' @@ @!@ @@ %@$@  4?@ ؐ @ ! .@' @  @?`U":"  "t x *  4 ; yb(&@"x"`  ,?2 22   ""Tv:2"t"xഓ*``"X഑* @"\"\ ` `,` \: @# ``,: @# d` $` -c@ %  #   @"U@= b\  * @*  ` ?"`  ~' 8@ O% @bU `@V  b(`]" `d`@ 6- * @"U@TT @ " bU " X`d`@ -*    @  d @ -@F%P* 'eP $%`d`@-@`@4``d`@ڑ-@`@(`@`@!eP@`*  4  8''8@ *$ *`4  " 8@%@ @"U@<`c` ` * @* ``$@ "`$ ~8 8@#` @bU `@`  yb( `^"! `d`@-` * @"U@TT @ "` bU " X `d`@f-* `   @   d @[-@%P* @%eP $%@`d`@2-@J`@``d`@&-@#`@t`@`@meP@1`* @@ 4@`  8 `   ( "@*`4  " ! @"U@=c`  * @*` `$ `  "`$!  @f`%0&' @@   0̬  x*   ")F%\aT @N$ l @I$`Pa?2)  @;  @. :  @ :`D @ d@ߐD @& y"( @  83* c̢ @ @`$ l`x@ ' @ꯑ;  @. : @ D @ 8D d@ = @穐Dc0@ 8' x ` @b< +㾘 @+!#' ''@7'h 'l!@77@.'h'l y"( `7 z   y "@p1: ? @ 4`'   L@@ 8B @ * 2`  '`d+  :@4@ϒ 0 㾘! @ڐ> ?(7?@? @'' 7 y @0": ! ? 4@O ?hhl@   L%@8@ B @ * 2`  2 ? d@ @Q 4@ 0 㿘 #̀"`` `6` @+`?$@a, @*` `2` @"㿘   : d@# @` ` @"U@ -9#   .2 #  #@"U@``` 8 ; @֐ @ `` 8: @ F '  : ږ  . 0@'   ``@擒  @"U@`@#  + `?# c`B?;c ? "  # c`B ;c " y"( !`d@O`  @{;  *`@bU  TT @?" bU  `d@/`  @[; *` ` ` X d@   @L; %P @; *`@ ! eP ;`d@    @;    @3;    @;   d@   @ߕ;    @ڕ;    @ؕ;    D @Ε; %P @͕;   @ ; *`@ @?4@! `0F`4@  #`8` #@ #` 8 @ 8C ` 8$4@"$8"@*`  " 8$@ ;F` * 2`@@ "U@ `   * @*  8   :@ d @ 㿘- y( @)& l@)& P #  :@h d` @ ` @"U@"  -c@ Đ )6`\? "  `  * @*   :@H d @`  B?:?",@8@   .``@   +  :`@4 @ @* * @   D :`D @]@ x `*  d@D  0@"c(   @]`xc̑* @@5   @]`xc̑* @@*! 0@0ć㿘#܀ #ؖ: @Ȑ @0#ؖ: @绐    @( .`@ "㿘#܀ #ؒ: @眐 @0# #ؒ: @犐    @^ .`@ $㿘 8>"># 8 2 8@ `?>@ * @ * *@ `?@*` @ `? .@% Ȱ 㿘 8 >   . 8  ..@>@ *` @ *` * * .@ >@+ * .@ 8@% 㿘 8 >   . 8  . .@>@ * @ * * @ .@ >@+  .@ 8@%a 㿐`h @͔?    .@$!  @ " P㿘  *      .a@ ; 㿘@1 \$ \8 \0 \8 \8 \8 \8 \8 \8 \8 \8 \8 \8 \8 \8 \8 \8 \8 \8 \8 [ \8 \ \8 \8 \ \8 \8 \8 \8 \8 \8 \8 \8 \0 ^( ^x ^x ]h ^x ^l ] ^x ^x ]؝㿘 .a8@  "`4 )'#!% ./ ~57 "* "@€ $( $`$ $ 0 $ 0 $`$ %`4 @@6O@??t* & @ `$ @@D@  @Ð &,@0@@J8㿘 $`   0` , @   @?  @Z ?` K#l*` €$ ``p`! .!H@S @${c`! .`@H!H@t 2$ ``R`! .!H@5 @$]E$ C``@Z`@ <@A}  6$` `  $ 2 `:``@F`@ (`:  @I`  4``@| @j>` $ " `@[`` ` .@i!P "`8@@ 2`:@[N` .aX@ ΐ @?( N 3/ .) -<+5 .@^ 0`$  `$ (``$@#h-% 8  #@ "$ @  4`@@iܐ "`$ @Z`@iRP% 8  8 ~"Ħ' ` ?@ n .`<  "` p   .`@#!g  @E "T .@ؒ?N$*$@H 2`8 .a@ ;  @R : .@$ʐ 5 .  @ @- .`8 @< $ .@$  .  @ @ .`8 @&  .@$   .@@Ӑ  .@h̐!P@ "`8@Ɛ   .@!ȁ㿘@Q 2    @$ﶦf4 8  x 0 ~bĢ '! ~ .aؔ@3#02 ,`_< ( Y@ܒ  "U @Z` 2O @@ Œ @  O逢  .!8 ."! ~ .#\a@#@ݐ# ~ c`? "`@g #  &# `  ~# ? $ @S#  &#` 2 `y `Ybİ b  .@?"㿘 @ %# .@i ? (J /"*@i / J .2 J  .2 J 2    @"Lb $8 `&   &  㿘 h  . ~b8@x#@ɐ 㿘@h@@iQ / `" H`@"HH .@ȿb   . { . b"    .b@ڐ" ; { .#! ;+ ~' {7 {5 {/ z  t #@@3h? f`t`*@`&  @ `  `@ `? `@~`@y@J : $@D :,@@` `@O ` @ '@`% .`Ȓ@ @u 2    " @ @J̰ 6 @X`  { ` .#(@g @   = @`7А @  ' J`  .@c0@]  '  W@ Ԁ  0  a@五 ' { ` . .c(@  cH@   @@a@䛔  .cP@  @  @@ 㿘 {R  T`" .V@2 V  . @e#V  . @&#  .V @!# ~``? "`` * "`V@e#0 @"x   . @e# . #@e 㿘  N   / / @e / @e{u`sN o ~ c``?"``#` <* H$#`@"= <EN * @:`#`` ,?"``#`* $#`@"" ,* : %  ~#` :?`&  @  #`* $#` @"* : 4 NN 4N`#``?"``#` >* $#`@! >㿘 { `  H / ~#@̌` 0 H / ~#@̅`8@֐ 㿘@% "`D /``@  c@g @ @86 㿘 /@ ! h@ 㿘 /`h@ 㿐 {!$`' { / / @` %!$ /`@  @h@ $( /`@ `D @| @  D,@A 2 @ $D(!$ /(D @ @ꦚ  ?"`@@q ,'%?#<'$  @`@d   @?c@Y $' @  @Q 㿘N #  /*`: a @ `  2  _ - @   N  㾐# ~bĠ' /!@ʾ { "a @Rb  /@, 㿘! {!  / /!@=a$! 㿘 {! `  / /a@/!  `P@{`,`  P㾐 ~"Ę'  ? / !@w /!(@ b  /@!0㿘@r@@ @j@p ~"Ģ'@E OЀ E F AА@;$ /!@@OЀ F? {"! @>@J@ "*@ /!H@@Ѱb  /@!㿐`@ @| OO㿘`* :`` ,, `  /!@, /@!㿘@㿘 /a@b @-u 8 a` % ;' /- ~) / p @ 2 /a@ @A!@@@/؀?• mt* @@`2@@@ 5 @@e @?` @`J /"*` @@   @@T  a( @@dZ?2@@cҐ! @ @~ʐ() /,@"@]ې@@UP@L@ `?,@@|N`?  <   / @   <   @U7 " /@c!?Ő / 㿘 h  / ~b@*#@~{ 㿘@ʔ ~\  | } ~( y< P < P `  d d d d d d d d d d d d d d d d  d d d d d d X㿘!@#"#@ @B##,*` @ x* 0$c$`*`@ q!$#(㿐 +`p@(  '  /bp@  0`J@  !J@?   `  'J (J@J`#"֐`p`"Ӑ`p`; '@ 4 &`* * $`J /"@ְ j @ !  @$` ' ' {J@  !J@?   `  'J (J@J ,2E$` 'J  !J@?   `  'J (J@@ސ  @$`  'J  !J?   `   'J J$`$`' {J` /b@  @,`LJ@" L  L`"LJ@2 L 2   /Jb@Ȑ    /JbА @ ` `p ,*` € 'J  !J@?   `  'J (J@` 2  * * @$`' `J  !J@?   `  'J (J@$@J`֨Ȑ`p`  $` /c@_ " 'J  !J@?   `  'J (J@J`;``p /L`c@4 `p 'J  !J@?   `  'J (J@J`\ /L`cH@   'J  !J@?   `  'J (J@J` /L`cp@ @B$` ' ! /%J  !J@?   `  'J (J@J`# /c@ #@^ `$` ?$`& @Z!? $`@R@m /c@ `p'  /J  !J@?   `  'J (J@#@# $`  'J  !J@?   `  'J (J@J  4$`  /c@.$` '  /J  !J@?   `  'J (J@#@ה@p$`  /c@) @UJ@ ;`p`'`'J`  \ 0`@ @א $`@7` ' 0`H@ ?'@b`'@` 'J@  !J@?   `  'J (J@J@ ;<`p(`` @~' 'J@  !J@?   `  'J (J@J`;` '`p 0`h@  `p㿘'D @. `:  h'D \  0`@  DD] D 0`@ DJ Q . : ! 0J [ @JD @D @w ;D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J" `(8]*@ 2J 2Jn*@J` ]*@J] "`㷈 ~"Ē '&  @ &@@  &@@ " @@@ 0a@ @`0 *"0b  0@zR! 㿘 `  y ,@`$@ @h p&`#`&`&`@M N I/`:  \9 07 0*`:  \-"  N` -?@ܐ!0 "N,@N``   @U@`&&` & \2,@ ` 2 0a`@? ,@` N $@%@h-`@ x@u( 2N 0a@  㷈 ~"Ħ'D' ?&@&` &`&` % 0# D`DJ@ 8JaJ@?   ` D 'DJ (J@DJ g  p 9 ; 1  Dw 0}Ds 0 w$Dm 0  @ђ i&@ f&` @ǒDD@\ #?@  0a@ &@'D !J aJ@?   ` D 'DJ (J@DJ*'DJ  2 * 0b@ @`#`&`& @&!? &` @O@9 /cД@m  DJb0@g D V'D  0@y "X ~"Ĥ'N  \ 0bh@I  2? 0.bc? 2N 0$bЀ  !*`: ?   ` ? N ?#@[@X 0b@  @Ԑ! `*??O#`  +@J &@  0@x#(㷈! ~" '@ = O耢  !J?   ` "JJ ?J `\2 J " J "  *J  " $@(,`@l@(  ,@r  0@xB#8*㿐N 9 \ 06  $ / 0ch 0 ` 2&@ 0cH@q &@ &@ &@@w &`ch@`  㿘$ N< 9;8  !+ : ?   `  N& #;2+  N ". !+ : ?   `  N 2+ .  0c@ &`&@Ӑ@㿘. ?* : `# \*` €c, "c, & @I &  0 c@ @l  2 㿘    `,` `*` |@ @' 0 2  @T 2  @ 2 @r $$ $ $ $㿘 ` ,`  `,` ` |*` "   2  @ 2 $ 2  㿘 | *` `' 0   @d @`2 `*` 㿘 +)#! ;'/ ~% 11 ~7'9 1 68 ~* bh@€ %# #@$c# @   $ @UӐ`  ~ 1#@*`@v{ @'[?֐? tc* ` @ @`@ `@  @@`@ 0@ @2@Ò @*`  @L@!@ @v@ 㿘% {D K!  g0#"#b`2` "#!5"` 1@qa  "b@Lb@Q 1 a@ b  "$D`! 1 "@   1"a(@ b"  "c""$D"@V c  "cN #2Q N  nM "# I b"@"b$Dc  "J`# J  n "c  *c"J  " @"$D`s@#"*c #c**"c` #"#c`*#"Ք㿐"`?)'@b`$Ⰰ "M  ! ~ 1a0"#$ 1 a@$#  $## 1@L a@@Ӑ `? "`@v @  "@@b8 # & f @C `@@K#`"  @K%# Q  M%# @e 1a@ @v ~` 1!0"#31 1 ' 1@b` $b`!$&c $#@S!  $@K#@4 @i`? "`@  @  "@@aΐ  㿘@  {<" " ""@"<㿘@   {@" "@" "@㿘@  @Kd@ 1ap@, 㿘@둒  @KR@ 1ap@ 㿘#@b 1x@ Ӡ @$bb㿘 ~'L 1'P'T'XaL@/#    # 1#a@"#@I# 1#@a @th   t $ D | d 4  < 㿀"#'3/c@ΐ "@ `?Ƒ* : `C d*` €`%!#,  +*@ c$E*`#,%c$*`$#,*`c$ * $В " " ``O"`a 1K` А _"`  [  Д@۳ А M$   ?% " @i$ Ac""@ 8@!" " 1a @ "@ &@    @"@ 1` @W!@@@  `  ~`Ж`@_ @  @sx " @ 2@# ` `  ~`Ж`@= @s^ ` 2@` ~Ж`@0 @  2@  Д@(  ?%$  ~Ж` @  2$ @# ` b b ~`@ @@s %,  +**@ c$",]*`%c$ *`c$ * $` $ @` $ `~$@@w"c "s@`p"c `2k@`?` & @!? $`@I@ 1` aJ `@   "M@@Ip@ 1` a7 A@%  1a @  `'`'` '`'' $ $ "` "`"`$ "` $ $ $ ` 2@` ? ` @- @ 1#@V!@`i  `  ~`Ж`@O @ Аޒ  2O$ 㿀 `"#   " 1b   @ ܰ ""   @  c-P? -  @q = ((@(   (" @k  `@ؒ(@`` `   @ "@S (" @M ( ` $@-"@> ("((`  $ @  @ ?2(( "Д$@ @#  "`@("  $ @@ "   ' " $  '' "%" $  $ " $ " %"  ''`  ~`@y  `"1   2- ` ?А & @ث! ? "` @H* @ 1 a  `  @_  "  @H @ 1 aݐ  ?c ~"b  '7' ~?#/- 1, $* @  #b@  @`b@`@  @` @\: @bґ, ` `@"@G`" @G@M 1b( ""c%b 1@q("8㿐 {#H 1@2"H @#$H`h @ǔ  < 2$H <$HN p! ~ 1"hH&N 1@T"P N`' ! `@ J` ` `*: \#``?"`` #`* $#`@ 8#` 1?bX \"& #`* $#`@ \N@ #`"@?M " `  #`* $#` @s  1@T"x N H#``?"``#` $* $#`@U $#``?"`#` * $#`@G #` `@@F`" @F@{ 1b( 㿘,` w@: & \ ?N? a   ` "?N?Ѐ $),`:  \2  N \ &2      $ J &  & &,  3& #(* ?2 (?2 ?"!  $@    $  &  & &#(@ @k @& ,`    $  &  & &,㿘    $ && & "&  @; @& * 㿘@% 1?N  w""  { s" 1", - ?" @   @F @ ܒ " ?"& @ "& @F @ Ȓ& 2N 㿘 `""  2 y  `"]  2  "( @  `Д `@l  2 _  #` "  U # `"Q  * $  &"@  `Д `@F  2 9  #` "  / # `"+  @2  #` * &" $   Д `@   #@ `?#  2  `?㿘  #`  1b%  "# J?` "?(    ;; ##0`c(@>  "  0  # 1b 㿘@e  㿘 "&@q  &㿘@㘐  2@ 1b@I @& & "&@ 㿘 ??`@)    1b@I  "&$ `2$@ 㿘 @ 2  2 1bА @Ij` "`&@ `"@@ È < P X ` H Ð Ø H ˠ   ΄ p p p p p p p p p p p p p p p p p  p p  p p p p  p p p p p p p p p p p , p p 4 p p D p p p L p T p \ d p p l 㿀`J    !# 1"   P ?   @nb? L J`*  1l# 1@,#  1@(#( 1@!#0@ {cx [! 1S#8  2   1c`@+ L!@ {cx C  1<#h 8 1a8J   10#x @zk 8 1'# @穠"@@ 8@@硐@h `}8@! @8@@@@#@G !!h$ ''^$' ' 1@#@-' `8@p`@@q @羐   1#@G @C8@ 1#@GahO`7 @9 8J@ @ J@ /  `@qe 쀤`  {@q1@ה @q)#x쀦 1 #@Gah` 㿘J  #% 1"   P ?` `@m۔? L`* ` 1@G9#5 !8J` @q @{  &  1 @o  @B @A 1@G#0  1#@G!h` 㿀 J`e3    L - L    L  n e  E`2L  k   f L -b L   \  2 6%`63!*` €` 2 () '`%  @Hr䨒   2@F 0  ` L`  @GՔ䨒 6  2 8@F @m$?ƒ?  `*    1@c`   ?$*  'h  ' '' {`h ?" @g`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *`*! ` "`@Co6   쀣 "@` ` @  6&`@@AK`2 @`ꀦ @` @Ր 㿘 J@  w`?   2 H 2 P!"  v ? V       @l ?耢 p  *  `2 ?`2ͮ ̀   ` !!@~/@~  ` ! H@~!@~  " @6}  2  ` 2 X@E ?`"*` €| 2@E `x  2` x 2  {#x@E  2 @E@l ]Z 2@E   2@E   2@E  2  2 2@E{  ` 2@Eu  2@Er :7@ 2!  {#x 2@Eb!*  2@EX!0   2  2  {#x 2@EI!8 2 @EE X  2@E?!P  2!`@E9 { {@E0#22`/ 㿘㿐 2Jap      r7 s e   t    2!  2!$    `"  5`9' "*` €  %  % %  %@   " %  $ %   ` +,- - @j?Ȓ?`'@h " `'@g "   `` * `J`-`+ `J  ` $  ?#@ 2@C!s  * `, ,P @  - "* * `C `" * `64`"%@@@|@4 ` ! "*"h#X 2! 2!  @@  `@& "=`@ Ѐ` `8h  @}c@ "`-+ 21 2) 1-- X(a!А   @J @@C#@ `Lװ 0 2@CM!԰ h ϰ @}-@ Ģ`"  `` @ "`    "@0"+- 25 2  " U`R` 2@C!" 2@C"  2@C"$ 2@C"  2@C" @  @C( @ 2 @Cz"0@@ 2@Cs"8@ 2@Cl"@@ 2@Ce"H@ 2@C^"P 1#@CZ ? 07 " 2 2"`"h 2@CJ"X  2 "x@C@ -X@C; - { " {@z 2@C." "@C'X {@j {@C # "@  2i@ BL5 㿈`  "` H' ''   # 2  - +`9#*` €!  '  !P ' @hܔb2  * ` "J`-`+2 J    !P`?` 2  2@B" @h  2@ސ"ڰ 8@{`/`; 29 =5 {@ 2"쀢 'b@p#XX`@pܒ+ `2 @p =0$ * $ @il` @Bu`ڤ "5)9 27 =@ h$@@c``@z`<`2:`27@{ ) 2 $쀢 '"@pXX @p+ {`2`@p7 =0$` =*@`$`@i  {@B&#P  2"@B  H'@z`  `$ `" `2(`$ 2"`` $   ̀` #Ԕ @3ٖ  `" @b $ `$ ?$+ $8 @@`$h`  2l㿐 H  !% 2" t ? a     !!PF  @g?〢 d * ` %@y@zM 2  `" $  ?$  2@z   $` ?$@z 2㿐    2@@ɐ#0  `?   @6Ɩ   㿘   %' 2"  p ? l  z   ?% @g)(?• n* `2 @G 2 @G 2   㿘 2@nc0 `J``? # 2@@`#8(  {x@f` ?` * `  2@Fk ` #P@Fa  J `" 㿐#`+    2  X#\#`@o0   2 #` #\h@o㿈  1 L -.# !* 2 *: ? a   `  @zx  2  2#x$  2@c ) ' #% 2"  s ?`" `@zU  2 `  2#x@?ް `@fS?ဢ l`  ,`    2c@o # {@?#x    *# ' 1% 3@c  '?  *`" @@  @@   J ` {#cx ' {% 3,`@?`` {@?#u  ' `'@  #  ' ? @@4'@@4 ?  #X\  @g >   6+ 3' 3L % @D 2& %`@bܒ쀢 @?` ?  @  `@E\ 6 `@: @@>H`,` 2L㿘 J `  !@ee!x!x$!x" 㿐! {x@ea ?  * `  3I P  3B pL  @J` 3 @> !h`L`2 3`@>А u  2``?@&  '*`2x@  x  *`@@" @x 3 @>s 0M$ @e  `? `   +// /` ?///`?xx" ! 3@5  {b&  " @ݘ x `@ 0@ @@ J`ؠ`?    @˜ ` 㿘   !# 3"  m ?   +  @d`?쀢 l * `2  @ @Ԓ = "*@`@ܖ 2   2                            Hf`?㿐!h#` {x@dI` ?"* `*   @3   6  3@="`   +   "   @ " $ $  3@="p x ~"Ĥ '!# 3퀢 S"  @d b? ? *  2:@ @- 3 3"b8  =   , *.  .   + " @ . .  3.?"@=Ӓ  3"@=͒ !* А   * - ВБ:  @N  3"@G @EN8`y + 3 g  o a" I N u"@NN` 3@ϐ" 2N" Ibȣ*`@ē<` P  ?* : `  "*` €  4 4I"N N` 3@"Ѐ 2 @ݭ<``- `=`+"  N,N-"-N`,  @zbȀ "NN 2+ 3N  3"@< 8@   3@a"㿐! {x@c ? K * `D #Ԕ @.   " 3@# 3"@ < . @7 2 < " @+ & <  @'  < (  @  < 0 @   (@   $@   "@ @   4 Ā ڰ  @Y  ' $ @q'@Ē    @ @  @Ԟ@ `? @X @< @Xڔ 3@ߒ5@ڒ2 @Ւ  $ 0 @*Ӗ    @*̖   r$`-"*` €  d`?  ^@  @Y W   ˀ@ @M K  @F D @W > @W @@44 @W , @V @@  @V  @V @  `?  5  㿘@VВ(@ܓ  ``@V  <  I?㿘@  2  €  2  5     `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@㿘 2m  €   2_  €  2X  5@P  €    2   5<X/   2   5p+ €    2   5  2     @ 5? 㿘   ``? `"  5   *` @*`?   $  `  5"㿘"㿘 .`   ` & 5@2!0 5!@2 㿘J#8#8`  .' H-#8 S* 5 a*`  # **  *"  a?H#8 #8  #8@YI耢S* ` 5@2"`d @Y/ &% 5"%#8a?󀢠H "L 2  > 5` @C #8< @#8@Y րS`*` 5!`'!1 5@2"@w  2 `2  5`! @   0 b@2|  @Y 㿀 5b@< !#&? @(9 ?  @a* @2   5"@2.   ; : @  @D2?耎2? @  @-` 5@1"  @- @ 5@1"㿈 @  ` 耎`2#2  2  5@2k"0 : @  5@2a#㿘?### """ ""#c@m ! cc "c "cT@ @r  T㿐T 4!t`"T- |`@[`h %    {"c 5#   @y "@wC   5#   @y @w4㿘@v `J` J` @ J` @~4?@] 㿐 !,`  @O @lz @K  @Y   @,`ꀦ ?㿘@]Ő#㿘#`2@_ 0"* "㿘N #   ?*:  @_ N$  *@`$  N H ~P bĀ@'x p"P#`!'`(#` |'` '` '`'`'` '`$'' #' ' ' ' #''` ~Ә >w$#& & & Ԕ& &  ''///@z/#`2 ?$#  2 ?&  2 ?&   2 ?&   2 ?&   ?& @+  " @   |`@E   5@U~#㿘@; / 2  = 5 Ԥc  ,`,  @b  @R 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@4  @ ,`@  @+$`@M,`` %@  J?`/2 h`U*`'' @' h$< , U, @''',`@@"`@' h$< , :, @'''" 'r p @$!h=` @91 N@   5N@ \@ 2.@  .@   N@  \.@ h !@Dp`"" &!@< !&! 5c0@/ \ h ϒ` '''ad$ @F h$< , Δ, @'''"@`'h"@ 徔    . `2  h@ @Qx J`2h@/  h崒`  &@  &㿘 @@`@  `"@㿈`ذ @#@ ah冒`ah Q` '''@0H@+@&<ah    @ L  #Ԓ@C 5@r#P@sz {#x@5">   &ah@` Aah. * `    $@@ $`2 @} "$`$`` ?Ȗ‐@u   ah,  &@  ah`*P@TZ?  @4  .&@ah` ,`@.. &@ @' ah$< , 䭔, @'''"@`'ah"@ 䝔&㿘&' ! \ *`*:  ' " ` = :24J!! : \2  &  *` *:  ' " `倢 = 4$ N ? a   ` 2  N  5@n#X ` `N / N /2`?'&㿐\`o '    "Ș 4@  `$  $@$'@㿘` A !h`@Nϔ.N '% 5L \2LL  "L `*`[`?`$"LL  (2L@`  L /"  L  \L  N ~ *`.@*`㿘 $ @̛@ @*` @`@K@J    K@ K @" @*`㿘 #, @ " ah〒` , ahx`㿘`@\" (NN / ?N /"?N /2?N /2& *&㿐@fP @P @` ah`$< , , @&`&`&@ah@M`@"@`&@@f3 #㿀@ ah  ''ؐ' '耦r@! : @@@ `-" @Mې @ 2 @,  @`,@   /,  " @M@B $@< ": 6%,",'@ @E䀢 6@䀢 ah@,  $@ˑ @~@✒`?`,&M@`㿘 5 @pU#h@p  ) 5 ' 5 ƀ㈐ ƀ &@? @`N@#p N@ ƀ 〦`?`ƀ㿐"#h"t"cl"x#cd##p.+al {#3    "c1aH###c(&# t#p@Dc#aH#" %"x"|$|  $c @ @P#c"@$cc!# "@aH$#"@D9 # 4 !#$c?$#@  $|!#`!al`#" :  *@#?$# 5 تc %@  6MI  p % p p#*`@  @  `* @*`@`   5 㨀 6"#"c* * p#* @$p "p  0 0 `",0d"@e  @Jl 㿐 2/@  0/1#?? &#@C#&# 㿘t @  0c>  *  *` "tJ ""t 㿘#cp#h@ !#l "@/#l@+#lcp@$#l$cp@ \ ?㿘#l'@&֐ ?@ >"#1cl#x `?"|@ϐ   #x@Lcl8? %#| 㿘  㿘#lcd!@    # 4$## @B"#@ 㿘pl@@ 0 4"@  㿘 _㤀 %l @ """㤀`@ѐcp?"l "cp  )L@M@ lp"@Ȍl@U%#|#`" `4@  @  "c@ %#|l ?@Ll?㿘@  㿘@ 㿘@d cl@㿘@[  㿘d#l  @l 0I㐐??B# !   :  _ $ -J?   ` *!cdJ?   ` 2 *:  _ $㐔  㐐??#@W 㿘p#l  @ 0G㐐??B# !   :  _ $ -J?   ` *!cpJ?   ` 2 *:  _ $㐔  㐐??#㐁㿘#t c @"#l0cl  #l$#l@J#l #l0  #lJ@`@Z$#l#l#l㿘@??@ ??㿘N  * @ : N`   င    㿘#@ bN`cx   @: N  xc*㿘 ? 7@"0 a   `  ` @= ^  ? @@7@5㿘#lcd@)   c 4"cc S"㿘clp @    4" =@㿘#lcp @*#c??$c% p @   cd@ c@ 0??$c  㿘@#l#??##d cp2J@ 0 d# ??## 㿘@ @  #p *@`"#p㿘c$I   㿘`@6 㿘al@/ 㿘c* @%"@ 㿘c* @@ 㿘#`@`0 !c!l*@ * @"@ 㿘 Ѐ !l !@M 0!#d"ch#d@U"#d@"ct#d@!"#l$#p@+"#p@@`#p㿘!al#`" :"@ `n 㿘#pcd #`m0㾈 ~"İ'?/@ )1  "J??..?# %耦*.@ߐ #` `.!#d@n  #d&O`^ B?` @*@ `` 7@"@@  #  `@?  7@K"Ё 㿘#`?`Ѐ  %@# @ *d@RL@`^ D?0 `Р?:@o !l?$㜁㿘J@ ^`@5@u   ?@X ?"㿘%p#*cd'p $ cd@2$lcdl ""x$p##t+@"#@ 㿘cp] 㿘cdV 㿘@? 㿘 ?"#|@ 0@ %#tcd #!!H@?  c $@@c |`!Hx@?c  @@c"@$c "@ ""$@"#tb)tcd@2 c#p#x  c 8/#p#x@  t"& /@  c?@p#x@  tcd@  > *tcd@8 <@?" #x@ ??#xNl8? &c|㿘1#d#l @u 03#p J `" J#lJ#lJ#l J#l ? ?*?#l*J#lJ@#lJ#l ?*?#l*#lJ@#lv  ? p   p   p 㿘#lcp#d " #@ #@ @ "##@ <d H   㿘cl%@FД`1 h`* @ " h` h * $@ @HÐ & h㿘 h "`l" l l?`* @  # l#l"c 0 7@ "? 㿘 # 0  1 l*`@  `  h 7& l@"?" @ć cl"  l ?& l& ll* `l l*` = d "#"ct"l"p##x( 㿘@  㿘)#d ""t##p#cl x*@Q?  㿘@FN *:  ^2*@ N>  ?`  +*@`?` N *@  X င     ^*@` `@ ?(*@`*@X㿘   {cP 7@$ؐ#  {cT 7@$ϐ#ː 7@$ɐ#c.  ` *` 5 # *  7@$# 0 c.  .`  7@$#(㿘#`  7@$ #0ϰ   5# # 7 *` *   `2  @$c   :  !  ,``㬐     2㬢`  !h 4` 㬓,` @     !h  k``2N@ap - & 5#  : , *  " @ 2  ; ,  5c*    7#H@#E c` 㬳,`  #` .c@ #c`㬔 *c@ "@ #` :`*"  *@* + # :   ?"  *@ +  㿘!ٮ#`?"c#`ٸ#  "c !#* #   + c@* c    7!ޘ  ` *  ` @ G* ``ى,$# +   c*" +  @    7@c`  7@ch  *`ށ*   8("8㬄( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $l 㤁 㿘#`@c 0#l@"@"  a $c 㿘㤀#l  z"0@C  㿘#%')+dhct#p@+clct! @#" %cl$ct$d@$h%#p -@$d$h$ct%#p%cl@? @  㿘 @j  㿘 @d  㿘 @^  㿘 @X  㿘 @R  㿘 @L  㿘 @F  㿀#p!#l#d#\#`" "  袒 #d@͐ 0* @ А"'% {. @@̀    V @ 0@d 㿀#p'#ld#\#`" " L谒  @ 0H` h ܐ0;"    d@ w@’@# ` J /` {# `  - 㿘#2`@l#d:`#"  ## "ct"ctc"/ { X㿘 {X`?"X t` `J@"tJ``""t 4 㿘  !"###  "# #   #? $##|` #`c?@㿘N`#*` : N c*`㿘   % #* ? ? a   ` `,    $c$k$$c 㿐1#d%#dp" h '"@c #d $p* #d#clR##t    b  㿘!l@`V 0#`:@$?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' Ð0K N )   " '!N    " '2  N  "  "  ""  '" ?`"NN     " '2 , < y.. 㿘@ U㿘@  L㿘@ C㿘#lcp! 0#??$#  #p a:  _ $#p  #pK?   ` *#p0 LK a `@ `  ` *: `  X a `@ `  ` *: ` ~ !*`@ R`+ #pJ  ~ K a `@ `  ` U*:  _ $3# U*: a `@ `  *:  * : a `@ `   *:  X*  R +p 2K#??e$#A  㿘#`'ct#p  #  rNp  c$x %#x rh s s s s s s s s r s r rh s s s s s s s s s s s s s s s r s r s s s s s s s s s s s s s s s s s s s s s s s s s s s rh s rh s s s s s s s s s s s s s s s s s s s s s s s s s s s s s r s r s, g g g g h g g i k m m m0 g md m m n( m@ md㿘'#h a@3`$ $$a@,, !"h 7cp@Ð h`D$aad@L㿈 C!!h ``'''@ ah   '''" '`"  @g  ah$< , , @'''"@`'ah"@ ۔ 㿈!!h Կ` '''@7":   {#x!hڒ`㿈!!h ԡ` '''@" :   0 {#x@ƒ!hԵ`(  ' 7c@#  @g6   J`2J 2J 2@!!h  ''V  '' (@  ' ''Ԧ?$@@?^ؐ#- €N  ؐ#\-  €ܨ Nٰ N հ   ڸ ظ   $,@` (,@N ``?$@@?' ,@N `4 )@s2@C  ' #  $,@` (,@`,@N``?$@@> ,@N ` ),@`,@`" ?/   @H@   @b L m?$@@>Ȑ  ,@L `[  @ ؒ@v ? @^"  7 @,@\  7,@Đ#2D   !h o`" " $4$@ 444 $` ` %"  = #    ? ,@` ,@ `b"( @]ʒ ,@T T    %"  = #  H ?"0TB,@` ),@,` T@ab T@' T@@h `@@aΔ @aG'؀2@@ @ @ 7# 7#@ N '   '~ | 'z ) 쀤@|z J  l'd   J  b'؀ W䀢 2  '܀`N' {#  W䀢 T FW䀢 D  A   ?% `'`  ?"` `  "`@J!  뀥  ? @J3 ?'? @H('W䀢` @!"a 2  耥  ` !*`   !*` p ml ,@`9$@`@$@ @ @ @ B(`@Q:(@`` `ah$< , , @&`&`&@@" &@` `ah$< , , @&`&`&@@ @@"@`&@(@  'h  ''Ȑ  ''쀥 { !*` r p + 2' 쀤@2#  7@qa#ؤ 2@ 7c@K @` `ah$< , ѧ, @&`&`&@@" &@  R-`?߀`]Oؐ!*` €G [`@ ,@?`< ,@`@6`@3 {`@0 ,@`*`(%` '  " (`'@:  @ 2  ?` ,@`@' 2,@,@``,@`ܬ 㿈N@ $`N@ #cNN` _ } `@\ [ % *O  * @ *O  ] *@f @^R  @2 '$+ 2 2` @ !h`+@^0@_*' {cx @@ +`J `   2& 8 @ &@;h @;`*$@    N :  N   N * a@  @2?N  J  2&?&'N@ * @*  %%=#!h`` 2` {#x$@@]$` @ +  @`$`` ``?$@$`4`  @ [ w O  * @q O  ]m  %%=#?!!h 0` '''@e=@]  +  h$< , *, @'''@^e"@`'2" :   {#x$@O `@  h &`6! h,  ,   '''" '$`@ `$`$@O  @`?4` = @!* @ B? ?@] @^$`$@ +!. @2 "@@J` {#x@ += -?`J `ذ `J ` {@#x@!. @2 8 + 8 @Ғ㿐%h @.`#a$ @P$hϩ``$aP V@ -``(``#`   "  8 0@XĐ  8@    @C 0 2#6  8 8@@А @D/ @  " 2 @| @ 2@ @@ 6 &  㿘@q %2#0Q@0L@8J.@#P㿀@`$< !!h' '΀!' ''쀠`  @ Ρ`@&> &㾸@R@2|  2   2Z @ˑ  "  @  L / '< %@(@ @:A  ?    2. @ (*L /%< @ (@2   @:  ?    <  2 /,@`,@ %h$< ,  , @&&& h$@@8"@`&@ /,@`N /?$@@8,@N /`@  /  ,@ @;m 2,@$ @" @8Ґ"@`@ǐ@&@;P @ 8 X@ D  9@ ` . L 1 .2LL +L .N .#@:  @ @"@@8@ @&@ @: 2J`@y2,㿘@  :$@=@L`- &@)% 8 (2  L  `@` 2  .@  "&@.@`&@: .@` L  &@ ݀.@@e㿈 !h' ' ' 'L@?"@$ `@8  ``*@L@` 2 *@L` /"耢 :*@ @   @' N "&@?$@7ߐ 2,  ,N  &㿘N  + 8@Y h@Z2 NN  2 N 8@Y p@Z - N   8@Y x@Z@  {#x" 㿘@Nː!@Od 2 @ԩ 2   @7f`$ `$ 㿘  @  +N {2( N   `N { }   ,?2 "N  逢` $ c$0f   ah$< , ), @& & &&"@`L& 0B> "& 4 N { },  ,? ,% 2# `&!h`ؐ@|@w@@r,f  2 @ ` t 0 L L , ,  8 P d x L \ T ܝX'D'H'D   H H DR` H?D@Ӓ {@4 !,`@P% DR`VDD"aD `  *`#`TR:`'H$DJ `1`, 8@X @Y!  8`@D#@  8# % {# {  ` c@D @ @A9#` @H ;'HD` 2 !DR`"!DR` !!h @`!h @"` @ D `%D `# %' {@a 6 '`O$c` K@G@x D@?* : `9*`!p €DH@M'0+DH`H `'HH! 'H@ !h` 2@ !h` 2DR`!!@. @ DH@` @۔ @8H 'HD`'DDR@ !!h ` @R!h ` 2 HD@ϒ`@H`H "'0DR`DHϒ aD`'DDR@ HD a`@ ah 2 @   @ @3 @3I  `    8@| @z @ !!h` 2@ !h` 2@耢  @h @3`$  쀢`$   @Z @ &`@P  $ `$ $  @Ɛ H ah ?2'HDH@Gb0ZDH %`D!O'D `D R@  `? DH H!'H07D!2`?D '`#`l'''''0 'D` "D !h` !h' 2@!h`?  @2 @2ah @H  'DR` 2* `D@V` '@XIDHԒ a'`0'D@V`@X6 DH a'@| '0!h 2!h`?  @2 @2Cah @  '0DH a'D!DR@@  `? 0D `D!| DE D Hp a0DD =D`'DD`eDR``D '` $ @6P  '@ D 'DD <DR`05DH a.D`D@(HD١ 0D @[@'@M@2DD`@@ `D@(@ @s= 8 @ݒ'"c@1 H @1  H! @LԐ J ߀`@1 㿈'H J` 'P ' J`    2  8(  "@Ye ?@W/ HL ^"!@  'HH A 8 @H `̀   J`P 'P*H ` < @8-  3 8 @8-`耢 p?+  J `Ҧ = *`   @ǒ 'HH `H ``H b耢  `'H` " H Ha@Tx`H H ` Hh   J؀ 2  @ "N# + 8) 8  M#`(2  @U @V c@@~`  8 `c {# {#  @@m  ` @=c  @X  2  `  @X   ``!'0cH J ` @{ /  8 a@P @'HH    0A퀢 0<H@07H`LH `H `  8H@q` 8 a@ ~ aH@ H  @. H@ $@q  8 ap@q @I[@M @  H 8 a @[ 'H'Hh"&"!h `" ` !!hH`"`(`` x "` x `"( ", "0 "4 "8 "< R"@ K # 'H H2 + # "'H!h"2@h   H P  a"cH*H" }H@ #@ &$H` HH@H ?"@ @QH"`!ȓ*` €#'0`@/ @/o@/  8a@  0TH`H `  8H@p` 8 a@? ~ a@9  8 @`3  L `  8 ( "@WA H @U  P @JP L   #@L #@L H `2`"  P""@e?'P "#@/  㿘 8@SV!@TP  8L #Ԕ @   8L 2  8"  "?& " @@@ @px 8 "@㿘@H@H!<  8b @k @㿘!h`    @Hm  L @H& && 㿘 @Gה  2 " ?$$, ` $ @P `2 @H`?@O`$ $V``$ 㿘 # N = *! +@G@H:a<  " "" 㿘@GJ  /@y   q` !<@G ` @2 /`_    8@Rh"0@Sb {cx  & &  @ &   ` @2  ` 2 % `0 ! !P@G #`   @     &` ?&  `  [ W`U `   !P@G &   &  & #   @   & `@/& !hij` &` 8@QӐ"0@R {cx  @_  ` & "`& 㿐aP@G  J`/  ` {$ ?$@G 2(@0>  '?@ `@ < <  I ?    "&㿈2&@x\ / Ő 2X 0V"@Q@  !h' ' ' '耦`:@x6 : @@$" @.@u /, "@@.@cy N@ ɲ`Dz  㿘'@%#$$cX @8  ! @3$!0 @@9cX$!0$$ ?      -J $`  Ғ  ' ' ' ''''J`#!' 8@P @Q.  8@  @L 8"8@ H`S!*` €L J" J `E&  @B`@/6p x<  6`3.1"   @ `*L@ -  L` 2 #     @ l 6 8 @@Lr  8l`@ a ?" `J ` " 8a@ N ?@m!!2z?  8 8"`"h 8"p@۰?@mn 8bH@ ( 0_!h *`R  ?@  !h` *2 "@_? <@    8 @@L  @@m: 8bx@  +?@?'?`@9` `  ̀@   @ v@   @7  㿈?''D 'H 8b@  ?1!h  @@  ' '쀢`  `@Β ' 쀢 2 8 8"h"`@D@l`  8b@ 쀢 R?@74! '@+f!h @ߐ   H@+n"a@İ?09 !h1`@  D" "&!@$! 8b@  ad&!4 @:U @:RD@+H @7?0@?@@l`  8@ <b㿘 + 8 ) 8' 8% 8 , `2 # 8` @Oc@PJ`@8@O#0@P @ ` n(  @Oc@OJ@ ۲ @X6 4 {* ? {#x㿘.`@ 8 8`@:i㿈   @@&     @  '# ''@2 㿘.` 8@:3㿘   @a@&   #`@2 㿈 ~"Ġ  ' `A`?J@ `J@ "`J@`? * J@   : + ``+J@   * `+]`    ?!̗.`  @ub`? b  $ b  8@/g#@㿘`   "`1 { #x耢   㿘F㿘 8 &cP@ T     $ 4 D T   $ D T d 4  $ 4   $  ؝x"'ؒ'@&@p'Ԑ 'D'L''''@)'ah @&   *@"@)  L  {4 @ #x@)T@` (2Ԑ '@"`"@p @Ԓ ("D  @ " @P"D0@N{ L@ND@)x  㿐`C& !.` €  ''&"  *( )"  * @NQ  9 !H @//@  8*`#p@ 9a` 9 ax 9 a 9a 9a@ : 0 9b@ 4 @(א 㿘 `Y ߀ ```#@ @|`! 86& `"` `?.& 2- (& `@c ϐ`$ 9y  @S@  @F c `;@ @703  * 8,`@#p*`   @ `@  @  ` ` ` s@耢 ``    $  9  `!ؓ*` € @  @E  @,%   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@g `  "   8  ?3$  @   $   ?$  % 9(] @9   $   ?$ "  `$ @"@NO@M2&   ,`p* `@㿘 !`L?   ` `2 &` ( a* @ 4  [ L * `2 [2 ` @S 2 98 `  !@&`@@ "`!h$@)@KN!h&` `Z & 7 _'  _  * !@2L #"Lh $@(@&` }"`" `"` ``@M h `% '&` 8#p J  2  @VJ  M ` 2&` )&`&`㿘@@L` ` & " @Mr @L"& 㿘N 2@@2 .` 8* p A $ .` 8* p 6 㿘!!h H`!h""" " " * 㿘N`  @@" @b" @M&  @ "$ ` @@ @Kr&@  @ *@&@$  T T T T T T T T T T Ɛ Ɛ Ɛ Ɛ Ɛ d Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ Ɛ 4 Ɛ Ɛ Ɛ Ɛ < Ɛ D Ɛ Ɛ Ɛ L    H ڼ ` t ڌ ڤJ  `        9"H'<7 9`C9 *` €  9b@q )@ah @' 9b@g7 `   9@5}" `u 9@,|h* K   2  9`2 9" 9X"` J@ `@p =  !h@'F`$@  , `  ` 2 `6 9 2 9  @ה @& `'@h7  9` " ` 2 `2`2   9"@t   9# @ @  @   ` @ @ ݀`@ @̐  `?=` 9# 9#@ ,)@)753 9+ 9Ԑ#Xl":@4{# @$#X@4tc@o 2 #X@4ic "`@ @@1#X ah @ @ `  @ @f 9`@#(0@ @! 9@@4:# "`@ @(@@1"?  9@_ @e 9@#H0d @IF#p`@J  #a 9#x@#Q $aR`  @/ 2 ` 9@#D @   '`( ' 'x'| "  x|$" @&&xx"@@2. x&  $@0Đ,|@,$@| @e ` 9@`#@0㿘@ #+)' 9 @o-   , L "  Ԓ   @# @ ,? a@"А%a㿈`!h@%`0V@ː@Ȑ  !h' '  ''$@"  @%@1@,@6T  〦$  9@# @ "@$@%@n$u㿐@' /  ` "l* @l*@  Ѐ  !l`* 9@J. `! 9@)%"   : L ?   1al В " : ?@i ' 9#@  Б* @㿘 al  2 l   :@h  l?㿘`!l :@W  㿘!!l`Ѐ #`% {`  "``!l`?$!l$`lЀ`": @*` Ȅ Ȑ 㿘!l`Т "`< ? @ `а`Б. @@ #l@!?- @@R,  `Ѐ `@@5P `а&@ > `в@@ l@怦?㿘!lА@O" <  ?  ??4? ?㿘 )!p'%lР"@< . "@@JI̓,  %!p$l$Ё㿘 Ѐ`"! ̀ "1@m 1 #@ "Ē`D&  `"l$ " @S`ԁ㿘! Ѐ  !"p`'Д?"al$ Ё㿘 `@#@m? 2* `@31ap Б* al  `ap Б* ?:""p Г*` ?*"&l㿐J •`  :"Ш "@F 0@Fw"  @#`$̒" @!! k@ "`@?@_   @  ` " @ G@,B #\   @| ?"` ?   ?`@Ǩ@@ >`Ā` @)ap ``@I `@ (`@Nj@r`Ē @`@@   @Y $`ā " ,* "        2    ~"Ĥap'|'@D| &@3 !t#` :@$@0ː&@l! &# @  |@)| @@  `@ @7@v`@ Ɛ2   :@&E H@?  0  2? "  2?@" "@  㿘   IA`!D* €@ 7`5 @`* 0 @`* * @`* $ @` @ `alЀ ?  @ `& & [ `  㿘!l`В$ : &@@@ "@*  1` ̐@", $㿈! @    @J   Ĩ@ )D"@  #\   @ ?9`  @M00! Ԓ   g#  Ԑ"@; %`ĕ>  > > // ///@4 @  @.   @ %` @ 0@㿘! @ @{ $ 㿘 {ch@  @ 㿘 "c"0N'H'L'P'T'X  3@q H@/cc@. @,c@ 㿘'L'P'T'X@_!L@/# @.#@,#㿘 "c"0N'H'L'P'T'X 3@B  " :`X@/Jcc@/H @.~c@,ca J `" @a 㿘'L'P'T'X@ ! :``@/##L@/\##@.W @,Z# @E 㿘 !!  ! " @j!  !J :- b#@.`X !!    $  :`x@.#!"`㿘 'H'L'P'T` 'X!#@/ H@,#㿘!0'H'L'P'T`'X :` #X@.H(@ǒ   <   ` `㿘X @*  @*  (@*  "`؁㿘@ǒ  @`  : 㿘  @  @`  :?ؐ  @ 㿘 `#(@+ ``@00 @(㿐@;  :  &@  & @ 㿘@ @ 㿘N? a   ` "+NN  2'NN ?А@C `+ :( (  %` `  2 : : ! p N  @G :!(&?? "   㿘! `  @@ ?$ 㿘`   `` @?$ 㿘  `  @?$   ` :H"@?㿘  1  ` 6   @[?&    @S?$   @K?& 㿘!` :!X@ ,  :$ `$$@-_@l  @)f $!t$$&  | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |  | | | | |  |  | |           | | | | | 㿘 P"`` "`@ ""` @9Δ ) 'J`  *`  @( J"`J # :`!̰ .  * $ @9 ?. J` "J` @l @? 㿘  ')<% t24  2.  2  J` "%J` 2!Ԁ2   @ 6  @#  2  @ ' @  2 `@ @t@2 ! {#p |`@A #p@Ԓ  J` @*`㿘 `J` "J` J`  @?H @y!@^ ɐ ;$ ! ` ) | # @ " ' @  "a@U@] :a $  "8@8 !@ @ &! :!@2  :!̢c ,   *  @8Ԑ?,  - ` & @   @@] :bf $@ Ԁ  a@@] :b8V $ {"#p $a`    :bXF  5@Ȓc01`"! :!̢c ,   *  @8?,  # :`!̠ , *`` 2` `@8k ?,  J `@>㿐` aL`@e @$@$`$``$` ! 䀢  !t :b3 ` "%"`@m` `2$$ $!t$,$ $($$$ $ $"$$0$8" "`ܐ@  :` 0@;ǖ )`@u,@ @X`#!4`  @ :@Sb @  :w"Ȥ`?"$` @"at$`  J ``   `  $@!` a  ` |`@ `@`jb@eb;  @ @` J `` 2J  :!̢c ,   *  @7?,  J ``@ `! : J ` :  @7w## @7r b : :"@> " :  @` :@ƒb" "`* @=* @6a` : Bb@ @D`7 @b   $8 " `" `" :@# J `  :c@*L#0` % :` #@*D @`2`  @)x#@'{# (@u  @! 㿐`@ `䀢 `@E" @  㿐` @`䀢``  ` : :c8  cPА  @   } :h@3  @ߔ 㿐` @ה  &@ !t  !t@2 2' : @8  !t   @ "? @ ` :!p*`  :#xF? :@  @   &@㿐`@ @   @u  :!p*`   :#x04 `2 @ 6( @ @[5 :#x  2  ``2  @  @ 6  @ @[ :#x @7 㿐`@/ @   @%  :!p*`  :ɐ#x`  ` @  :#Ӱ "`0 :`N#`0  + :) :' {  2$ $  c  #x7  2  {0#@&7#X2$` @s `"` @J` 2>`!` `  |``<@M ! , |`h `h`@  `  @5  @ `h `h`@ @Z} :#K0``  ?@ $`"` @``@6  :`@`(` $``   |`@ ! ! |# @[a @@Z? : ca  @[ @Z2 ;  0 !` ;` 7$`0@  @? 㿘 ' !t`Ԇ " J` "J` 2  2  2 " 2   ; X ; `  ; ; h `  ; p ; ` ;) @  㿐` @`     @ߔ 㿐` @ה􀦠    @O ` @Ɛ  :!p*`  :j#xB  ``    !% !`  @ @X ?   "$  2   3 ; "@֒`x 2  @|  㿐` @s` ' L` "    @ @Д ? 8 "$  2L`  % ; "@`2 @$㈐ @? 㿐` @7`耢`"` "` @+ `㿘 耢  !!2  ; @k`  2 4 ;` 0B `  " 쀣 7$`)+ ;% ;  耢 "! " @6   ` a  `  & @& @ 㿘   0& ` 2 & 4at"@Ȓ 㿘```$``$` J `"`` @!`a(  "` ? @2$``$``"` @2\ 2]`` "` ` `x$` $`J` 31 |!`/ ` ,`  !@ $`h`($`! @J! 6` @@X. ;!`  `   ``<  @f$` &$`4`  `  `$  @Sc`4  ?S$`  @` `2`4` ;$``4J` ` 2`(   # * "`(@1 `("#`,#" ` "#`$#" `` J `!` "ؐ @Y#@#6#`  J ``@-@  !t   2  2"0 2 @3?vd@-?  0"   2  2 0 h @w HV? ("? $ ( ,l@@ $ ,?/!@$ ($ , (" $ ( ,"@ $ ,"@ $ ($ ,p  $  $t@@ $ $?/!@$ $ $ " $  $"@ $ $"@ $ $ $ @2 Hd ` $   `    $@?@  4h@~"㿘 2 0 ;a 0`  `  4@`2` 4&  ``" &  &   &  ? #` 2 8 `$  8`"  @2   ? $ ?`  @`& L  : 8` 2L @r L  -`   '!h!  `"R``2 2  @!C  @0 @"   ` `  ;`@`J `   耦   ;?& & `"@a(8 ~"ĸ' `' 2 ; 4   ;@$a8 ~   ?` '  ;!@ ;!P' 2 +" - 0 З*'; {     `0>" `09 ;aX *  `"./   ; ;a`@_͔ @#` @@$N!h`  2 `2  `2     2  / * @_ @`` 0  ; ; ax@$; `a@$`` ; a@$ `2O $` ' ;!cx ;a@#  '   ;!cx` ;!cx ;a@#   ; 7  3 ) ;' {!x/ ;- {+ ;``  #\#\@#2 a  !x@#     ڀ` 27  {@#c ~"  ;@F!㿘 !* &*@AC`  4 "  2 4 |`   z 2 p`:  %`m k&@L`?F"*` €  V` R`0T@A` I  J 2 @` 7  0 "  @&!  `"`2.&@-    2 0`@S    0`@BҔ 2`` 2 0`` &@ 㿘a "a` l `" & ` 2@`"& 㿘a "a ` @㿘  `@2 @ ;a 0*" 0`   @"`"  ! !t @ !`?"`!`& #!#`耦" 2`"`0"""" """㿘 0   "@R &? 2  "x # # # #8   % ! " $| "P % #l &\ '8 ( $ 3t 3 3 5$ 5$ 3 3 3 4 > ? > ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? < = ? ? ;@ ? ? ? ; ? ? ? ? ? ? ? ? ? ? ? < ? = > ? ? ? ? ? ? ? ? ? ; ? ? ; ; ? ? ; ? < ? < ?  L@ ~ `a* @vh ` L`?$ >`?$aJ` `\ " @  <- & >* &  >  $ 28$aJ` `\ " @ - $@$ > <  $$   > $ | @$@$$ $l"!d!2m,2j,` )"߰ ) ; &a ( 4 ~7 ~ | ~aJ` `\ " @ | ; | &!,!!!( &&!@? J `aJ` `\ " @S (!@!~ ~ؒ$ q"ad@` `@d@J@  ` @,@`@ `J@ `A @$ 2,?L? L? J!@$!@%O   !  } !hd`. * H@%6 "$! a"!< " a @( a"<""!h" d&a`i?! ~  ;@Ӑ"(㿘!\`X   @ a\  X$a\㿀 i  '`a "a!h!' '! ''+-  $ ` a L@!?$@ , aJ` `\ " @h`ڀL  `` 6@-%' ;@<0?$@ , aJ` `\ " @5` ߀`?$@ ʐ, , $ `& a?"a㿘!'H'L'P'T'X`?  H `<`? (`<"! {#x"A @#꺐㿘o @ {#x?$`$ $ $ $ $ $ $ $$ < $ (!$ 4$ 8Y! 4$ 0 $ ,$ ,$ 0$ 4$ 8㿘a @J  $@``t$@"*` € {s#x@h@`   $`$` $`^$@` ` { {#$`$@S$`# $`$`M$@`$ `< $$@ U" $`  J`"`<@UY J?? a   ` "`<`<`$$ 9$`$`$$ `$ "$  ``$,`,` $`$$`$`<$@$$$@``@!h` ``<$@`2 `$ {#x$`$`$@  !@#@Ӑ#@J  s$@㿘 J  ` 0  `?   $ @  ,8$@  ,,&` & #Ѐ { "c@ `J`  J` J`  ( & ,F+ " aH@ɒ ? & ?#+% , @ƒ"@  `$  `, `"@$  ,"  J "   0$ ," $٠?@ T ,Ҡ? `@D ` %a#Ѐ` {"#@  0 && @ϒ$ 0    2)&@ %&# `2JJ!` * J  *`  2J    &   @ 㿘! ;*` @"P  p㿐 " ' ;0* ;@-&"X@. !!h@ ǒ`!h'` @ '!h @q   D "aHʇ @ "aH@  0@-"`@-!$!Hh ~"ĺ'N     ިN  2  ר  @ *: ` ` `   /   `  : @ `? *:  \_ !M J `  ;ߑ* : `V;*`# €( @E@ ;}p }@SL`{`$@S@S } 2,@@Eΐ@̠$@B@Sx }  $@6j .@5$0 ;Ҕ@ @    `Ӑ #ѐ $ // ݠ!@E@_̠ ;@E@V̠ ;@Ey@M̠ ; @Ep@D̠ ;@BY$0ac @#@S `@S `$@S @S 2,@0 @Ec% ;@+@,! ;@+"@,@ ;b@S /@+"@,@S _ ~@+"@,@7( L@ /@+А@, ; 2  ;@+Đ"@,@T@R$0J!` ;!` ;`" А   А ( L ;Lh@WL$0$*`:`*, : ; А@W>$ \///  /   ;Lh@W($@3`( @6W&@!$@0M ! !( !` ; @ې@` @&$@6&@ @S*2) "%@$ `#`2 @ܒ "* "2 "` M ( @Ȑ#`2'@ ~"  ;@ 1"؁㿘  㿘  㿐 'J  \ !`" @`k p.` €, :  #^  a* @ V  S  P N  !*` G`, :  [A @U 2. ;" L #?&@X  .L  ah]`J  \ !`" @  !*` ` `2, .: @\ 0 ?&@.p 㿈  !h' ' (' '')J@  @ \! `" @U?$@,`: , [  ]":`  , Œ$&`?㿘a ?"a! {cx `!@` "@`( * * ! " " <"$!!㿘!` !@J  7"@a  ! $aJ  '"#$a!!@J  "@  \!J` "  ! $a㿘!h`7!" !$ $ 㿘`~&h``W& !t(@B !, "#!,!,a0" 9! #!,  ;@)d"   ! %%<#   "$ @ 2$  2$ Ā@   @$  2  0(!` ! `   ̒ @Đ$` $`@  <  $` " 㿘#@>a`@$a 4 ؤ@O : , @O % N? \ @ ?@  L  @OΒ ? . @ "$㿘 % # ̐`̀ (`S $ $$ @N 2 $ <  2$ $ 㿘 ; @)7# @*    ;#  ;$#@-T  W W W W W W W W Z Z Y Z Y Z, Z, Y ]@ ], ], ], ]X ], ],@  | | @!"! ̖  ????????'7ߐ @'"ah@''@)@m- {9!P @E  H @@ ! @; @I/!< @4 @`'\ 4!` ;` X  2 3 `   H  2 <!$  @*     @$ <@'!h@)h a ؔ  ;*c`@N* a <@Na耢  <@a  @aa? <@Na    < ؒ !*"  @9  ;"` ؐ *`!   #`  @+]   `@"`"t ;    @+K#( ; #0 <@'"@(L /@.@  <"@(Ѐ  @Ѐ@2 DԀ@ @ H!8J@ @ ܐ !8J@  {#x@(ޔ @ <@'W!P@)<`@'Q  @c@(Δ ``    @@J%ఀ `D <" <" "@ <@'*"( ఀ @(@N #  J `2 `D@( <@b0 `D@( @ ఀ   @@   , ,  @ 6L @  h `. @ $@$`  <̐"8. @ P\%aL % L  !h `. @  $`   @ 0   $`  @n"c@D <` ⡐"P` &%a `,  <bX$` o   @9 $` @o \@o   \, ,$`$`  $`$`"$` \@ h<    ؐ J `"L @ !  L  @ , L hh. `?a@&""&@ L , !8L , J@ 2  L  <b`Z  L  < " @{ L `   < ú"  @o  J`  <"  @e 0J`  <@&*"@'$á J@    @Q @@ 2   <@&!p@'@   <"̒ ؐ *` ؐ *` J`  @y*`@  㿘 <@%"   ` <@&ܐ "@M` <"#@LҔ 㿈'D'H'L'P'  @  0 'v?L  !h`''0''@ ah @j  3L "  @  !h" "?`#̓*` €? #P`#`5 @) <cǐ L 3!h"`H" ah `'Dah" @` " @ @T`  ah" " 㿘!h w`"`"@@ 㿈'D'HD`$ J ''` H@ !' '@쀢 "!Lah @i  <?`/*`# €쀢  2 {ᦐ#J ဢ`D `  D "`D {Dcx"" "!@ @"a@  <c-  آ % <!,`@, D <`L  D`$ D`$ ?"`$쀢  =D D@p BV .  L ?'`; D"  3aL    D&aL"`H '@.   L   D $` ˃"c V  쀢 aL 2"aL@@Z "a㿘  J `   #` #J `  !#@ !!hR` *` €ah@h  !h` 2`@ !h㿘#ah D`44  ah`$ $ $ $ @$ah㿘!h` " `  `@"` @#Z` "` ` , R@`"   $` ` R ` @ Ȓ ` 5 T@ ( J •`ߣ` #   @n`Ԁ  #, @ @  @/ @ @D@c@ @;h$hn`㿘!h  "    ,`R@ `@`$  R$   2 h" 㿘!h @ @  㿘!!h@`@!h`"`@㿘  ! !t@2@  2 㿘@ / 2@J7 r   ;@c`@ 㿐`J c b <;#`@ `@ =J@  =) ` @ ` @ =J@  = ?# * * 2 `@  =? 2`   = @  0@@l   @ڗ @@* =@ `㿘@@    @څ @@ =@ ``!   ?0 !3!J ( 2J  㿘 – @  2@ `!  @  2@ ` =`2 hĒ  = x  =   =   =   =  @ = !㿘!L? = ,@& @?,@}| 㿘   @~ @IP㿘` `@* 㿘 @    $  &@ $$ 㿘 = ԰ . @ " @I9   $. ?㿘 .`@ J `  =# =# =@ h "+ = =ަ# =Ȩ 'Ȥ  Б,` "`@}$?$Ƞ @'Ȣ``$,`#X @ǚ 0~# = ؤ`Ԣ ! =N " `,``"`m#Т``$(N {f#h ~"Ġ =`Ԗ ؄ '` J@  @K@ " *  $`!h*`5"  =@#؁㿐 J  *`5 4 0    % * * *  * ` @|?'@|4@ `@l   *     atԀ * $xJ!P!P`   + =c (@H(@|! =c *@H!x@|ސ!x!x =`Ԡ J`  ``  ,@`" *  $`,@*`J ؀`-   @薒 / ",` J  -2,`  ,` P!x@  = ش`S7 =`A2  `o`?`0* `0'? ? ϐ8  O.  , R @/#i =`s    `  $ %J`@2`R`@ %P >@>耊 !`ؑ*  `J`-`+`J  ``-  J `2* * #ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @%SJ` > _,?`܎ &?ؑ, `2 *`P$ @f ؐ*@' ؑ*`" ؔ*`2'؁㿐 @0+N J`2   <#$&@  㿘  > @ P ~"Ĥ' `+ @{@{@@* 2$  @!ho`@Fߐ`?@p  >@ P㿘   U + > M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  `X@Fn  `  | )`02 `  2 *  ``?㿘 0퀦   @〦   ?" ` [ * fŀ " 4 Z`"° @  ?    @ "   ? 2 @   2   2w  @ِ@˔ "h   ?g 2\ @ U  N 2C  @V@ M?J  @, @ 2        @!*`?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% # >   ) |?? |2  2 ` `@D̐`X 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@Dw "" * " " " 㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@C 2J N :2` `&`Q.`  > x` > x >  > 7```:`;<`,@+`?`J  S&` `&`L&@`;2NG&` :2` `&`.`\ :  > x` > x >  > `ث<``  {ظ#xA ?`#2=<`@* `K  !*` 2 @ > @C` 2%&`@* ?`@ &`&`  a* @2 @ > @C` 2 &`@*   &`&@&`<`㿘L  !*` !2 L L  *`a" L  > 0/L '  > % >1`'`ߐ$ #XِȢ #X ?L@Ւ   " *@`" L  ` >ؾ ȁ㿘!h 'L` {c @zВ " @@zɒ` ` @$@x㔒@z" $  @,  `/ >- >+ {@xݒ@ L @>ؔ@7cx @l@&ڠ !h`㿘`' @d  `@L@ "` @d& "$@v:@ $,㿘 @  @!`#@@   @"㿘 @   ?  @  ?  㿘  !h$`$@⸐`  @vah !h`㿘  `  {#xN@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@v"@@v@J / /,  $'" y@uJ / /,  @vf "@`@u "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘     {#x@u ` #"`a8˒$a8a8@u[  {#x!hْ`㿈@uah ' ' @ ''@  @2*@ /*@`*@`"@㻐 ~"'&@ d_N /"N Z@@ / $@@u}  N .G 2 N .2 N .  @ (;N@ /@ 4  /&@.@` @" V@tٔ@.@ @m# 6 .@2`" O / @ " 2N  >@  H H  \  | ܝ㿘"!!h0D`!h`0 "$`,$`$@$`(@`   4`  @~5@vې  ,S 0` 2@\㿘`"`` @~    "`  `0`0```  >`Ԗ    !!h`&  d & !!h0ؒ` 0& b!h`  & ,& & & & & & & & & (`&& $ @}Ŕ 㿘`"`` @}   "`  `0`0```  >a?    >  a0 (6  >a00  & & & & & `& & & ` &&& $ @}w 㿘  >aP  1!h 0Y`!h   &,B B `$ @H?& &&&&(&&& &&&$㿘   @H@u &?"$T ,0 ,N 㿘  @,@u &? ?& & & & 㿘   ` &  @  & * & " ,㿘! 3 1? 6 >ahӄ h@ $?"@  *@ &  ;    @q  & & @ @ 㿘!   6 >aN h@Ϊ $?s"@ `l * &a `G d@$@2\?  ,*`   &  " "@      @  + & & & & >& @7  "@ % @ 6$@d`  (@Z& & $@  &  @qQ @& ?ܢ@`  * && &     & &  &㿘!2L  6 >aÐ @ h=?@ $8"@ X ?2-?  $$      $ @`2  "    ?(@$ $ $$ $  $ 㿘 >av ` >aȐ o` 4@qb @"&& &@`@ ?@ @$@( ?㿘 >a9 `4 `0 \?(  @!,@@^ " $  4@q &@ @"&& Ң@,@㿘2  >a   !? ?  $ @`$ 㿘@2@ >bؐ @('?"7?``@` 2.?i ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` 㿐@? >b(ё ?"B?@ "-`` / >b@т @(@ް?`$-"6` @`@ " ` ?(@&@&`$` @  逢 0 2 ` ?2`?`?&`*@`&`㿘 " ?@p@㿘 >bX6 `6 >bp . `@@`4 @p$@@"&&`: ?24?@ $`@l&@&@  @ 6$@W`  ?(@L&&&$` @o۔@"&&㿘'L'P'T'X@6Lh'P'T 'X`  >b лȒ P@hȖ'H'L'P'T'X  B H@H ~"Į '`  @, `:  %"N@ `2  & * &  `   U`* : `L#"!*` €CA?"<@;N@7 261N@ -+ ) !*` &,@: , ?Ѐ`  ,@-,* :`@  ?Ѐ` "N@` & , 5 ۦ ۑ* : `S" *` € Ϧ쀌 * : `Y`" L*` €   ,` @T 0,@@n 2 =  u< -7 +20 -`   04  ,@" 0"! >" >"`   4  ,@  x X,@ 0,@'@$@` >"@n ` // `@@d`%@ @"@@ L@`+ @`-` `0  )?"*3 0  ? 0Ò &   @*@`& `  @` x 0  ?*`:  `&   @*@`& ` @  0`', `2 < `& * & `,   `  ?L@r &   @*@`&  ``$@, `2 < Y& * & `4 @, Z(? ~"  >@"㿘!!` `?@}$!!  "a $! "a!` ` a ` @  $a`@ 㿘@ * #%@   @ 2   @S  @L $ a $a |ݐ |$ސ $a㿘ϐ "#%Ȑ  !@Y   @% a $a۸ $!瀤! $a㿘  )+!`a%!۝ %a  `@a `瀦 0`* &! ; &   @ 2 2  @і  @ʖ $ %!㿘!`  $!S! "a #!a#& ad$! ! `  @?`?@ b ad& J`  & \ @ ` >⅐""@"\& 㿘 !@ "0 "a@ 㿐@X  @ @] P!!h`  !h @ݒ` @'''!h @Ւ` @'''خ !`!%!А`, "aaaa sЀa!a `{ a`(h  ,h na  00"  aaah %!~̀ah %!`h `h`0 @%!a &  V 耠` "@ :` @`! $!  %!l%a"a`(c! >0ri >Ẑ#,%@ צ%!ؐ" :  " :  2 @_ "6 " :  N` #ad@  h$< , *, @'''ad" ' h$< , , @'''ad" 'h!`" : ؐ" :   ؐ" :  " )@w  %! %!  (Д ) {˔ }ܰ@ː a& %! h$< , Ŕ, @'''h >`@ 1# "@`'!  h$< , , @'''!d"@`'@  /000P!0a8'%!'''''Ɛ! >" @t @W!ad@   ha  > >#@#H >Ð#(`S & @C@I@& 0& @:a   @G @&  & @> !! !d& @ ! @& @@+  @& & !  @5! >  @   @{    h `& * *   @g   !ad @}! >$,Q#%@ ,h` & %@h,& V  ;h h$< , ϔ, @'''"@`'h"@ &  h$< , , @'''"@`'h"@  & `h`㿘a !"a؇ "a! {! }@  ͐ W 㿘 Q!@h   & @ @& 㿘a  !&!T ,"a!!  &!  @֐ @=  & &  㿘a  !$+  "a! {!  }@     @`2$`&  $  $Ḁ 㿈!!h @` @'''@ !`!$a  "a( $a%!  h$< , Ӕ, @'''d" 'a`!$a׺ %!|ݐ! $a h$< , , @'''"@`'h"@ &  v ) a` & $a׋ %!0!!b 㿘@ >L #! > *acP=cPŒJ 2 @[ !`& 6 `&  {6  "aah ` U2` /& @@ ah& `3  ah"`-   ` :"  @* `* `* `"ah`  "`  "@ "  ah` ?2`㿈!!h @` @'''a  !$a  "a;: 8$a% !h$< , , @'''d"@`'a $aА $Ḁ߀ ;@W " :  !h ޒ`  , !h ,   '''"@`'!h"@ 㿘@" " " 㿘`̐!@  >#l`#l T` "`@@Ő@_" `"T`" `@ 2T`㿐  ?!!"a ? >"ad"!lll!  "  ?ݦ!0 ? P ad ? X@l @ "@R` 2`@   ?//`  ?!hy"" " "   㿘!h ~`22 " " " " " " 㿘`X"!"\"# !㿘J `2$ N  ? a@3C   ?a@3< "  ?a@35  ?@3/a   2 <   "  " $ 㿘!` $!` @ A՝ "a!  J @ ``H`D `Aad ?9`7(3) (`!d` `  ?! ?!!h @֒`  !d ad ?a@2`? .`,$!2 `!h ?̗.` @``@`*``ah$< , ~(`, "``"`@"``@" "@㿘!`  $! @"a!!"$!$  @`* `ah$< , } , "` " @"` ad" "1 {#x 㿘` & `@ " !" ?#a .` "dPJ@  @`*J@(8 @ ( * "* * 㿘"" 2 `2 @㿘.` }V  @*``@$.`6 @i 6 5&  @6/*``%`@ "`V  * ` 2V *  " ?6 }z@ב*`}s㿘T  ?%  * @ @N N@@2   @1 2   2T *  2N  㿘T ? T?* @`@L`N@@2 `@1q .2T* `2L`T TX*`T@e |ڐ $@$`$`$`$`@ew`4$"R`"`"      㿘 @1`㿘T` h `|* T``  "@ 2`T` &"@< 1, &㿘 ? ?!!b# I M ؞c $ " """    #  T ? t!a 4#2"a$$ "`"` aȆ`@"$ T$ t$!$ 4$" $@ @ @ ` @! @ݔ 㿘#!1"!Ԑ!c@Д )㿘@## {c  @]  $c"a40@]@"㿐 a* @= D A 4@ 1* #;# % ?  /`@ ,@d # @  2 @  @0@ @d  @e  2  @0/  ΰ  㿘. #@@ $   @"!,"!4"   2 "!("a4 `@@"㿘!4`@4"@  "  @     " " H2 @  㿘 {   ? b ĥ"H ""!, @"!4""!(#      "  2@ 㿘  & 2L " @"# )"#   " ! & ~&  a!# $#  !{` &  & 㿘"!,"a4"!(c  $  "   J@ 㿘#  2 ` 0 @i< 㿘 !zْ ̒ 奐 & a` & N@ 2!    "@& 2 2! J •` π&   &  &  @( 㿘!8 `    @   `  @    @  㿘 !8 @ 㿈< ";     a@ce 耢 `` & &     J •` @ "&  2& !  '& ''@c6  㿘  2   ?b@ ë  ` π` & ` `  0 `  &  &  Ӱ H d լ t X X t |  \ Ө ( ` ڀ 4 T ڌ L ܠ  $ 0 ݌ ݤ ݼ l  ߰ ް ( ( 8 8  4 @ @ H  0 8㿘 ?* : `l4 *` €   # ?@b`  2  ?h@   K# ?@b`  2@  ?x  ? @`3   ?  ?@| *:   ? ?"" ?  @j  ?@c  ?@\  @ # ? , @bȒ@O  , `2  ?Ȕ ? ؐ@?V 2   ? @5 ` % ?) ? ?@*   # ?@ b`  2 ?@ @# ? @  `'- ?`+ ?) ?@ ` "`#(  )  |@  2 `@c0`` ?`@ ? H@ג`! ?  ?@ϐ ? `@ɒ`     ?@ ? P@` ` ?R@ ߀` @ ? h@`'#x*:  ` ?# ?#  ?@ ?@ ? `@ ?  ? `@ ?@|'  ?  ? V   ?# ?#  @e  ? @]  ?@V `6@   @@0`@ 2@ @  ' ?@   `    .  @( @ 2@ΐ 㿘 `       4`  @ @ `  @ `0禍?`.4!*` € ?` " @ @ @`@" @ @    @(` @0@В  @8@ɒ 2   ?@`0 ! @ @ ?"`@㿘 `    ^ $R  @N0 2   ^ $DA ?0>㿘 %4N  , (@€NҰ NN`   " ` $ \N $ (N`&* : N  ) $ ( (N` * : N  ) )  + " ( "ې $N`{  {ԒN  sN  NN }   }N  ( | )~N㿘'P'T'X@P h'P'T'X   B @P|`N% Nŀ`:~4!X*` €zzL s *`m:  L  iN(bdd 2 `2 , `? -,L K *`E:  L  AN9! ;  ;. ++ &`  ?  $N ?  N@  Nr㿘 i uߐ 4 4V  @^$В$ ` $  $ ? u$  " $@@@$@  `$@  $   $ ? u$  " $@@$@  `$@ " @Ȓ$ $  $ $ $㿘@  "up@^㿘 #4N + * bD@€N  N N  N`  ?N  N?@? ` 2Nՠ? @N?`H NhȠ    B#4N  * bt@€[N, N' $ (*  : N`? ) $ ( (*  :  N` )' ) $N`{  {N  N  NN }   }N  ( | )ْN㿘  & ?t  `- t $@$`$ `$ ` $ `$ ` "` %$ ` "`$ ` "ߍ$  ب - &㿘 7  " t  " t   t  " t   t " @  ϒ ̒t{㿘  " tp " tj  "tdta  㿘 |  @_?$# @ p$c @I 6 @ $c@ @`o @Iސ    @Iא    @`\ 01 @f  $@@ @`K  @f   @@~ @`: @_?$@Ic@_z㿘! | @_p?$  4 ` $ l P h  d d d   d d d d d d d ,    H X h     $  4 $ , 4  , , 4 4 4 4 4 4 , ,㿘!!h Psd`sQ$` !h`  @! $`$` $```$`` $`D$`H` h`$`L"`㿘!h```L"`T`?,` `@!"?@`@ @ ?@ ?<` `("!x`,!x" `0" `4" `8" `<" `@" rhs6`㿘`̐!d  @!$`  @@ڐa"`@`" 㿐&@@> @1L@ [-@ʐ ( &@3ahِ` ahr`ah$@̔ 6 􀢧(& @"hahrے`㿐!!h`L@ `!*` h!h "!h @Ԑ" "ԠԐ $ $ ,  $ @ + `+ ` @+` + * :`  ?Ѐ@4 +`@? $[$"L``U߀` ":!t*` € E$  @$ #:$ 7$  =$1$ - =@*   0L 2`@`@f$ !$㿐!!h K !*`  !h$"Ԑ $ ;$ Ӕ`#    L   " L" @ $""$ $  @t`@ $ !$h ~"Ā'"@  {Z#xb S @ @" @"@  & `" ?.@ ?.@Y `  #?. @| ?` . @] ?.@ 0 0? -.0@@e!hB`"  @@Ɛ"㿐@ ?2 @p"㿘$ `" @c { T  {Y#x"6 " @ @Z# @@  @c    q* &  ?` &@@  @ǐ & ` &d  2  !&@ !hp` 㿘"2& !h""Ԕ"`"`  "`  !&@i㿘! @  `"?" &@ @2  {#x   " `0 *`L  "*` L`x`X@   `02  L 0"     *`: N  !a-#A : 7 $4?? 4 * `,  ` `  ` `   ` ɴ? 6? @Z ?L 2 &@㿐d2 b  & p%  `& & "!&@㿐@X0@ "$!h `oА0@[ @3@ {@(#@K? a   ` 2#@@ #@ @ @@ @a* @ @#H @#X#\" #x{,  @N@? @ a   ` 2`@ 02`N@ 0"`c`V `@X@$N D  ~J `@ `  ` + :  a*  R *J 2J0%@#N   J `@ `  ` + :  `X*  R *J 2J㿘    @X4@X1  &o @& @W =,  $& @W  o'㿘@P " L [ =@ܐ  @  6 ! * @` &  L = !h$Ԑ@  J ` @bH@#,  @ch@#&  @cp@#  h @#xh6` ` .@ @$  @2##!hn`@y  p/   b@ b"2   bb "       ?$"2` ?$$ `* $ p$ p@2$ "   `"  ? " n? $  ?$`"  n5  2 {A#x"" ˔  4& Ô  b    ` {  #x㿘 " m @` `"&  ` m m `& `! @ a&!@'㿘 a* `  N* `2 ` [@| 2J1 ᘅ(*  J ` (2 `J [ H(8[`]2H2H㿘ɒ J`?㿘 @  J@ J` =`?㿈!!h!m'`!'''!h PT? H? ?  ; ^L  ǔ " L@ ?"@ L " K  y&ɐ h$< , l, @''' " ' 6L2T h$< , lؔ, @'''"@`'h"@ lȔ㿘 | `@㿘c!  @ 2`㿘!R 㿘ߐ ?`F:!*` € ~`9&@ b" 1 |` >&@?* !@S?* p >& >&| `T >& !&( ?`:",*` €#cԀ !lZ }% $c 0u֯ L {"# ~&v\   0#a l4`$aVL /}@]Œ  x@ s<  m`h$a ~&*1d @0"`T&8! { J$# G$# ~&!4& ~x&@ | &" ~@?&i$""" `& "# ~T&`T" ?"a&㿘Ԑ ?`/:"p*` €!#Ԁ 1k `g $# 0 @#  { "c1! k` &!{ 0ϣ 0 㿘@Ta` @ @$@`0$`  "` & " ` 2` `k! `@x @ ~$`$ `$ `$ $ $$ J@ `]"?["J  ][["  㿘 [@> !h"@㿘7$` @#          @   | | | l   !D !$ !$ !$ !$ ! !$ !$ 4 !$ !$ 4 !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ !$ < 2 3 3 3 2 3 3 #4 3 ) 3 ) 3 #4 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 ) 3 ) 3 - 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 -` #D $ 3 (P ( 3 3 ( 3 )P 3 3 3 3 - 3 ' 3 * %0 3 -( 3 3 , %d 3 3 3 3 3 .( 3 $ 3 %l %l 3 3 ( 3 )( ) ) 3 3 - 3 '4 3 * * 3 - +@ 3 ,4 %l 3 3 3 3 1h 5D 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 7 5 7 7 7 6 7 7 7 7 7 7 7 4 7 7 7 5x 7 7 7 7 7 7 7 7 7 7 4 7 7 7 7 7 7 3 7 7 4D 4 7 7 7 7 7 7 7 7 7 7 7 7 7 4 7 7 6 7 7 7 7 7 7 6D 7 7 7 3 7 7 4 4 7 5D 7 7 7 5 7 7 7 7 7 7 7 4 7 7 5 7 7 7 7 6㿘h(@ΐ@ڐ %Ѐ   $ `$@?5"̀(#` `2`@`   Đ  t   "d` @ ?@(   ?!"d` @ 8`?@"d@QN"d  ."d "  㿘"̀` C!d*` €!"+  $b̰ ^@ "b ?bဢ 9b݀ @X$b̀  ""d @ '"b̀@ "@ b̀  ?π #"8"<?В "<$b"*  #"8@0 $b@ "d /"` "` A 0 A 8 @ Ĕ ?@  b̀  @! @"d"` "`@Qސ##@  0 @#  "d`@ ے @bd*@ "@ ʐ n$b̀? a   ` ` <*` * ?Y"<8"* `Q"8?π "@?В "@$b"8* J` l#"8 @#  6 4$b̀? a   ` ` @*` * ?"@!"<"@$"<"@@R $"<"8* J` 8#"8 @#   @$b$b̀ $b8"* ` "8$b̀  @c"| J"`  @Z/$b̒b*@ "@e ( $bcc 2|b @  @"|bd "@"" @  0@/$b@  b̀2 "d"b| "" E"|' ?"J ?   a   ` 2  !b ?K `  ` " |? "@ @d? "@" d$|  @ " |'@ְ 0""|* 'J `d  `@ d@d M  - * d`"  *@ "  dd  `@ d@d ^  @* d`"  *@ "   @ d@d  * `" d  @ ^"c b̀    W 0X  0Ub<$b@b "  ?5 0G? ? 0B"`""x @ 4@ 9 "<$b̀ #$bb!@l" "߀   0%"`L"`s`c`C @Ԑ   @2@b @+@    @   @!$b̰ 㿘""?#bx  #""b#b#"t p@$bx@? @    .       㿘# # 2<"` "dbh`@ ɰ 0"x ?#"x"` &` ?"  * "d``x ?"x` `?#   #`@Ne#`  |2!"d "bx" @NT "d` `" "` "`$"d`@ , "d   "  @N9"d "@x" " "x# "x"d~" bp  ""t CC!.  €o p |`" x "p"t "x a *"J" s c C b?@I@  E bd@ ϒ ? J `! @  5 !"d  ?@+?x"p* #b`"x  ` "  @M"d`  "` "d*@b  ""d` ` "`  |"  㿘  % @@  @@" @  @ @I }"d 2d8"  2@"Ѐ`2@!"d#bh"@` @Mq"d bh"# # #b@Md @?* : `yC"*` €@ O `! | , 瑐 HN` 3? "Ѐ JN`@" @v J @N7 ВЀ ``""@  )e   @M`,@Ѐ`  @@Me* ,@ ,@ $" " "dbĚ  ""`"  # """Ġ """bȐ @ "d` "`~" A`@ @ bd @" A HN@N``c  A`@ @u "dK`  ` `@f  &a?N@ c.'N` w W)d"d``J ? a   ` d"d `K ?   ` 2d    N` %  N@ c@@_N@ y@|d" N@ cbd"  ""b   %#b@& d? bd` "? #`" ""b %#b@   ? 4  "d` ?"` ǰ?"d b  ""!"d @"d @"d` ?"` "Ā  !`Đ""!?"@V ""$""Ĕ """bv#""Ġ """ A`@ @} bd"d"!"#b@.@ "$bȐW$"!"#b@!"@ "$bȐ"J$""d `" ""bN` 2 @ 6 4B?  d"d  @ `* d`? "`"  #""""d `V "Ġ ""@ "Ȱ#@  @t"""d ` "? !d"Ȁ`d`  `* !`d "`7 da " ?"d  A P A X  A `d @L) $ !"d  " @"Ȁ"b  @"d`@!"d  " "Ȁ"b  @#"d`@""d`""`d"h""h"d#bȀ !@I" """r$b"⼀@ ?"""|N@ |"   |  ?N@`?`N%`?'⼔@W␠   Z?@@ 0T""$@$ΐ? &L? dJ   !*`: ?   ` 2J  J  J ; ?8 ! J  ?   `   a* : ?   ` 2J  J * J  ?2J$ '* { L ' { !J?   ` 2  J  "  J 逢?d   bĀ ⼐ " ! J  ?   `  〒 @ǔ 2 ?@  ?  d` ?#` p"b"d ` g% # ) ~' bd  J@ @ @ `  ` $b#H !* H `@ `  ` $b#H X*  R (bd` `??"`bd#!"d z *"d(" bd@U J J `"?@ @  "` "d` @" 㿘@?* :  `t C#*` €"d`?@ "d`?@  bd   ?@Q  bd   ?@+ "d` &հ 0N@ |" N`"" | ǀ f F` ` a  N@ ,`?b @   2 0'd `?d`   'd  `@ 6?d `  4 0 bd   |?@ x bd   n?@A j"d  ? b ! J?   ` S  OJ"d ` 4 2C?0A"d` < :"d` d` d`@_J@ d $  ` d ` d?? d @GJ@`"`耤``4 0?㿘 ?!%#"p` bx@`? ? ?"d` ?"`$" 㿘&@` """d"@@G ["  { ( ) 0"  } ]  0   0 ???㿘#bd! #@Gbd#` ,"㿘c"dc "@G" 㿘%_  _$` @HG  $` $`  $`$@㿘`` @H8 ` & `& @@&㿘 !_ ̐_ ́㿐!!HP"d |"``#"h"""`#` P"`" "` Β!H {"@ ?!  ""#"@  $"ܐ#@ #@$""b$"""`c?@!c!%" _L&"$""`_F"$`" "@H1"" @H- c"@   +c" ##㿘@ 㿘`2 "d@@6(? @4" d"d  &?@"  @Fd` "` d @F d`"`㿘!"d " @Fې"d&@ " " d #" ?  2 ?,? H 򀢠" ??㿘5d w??t `တ .`!"d`("Ea` 6Aa ("9"d` & 3"d.`8  &"d`( a"d!N 2"d` 6 "d` (@"N"da`  N 2` ??2 㿘3bd [??X ? J`H 2? :`!@(?d,. `(2?% ,# @(2 d`aN 2  ?,  `(@"N  ??2?㿘d @gd ? `@ bdd  ?!N bd`@&Nbd @7@ (@d! `@6) (2` d` !!8 2`@6 . @. @ 2`㿘3bd 6??3 `` a I "da` N 2` ??2Id 2/  ? bd H  2?bd! & H  "?  2ڐ?㿘d @I??E `@6 d `?N " `@&N @@`@6d` N 2`@&N@??2IJ`㿘`"Ā@40?@ (""`  A` ?%d@Ewd$  " d  @D[d"`""㿘`"E?bĐ?@"=?"`N ^    `  #@ !?` 0?ITO3bd@E(bd$  " bd @D bd"`㿘"b*@ @D tB t@ @" " "b*㿘 #"#@ #@2b $* +  @rb$$b㿘d      "d  @O "d ` "쀢   㿘"d`      /$@2  : bd @" bd ` $@2  : $"d"d @ 2`@:`$@ "d"㿘 `@k@ 㿘"db    /)c7 `bd ؄ M - ^d  d@d` `  ,b`@, `2,(d`bN`  b,b`@ , ` `b쀤@ `  2 ,,`@ `@, `d   b쀦@@b쀤@ bd dbd  @쀤@6   ,`@   ,LN@@ "܀@3sL"ܐ %"ܴ ``bd`  +` <  >N  @ r". %""܀@㿘"܀ + "@rԐ @ ".$bܠN@rȲ`"ܒ @$"#$b܀$bܲr bܒ?@&b$b"" @  $bܠN@r`"ܒ @$"$b܁㿀  )! |  "D"D bd %"D\$ "D "%"D"d#\#``` ` v"줒 d@b?0Aj  | %"D"9d"`5/+- 3@  {#  2?@,`@@COw `?"D  " `d`"`bĒ %%&&b 㿀 )! |  "H  @  $  "H! |  "H"H bd   %"H$ `'%"H`  "d#`#\ ``` u覒 `@ܰ?0G@@԰?sv* 0s ',`@ v6 @+O97/5- . @v! @ א   ,`@+O97/5-@Bk @u+O  | "`?97/5-bd%"H^`bd"vӒ 2`  | " J?`/  {#  uĒ &&'"%3 㿀  #\  #`u蠒  rw u 0@<?   H     ` 㿘J `   Aq=    q# ^ @q 㿘 !H" " 㿘@q  q㿘!"Ѐ  "`Xג`$"$`$`㿘@I W X X X X XH X X X X X X X X X X X X X X X X X X X X X X X X Wt W W X$ X X X X\ Xl X X Xx X X X X X X X X X0 X d d d4 d( d4 d4 d4 d4 d4 d4 d4 d4 d4 c d4 c d㿈    '  '   @-) An7 |`3iU!*` € ;# a` ;# `[  ;@c |U"` ;#J@ ? `@ a   ` @> @* ::  7` ;# `1  ;# ,`  ("a4 %` ; @'@ % ;#  @ | " A`Ȕ @I  "a( @@w ?? ~`t* & @ @ A `@@e  2@@@@ (@@J ? a   ` "@ 1 A @-& & Aa @O) !,0$ b@(ϔ?` Aa @IW   @ ? & Aa@O   Aa0@ID ` `@x0P` @0J ` @80B ` @08 `  @e00 ` `@ @0% `@   @  @    AaH@I @  @  Aa`@H ". Aax@H @D2  㿘 h  A ~a@'#@x 8 ~"Ġ' P@ b@ V : 2, A/"`  .@ K `*@   !@ &`&`   !@ &`   !@&@    A@T"x ~" |`  !,???0'D''b '@'?@` A@Dt ~b@N5  l'D  !, |`?P??H7P0'Hb"?X?`?h?p?x???'L7R@'ƔH?D Ab@N  @ h ?D`WP  A'D Ab A A A"@bWP/p/X AАp@j R AX@b T " A  " A4 A   A#8" A A#8 A " "###  A#( AL@ @8`'@? d `7 `? d  ,'@!4`X@.  AXH\@ @``CpX A#\#Ph@sp dX A#\#`#p@ghd @  a,? |??'`0b!??????????? ''@' ? Ac@MT  " A  " A4 A   A#8" A  A#8 A" " # #  A## A#(` @   AȔ@ !4`@  AДHԐ@ @ A@ O H@ ǔ H AcؐH@  HO (@  ( Ac@  (#\ A#@˚a(   B`0 B#\    @ d`@[ ~  B@÷ 8㿈a,?* : `'U"ē*` € ' ' '  ' ' B`@@Fؐ  |`0@&Ab#?2N B``@L  g  " B B   B@k ppגЀ " B`@F !, |Ҕ '0`'777b%@&? B`@LZ 㾐 ~"Ķ' " B`@F !, | ` ? 70'7b$'@% a,?' 0?b ?'@%ԔЀ?  Ab@L  @~pr ~ @j B  5 Aa,?' 0b"?????????'@%? @K @ڒ C >  - A/ Ba,??? ' 0b!?(?0?8?@?H?P?X?`?h?p?x'' @%?@K͐ @@ Op @a ~ a,`@a, B @a ~"  B@š 㿀# A`@) ?0 Aa`@K b'@%:? Aa`@E   ?'0'7b$@%&? Ba@Kr @?( ~"Ħ'` Ba@E @7e$ 2  Ba0@KY $@<Ɛ@. 2  "  C   B aX c BaX  @Ey  ,  Bap@Eq 2  C  |   Ba@Ee  a,  ??( 3`?'77'`C?'8% |0  @<|  @"X@!E @J ?  C C!@2bX   C C"@[bX  2   C  C"(bX@[ 㿘! h# ~  Cbh@c  Cc@b@  㿘@ǔ T l 4  h < P㿘@1  2"  @E  "㿘@1    @% &  @D  &㿘 @1 @12   ."@, J-`?` J  *8  + J (J? `2 "@ 㿐  ’ 2  @1x $$ 㿐  C b@Vu? @D  & &㿘 2  `?J@   ɐ "   㿘aP   8"aT ."aPL`*L   = C"@ "#"!TL  `<" `>`! 0 0  "aT  "aT  "aT. "aL"T㿘 Cb@>g 㿘!!T   !L @!T  0` ~bĬ 'aT M) C VT`@\j "  @8!"ؔ@>   @  Ѐ  *@ "    C "ƐĐ@g)aT   C@"㿘!T//   C   Cb@=ː 2` @6\`& `  Cc@= @8 & @ & T Ҁ Ѐ 㿘!T    C   Cb@=  ` `" & QT ဤ 㿐Ң aT sĐ D -? (?` X`"$*` € -@@J H @D B  /@1 3 `^?` -`!*` €  @0 $! 0 @082  @02   @0 4 0  @0`? @0@ ֐ԐT      㿘waT ; m    aT 㿘aT   aT 㿘 Cb@g  C`@Fc "``"!P !T`"%  C C @5#(0 @1#0@㿘@h    ;`N"#0#@ CH@iސ`M`>䀤<  & ?'Ȑ ̖Ș @2%  CcP@B ` @. '̠  Cch@<<  @3j̐ 0''Ȑ Ș @2  Cc@A @2  쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @ Oـ  C ~#``Oؔ?"`` #`*  ##`@Yj #@`@ ` ~``?"`` * "`@YO  㿘 h  C ~c@#@M 㿘@㾐 ~"Ĥ '# C' ~) D @6@ic؀? st* & @ @'@ " @2@o@  Cc@AD @!  Cc@A;   @ . 2* @@ 㿘 h  D ~`@#@ 㿘 I@ 8@ @!o@  "?dt" " " " " "  ` ~"Ħ' D 0 @ )   @  2@ @!@ >Ԓ?@1q@X!, @8!,!,O@4  D@ @㹈 ~"Ħ'@(耢  `n D!@ < @ @ `0#$@X"/@2%  D D $@ @2? @@@2? a ,@`; D!@VQ @m !X@``@1?,@] X` D!@43  D!@-, e`e@  ` D!@@4f @4b. :`@ z` ` D"@Vr   |"̓*` J@     D@"(㿘@`a@ɔ ??@i @i @i  $ @4' 㿐2&@y? " D"8 D"@@ / @!`@A5 a#\ D DHXX$@Y# X@̒ X&@I ?"`"? @@`5 D D`XX@6$# @X X&@& ?"㿈   ?'  @/ ?㿈 D Dbx@㵐"h ~ c@0- @@ # 2,L@ S D" @ J Db@  " @ L 0 Db@  ` a   @ `  D D"b @踔h@   D b@$ b@ɔ @ J *@+ 쀥 @+@㻐 ~"Đ'@0c( @z ?" D D:b D"@ے #@H @f` D Dbؔh @[@> O ~@S`H D Db@/,@u   D Dch@7 0 ~; D9 D ?- D!+ D@c @#( ,@$# @" bh@0@ ޠ @u" ~"  D@#0㿘N         !*`: ?   ` "N N N - +2N*:  - +n? 2Nk  N`-`+*N C !*`: ?   ` .2*:  .`J $ ?Ѐ`5`- @-`B2*@ *@B `5-@-B2*@ *@B  N 8@ @ N |l>@`p @\l @Xh @Td  |#HcP  K@  `  X*`@ R` 2L N ? a   ` ޑ, @@x #?@ @  @  @[`    @    E>  (K@@ ""?㿐    2`` |#P@3` + @0;   |4  |@İ? ""#P |c( ? @3` + @; ,2& !, @@   P@! @ `ʨ 4`,  ,`@B2`*  *`bC eC (0  8  `   &`F F?    Dc@@ 9  4 ?`c ?! | #H 4 2  |` &`F F? |#HJ DH@/  #HJ D#`P#\@!   ~"Ĥ' D#` @ "@?P  @T@T  @T!@댐@T:!,!,@<@0  D@g#p㿈   ?'  @,u ?   @* J@ " 㿐'D'H    D#x-'N] `.`?: -@L2 Ǖ< 2 $ '    ?L@ "'`.`: L@@  @:  ?'  ``@) 2@(u @, .`   &D@ߣ  Y-: U R@ NHN D..`  L   <,@ L`  2,@L "),@L  $>   < "; "   2 "  ,@ `  ,@L Ȣ`,@@,H 2" ~"Ĭp'@t"!X  D@,j# 2L D c /$ D@,[#  D@,S# ' DJ   D@$#($@@$ $@*@$$@O` J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @ .?'l@?l l l@$@K : ?L 2,? l  l%aX ?@'??   D@#㿐aX@Ԓ ?㿘aX :@В@ 㿈 aX///@Д찒  $@`@@ @&@    | D  ( , ̝㿘!` 1 D#*!N%Nۀ`M k p*` €``,`` !`c!ސ@. d 0,@ daР @.  0,!Ɛ@|  0, "\ZN@ N R@P N @``` ! ;#l`!) ;' D! ;#h`"#l@ܔ `` 񀥠!:1 D,¬ ``!:w1 D,@.C * @$  `` ?$@* $@Nf `$ @$@U:T1 D㿘 z N?  a   `  !N,  N*  ?А   ` , ."*  N? a   `  N?Р !N?   ` 2 N * @,  *` ƀ: N   ;cp* 2  * |#: *`2`:`@: @- 1 ;N#rƀ? N#r㿈?@4 !? |c @I 聠"# E` @< !"# 聠"#P? '?''   DD"# !8    "#m  ƅā"#\: 'Ԁ 7 Ԓ?'2` @'* ''  * '̒ 'Ԑ`̐" 'Ԑ ̐" 2@@'̑* 'Ԓ<'  'Ԑ `  2 @ @' 'ԓ: ' 2 @ @' ''''''Ȁ )Ȑ ' Ȑ 'А" 'Ȑ ' 2 @ @' 'ȓ2 ''Ȁ SȐ ''  1 *Ȑ ' 䀢   ܒ 'А" 'Ā ?'Đ" 'Ȑ ' 2 @ @' 'ȓ2 ' = E` E@? E`- E` E@D??'ؒ ' E`?ؒ ' ' `@'ؑ:` '2 'ؐ `  'ԑ*`@'''?聠"# l D   4 D T d t DŽ Ȕ l t ˄ ̔ ͤ δ t 4  4 L \ D ,  | h T @ ,   l D   4 D T d t DŽ Ȕ l t ˄ ̔ ͤ δ t 4  4 L \ D ,  | h T @ ,   h??'T ~c`@??T  *`n  'T c E`  E`(' E`? |c`@ !"Ȑ @ !  |c`  E0 @N@ !"  'T c E`H E`P' E`? |c`@ !"Ȑ @   |c`  EX @M@ !" ??ؐ 'T c E`p E`x' E`? |c`@ !"Ȑ @   |c`  E @M@g !" j 'T c E` E`' |c` Ec? ax? |c`@> "" Ȑ @ o @1 "" 4 'T c E` E`' |c` Ec? ax? |c`@ "" Ȑ @ 9 @ "" 'T c E` E`' |c` Ec? ax? |c`@ "" Ȑ @  @ "" 'T c E` E`' E`? |c`@ "" Ȑ @ @ "" 'T c E` E`' |c` Ec? ax#? |c`@p !"Ȑ @  |c`  Eؔ @L@W !"Z 'T c E` E`' |c` Ec? ax#? |c`@, !"Ȑ @]  |c`  Eؔ @LX@ !" 'T c E` E`' |c` Ec? ax#? |c`@ !"Ȑ @  |c`  E @L@ !" 'T c E` E`' |c` Ec? ax#? |c`@ !"Ȑ @  |c`  E @K@ !" 'T c Ea Ea ' |c` Ec? ax#? |c`@` !"Ȑ @  |c`  E( @K@G !"J 'T c Ea Ea ' |c` Ec? ax#? |c`@ !"Ȑ @M  |c`  E( @KH@ !" 'T c Ea@ EaH' |c` Ec? ax? |c`@ "" Ȑ @  @ "" 'T c Ea@ EaH' |c` Ec? ax? |c`@ !"Ȑ @  |c`  EP @J@ !" 'T c Eah Eap' |c` Ec? ax#? |c`@` ""Ȑ @  |c`  Ex @J@G !"J 'T c Eah Eap' |c` Ec? ax#? |c`@ !"Ȑ @M  |c`  E @JH@ !" 'T c Ea Ea' |c` Ec? ax#? |c`@ ""Ȑ @   |c`  E @J@ !" 'T c Ea Ea' |c` Ec? ax#? |c`@ !"Ȑ @  |c`  EД @I@{ !"~ 'T c Ea Ea' E`? |c` Ec?Ȑ @    E @I@K !"N 'T c Ea Ea' |c`$ Ec? EcD? E`@l !聨D Ec?$ ax? EcD? E`@J !聨D ax#? |c`@~ "" Ȑ @ @~ "" 'T c Ea Ea' E`? |c`@~ "" Ȑ @ @~ "" 'T c Ea Ea' |c` E`? ax#? |c`@~ !"Ȑ @  |c`  E @H@~m !"p 'T c Ea Ea' |c` E`?  E` E@? |c`@~@ !"Ȑ @q  |c`  E0 @Hl@~' !"* 'T c EbX Eb`' |c` E` E# E? ax E`  ? |c`@} "" Ȑ @ @} "" 'T c Ebh Ebp' |c` E`?  E` E@? |c`@} !"Ȑ @  |c`  Ex @G@} !" 'T c Eb Eb' |c`?  E` E@? |c`@}j !"Ȑ @  |c`  E @G@}Q !"T 'T c Eb Eb' E` E@? |c`@}0 !"Ȑ @a  |c`  Eؔ @G\@} !" 'T c Eb Ec' E` E@? |c`@| !"Ȑ @'  |c`  E @G"@| !" 'T c Ec  Ec(' E` E@? |c`@| !"Ȑ @  |c`  E0 @F@| !" 'T c Ec  Ec(' E`? |c`@| !"Ȑ @  |c`  EH @F@|k !"n 'T c Ec` Ech' ax E`  ? |c`@|E "" Ȑ @v @|8 ""; 'T c Ec` Ech' E @/ !? |c`@| "" Ȑ @G @|  ""  'T c Ecp Ecx' E`? |c`@{ ""Ȑ @  |c`  ̔ @F  E @F@{ "" 'T c E` E`' E`? |c`@{ ""Ȑ @  |c`  ̔ @E  E @E@{ "" 'T c Ec Ec' E`? |c`@{v ""Ȑ @  |c`  ̔ @E  E @E@{X ""[ 'T c E` E`' E`? |c`@{; ""Ȑ @l  |c`  ̔ @Eh  E @Eb@{ ""  'T c Ec Ec' E`? |c`@{ ""Ȑ @1  |c`  ̔ @E-  E @E'@z "" 'T c Ea Ea ' E`? |c`@z ""Ȑ @  |c`  ̔ @D  E @D@z "" 'T c Ec Ec' |c` Ec? ax? |c`@z~ "" Ȑ @ @zq ""t 'T c Ec Ec' |c` Ec? ax? |c`@zH !"Ȑ @y  |c`  E @Dt@z/ !"2 'T c Ea Ea'? |c  |c` Ec? Ȑ @= @y !""#x???'?'?  @  '?"#㿐'D'DD `D `??'':` ':` '|'耢 耢 d ܐ "# ܐ@'? 'ܐ ܐ 2  @ @'?'? Ec * $%D? Ec * &'??'? * '?ȁ"#0c: ' ܐ "#~2 ' ܐ 耢 ' 8  :@  '=耢 3耢$ D"#Q"#J%?2@' "#82 '  8 ܐ :  '''? Ec * $%D? Ec * &'ā"# *  *@2@*@    2@ : :*:       @    㿘    b`  ?   b`  8  R  @ $D` @  $$`@ $:`  @  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#   F 3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         b`㿐? F  @  ?@ `㿐? F!  F Z ! B F! 7ąB' B'@    ɖ @> . 6`  `6 @3 @ F?!  F$%! 7ąB' B'@@ f !  D'…B'@@ F #dd F#dd`( B B F0BD# ?B#82    #dd F#dd8 B B F@BD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@   F!H4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@@㿘  R  @ $D` @  $$`@ $:`  @  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#   F"H3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .      㿐V  $D`  $$Ā`$: 7 @   $D`  $$`$:   @ $D` @  $$Ā`@ $:`  ??#@? ?#   F#H4   "   d `]4 6 6 , ,    "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @ @b   d , 6 @4 =$6 c@$ c@㿘` ` 2 `@ "`@s? "?` &``@ , :   @ * &@@=㿘 L@  .!!*!@@J /"J /2 L@ /a . /*a *"J /"" # 1!@.@sQ  ?"` " (0 (`0" " #`@"    `  0 "! H P """  """㿠   @" &  g @㿘 G`H @=L x  ??''쀢'@r " ? ;#t *@ @  '@؀ ?؁㿘@5>@  $>>2   *` 㿘 ) 3 & `&   &@? , 㿘   2?2?    `*`,  @  ` `* ,  &?   2 ?`2? ?   2 ?  2? .2 ? 2 2 . `0 *`    2?  2 ? .`2   ?  *` 㿘2  @  @".. . . . . . .    ?  ("   *㿀 ~"Ġ ' 2/?  )?2  *@6 .`. @` @`'`'` ''&@&`&` &`   ` "  G@H X ? 2?2 &? 2 2 0 ` *`  $  1$( G+ p G(  G%  G"  G  G! G!8 G!P G!p G! G ! G ! G! G" G"(㿐  ?  @ ?? % c@ 0 h h h h h h    p    h h h h h h h h h h h h h h h h h h ` ``*`?`[`#??  2&+` `  `  `  `?   +`\ @ +G` E*` \+  n+ \+  r}+ \+  bw+ \+  aq+ \+  vk+ \+  te+ \+  f_+ \+  sY+ \+ Є 0+P + K+ ` 2 ``*`?`[`#@ ` \+0  00+ 0+ ` 0(+@` \+  M+  `?     ^+`  ? +`@+ -+ +  +㿘@N@:`@*``2`"*㿐N@ nl)  *?[#!@  ` 2%.    #   !@  ` "`. \  @2`*.?  `` N@"@ @ZN@ 2.(&N@"&` N@N@"&㿘 N@`zN@8N@N@p "*$ c@㻈 ~"+a'753 G/ G@4$  G@Ǽb@ X# G G"H@a%a )J #@w & @r & @޴bP  X @ެ&  G"` G"h&  H@Y찒    #@!$ H @G찒    #@ך耢$   bp@2a %aJ #"bp@& $ bp@! $  bp@쀢 i$ $ $  bp@찒    #@ɣ耢V$ bp @찒     #@ɒ耢E$  @$! G"x@ !"@+ * G"@$ #X@ bP@ "$ bx@ʔ @   G"@  G$   @ O"  G@" 㿘!`@:    1 !㿘@* " !@ʒ ! ! 㿘@  ! @ݴ  ! (!! 1 G@ 0""@' Ā@<   G@n# O ""@ʒb $! @n @㿘!! @B$!p G" G GȒb   ''''''@ӊ@'' GbА '' @  㿘@Ё   2H( HJ  " H?" J  H  2*? " 2HJ$ c@㿘`@m? "@ % 6`? -&   ,,-`@ے  6 @̐ 4ݢ2ت`k@ @,` @ @,`  # @   @-  @,`  (5 : @z@v  6  @,`   @,` ڨ@ T $ c@%4 c@% c@$y c@㿐 @?.@ .  ?#@.   ?#. ` '@U   ! ~"'L'P'T'X'''" ` ` @! 7'@'a''''Đ@}L"  G@ "؁$Q c@$v c@㿐 #\@( ~"Ģ\'D'L'@t  G@"ࠒ L  G Gb@"蒒  .``2 @DL@X,`  G G"@b  4`@ LD @@lȴ G4` @&  D??@ ?? '''@1 ? `!!@V!D!" '@  #'  k@@k`0?`'@k`=" ` 9 @k /#\``! @  Gc8@!% ~ GcH@А@k"@ `#\/`!` @s  Gc8@! Gc`@ൔ ` `@-` @k@2 ~  G#@cp @ N @V_?`@T % @k`# ! ~ ~ G#@c `# G#@kwc @ @y`  @ % @-6?@^`@` f`@`  Gcx@5 '@!'@ 4`* @ ʐ ^ @ G @5@@ @5o@9 @ @k#@ж ~ G#@#c0<@6 *   +6`*`% `+ @k%"@   @ Ƙ : @j`  ~@j@ ~ G#@c0 G#@c@ @r @j@e ~ H#@Ғ`@l'   #\  @q  @= @R@Nɀ '@  #\  @S    ~@# ~@!  ~ H#@ߏ` E@LL @4@ @4@ @4@]  "O@jj@D ~ H@#@h`P @E   @4 O`   @  @  ~ @@@ @ې @  ? ~"  H@ `p  ? ???' H`h'ܔ@5Ԁ ?0@ְ 0Ԁ   @,   2 @?㿀! ~"Đ  ?  ?'//' @ "  H@] p  ~"Ĭ'   H H @{` `@ @\ @`2W? |#`"P?@,ܐ J  H@ݧ$#8A?@ @ H`@E@`1@!   H" <   H T`@\  H 耢` @ H!  H!  ;"#x@ݛ?  H@ڐ!@㿀! ~"Đ  ?  ?'//'@  "  H@!P㾈! ~"Ģ'@!?쀢`# =` ;` 9` 8  J? a  J   + : a `@ `   + :  X*  R  * J   р?ȐJ  7 *  J " "  J    !J?  J     J   퀢?*J  @  L + -L   @ 56 @Ғ -   @0& L   @ ?@    @0Ȗ @T @OL@ + -L`  @`0 # ` @0L`  @ `` @0 @ס  ?@ך`?  ?  4  @x 2L?  H@!`` ~"Ģ '#\ /! @ 2;    ?ؐ ???' H'Ԑ`h'̔@ ̀  &b@! ̀  /  !#\ @ 2  @8   2/@̰ b  H@;!p` ~"Ħ b'#\*bؤ /! @` 2S  #\ ! @S 2F    ??ؘ ??' H'А`h''̔@̀  0@C+̀ ̲ /  !#\ @& 2  @ђ   2/ " Ha@T @̰   H@ʐ!h ~"Ĩ\'  H! @    @  *`@ ٰ? @" Ұ?  @`=`(*  ??'؀`6` H! H!Ȑ @,?"@  @e?@J@^  H6`@" :?8?@3   0: < @ 8 22``2`*`        ?#@2` 2`  2`   `? ? `MK``2H? 2@Q" =?@  7?! ;@ ː#|@FS@ Ɛ#|``@ @ !?@@ "?  @   "Ĕ@ ? "  H@ΐ"㼐 ~"Ġ' @" (?@ J`@@Ձ `@!   ? @  %@.*`   H@"㿘 ? ?   ? ? ?@ H  @J " @   H@  ?㿘 @/@P 2 `"   @7    @&㿘! >Ք#؀  #؁㿐@    􀢠 `" ` 2`22  @ڔ @1@e"h`'X H"('X@(   H ~ H#b8@z? @גbX  @C  2 @C  2@۰?0&   @ ܖ  H"h@  H"@t?0@ @AC  H @A=   H@a" @  H@X"  @/l  "@e@ʰ  ~ H#@bv @{bX !X@u X J@ 2'X H"'XX@t / "X`' Hb'X''@q0Z@2  X@tԒ / "X`' Hc'X''''@qu0AX# H`@ 2@xX'X@o X ` c H@# "c&c@r 2J@@'X@@t / " H`'@ H#&&&X&&@q4@d@& ~ HX#@ْc @ +@? x؀ N   <@'$  Hcؐ '' <@c@x$$   H# $:$$ }   H H #Ԁ H I 8* 㿘? @lЖ 㿘@ 㾐 ~"Ġ'@!`` 0 /@d#? .+",  @.P 6!?4@c44@ @l @d`0 4@, @)?2@@ ?$  I@o 㿈 ''@$ $΄ c@㿘@c֠" @ ?2 @c`2?  @e& ? ? 4 ?㿘 ~#`@$= c@$i c@㿘 @nf @c? "$: c@$) c@x" '" "  @ݔ؀ ?  '?ch?#ض  @  ޺ ?@ ?# @!?3?a/?#?  ?# !?#?󀢡?#?  ?# ! ??󀢡 ?#? ?#  ̀??  ? ?# ! ?#?  ?#  ?U#؀Q??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    L # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ??  ?# ! ?#?  ?#  ?T#؀P??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    K # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ# @[ ?`?D '#\   @2@   x?@az? "@5 a` , 4 $    "?J 2, ?:#@ :E4&@ @? ?`)` ` % _ J _"@Ш 2 `?$  ` , `4  ` ,  "J 2L Т` 8@ט `?@g0#@+BSF  @   `? ?b ~"Ĵ' 4 @ 4    i Ӑ d?cH @ ]@%آ   #\   @?@C F ؐ @n 06*` *      @ `( ( @ @*  @    @8@?#\  @f??@ ,`4`$`` @  `J 2,``z0d %`@?`W@ "SL "O @Ϣ " L _2;`  @Ϙ 25` $` ``"!  ``  ?#@ " #`   ,`@ ,`,`  ,` 2  ? ,`4`  ,`` @ "L  8?#  @" @- ~@*  ~"  I@D (㿘 |#?  , @€? 㿘 ' ?@I㿘@ $S c@㿐`wĔ ?㿈0  I8@ `@ `@0. .`0 ?@0@ ///`///G/ @* @ * @ * @ *ֈ 1 ///  @. `@ 6 ` . (06`/// I8@*@ *  =@*  =*  *?㿘 H  8 @W e "`   `9N +`3N@R"@* .@*  `I"@@: .@@**`  ` `9"@@: .@@**`   @+"@@ .@` N  a   ` `2N= I=B N     ; 86? !     ` `2N=2"?N  !   ` "?N ` @ ?0?㿀@' ''''`0   `a ?"a@O㿈' `1 ` I#\ `#@K #㿘  0 @ @2@^1  /"x ~"Ġ  I  '#\@   @^  "@_b  I@ 0 ~"Ĕ  '????  4 :`*`$*`#@ * * # ?''  ?,` ?'' ' ?@$'''', ?@''? ?'P ?# :/ I @ 2: :[ ,2 :R ,, ,  , , @$ 8 @v@$@aఀ $6)   @    @ :,   ",@]; " @̂"  I@ $ c@㿘 N  . *  /*@!J /"  J/ *  *`@" J /2"  #1 @.@\  ?"㿐#\  @4o  % c@$/ c@㿀'@! ?''@겒耢 @&$" c@$j c@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" $' c@$+ c@$ c@$. c@㿈'H'L'P'T'X H h ! IȐ @Ғ('&  ("@ @y ! h  I @Ϲ(!  |   ?'  @B  $   |c "" $7 c@$8 c@$  c@x I I"`bh?' '> ''@- @\0? "   @ '? @  ;b` I"p@ [麐 O  K ܐ@h  @ > ; ??܁$ c@$ c@$ c@㿘 @ɒ  I. "x``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ *㿐`2&@2&'5+ IL@ 1 I"x @C  2  `@8 2  `@ &@  & ڤ   @gc࢒ 2&  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@$ c@$„ c@㿐 I@# I_#L [@ Q J" J``MJ  1 J`M* J`k`G J`K`( J#  J  J`m`g J  J  J  ! J % $ J $! @"ɒ"% @ J 0@" W ! J P@"c""! Jp @  &&  &&@ $Ä c@$ c@$u c@㿘 $`   @ 3  $`$ (` % @ ' $`$2 $ (/ `$* "@*`@ (*` # "`$@`$ * "@*`@*` @$ ( $  (@  $`$*`" *   (* @ &`$$ c@$b c@$ c@$ c@$ c@$ c@X ~"Ģ>' 2 |@: 2%#! #  ` @  2` "`@ `@u 2 JА@" 2@+ @cb  J@#㿘 |# "  @k  2  J@1 J#$9 c@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  㿘@@ @Ǖ @㿘a   @ %= %Ha@Ԓ Ȁ @Q  aa`? "`@w @  "@ ဢ0!L?   ` 2 *:  "ΠH #"ˠH`0"`0  @*$`L $`$`@$`L $`@ 0"` "`L L %  K`@K   KL  `@ `  ` K` ?$` `@3   KL  `@ `  ` K`  $` `@   KL  `@ `  ` K`  p$` `@   KL  `@ `  ` K`  X$` ` @   KL  `@ `  ` K`  @$` `(@Ӕ   KL  `@ `  ` K`  ($` `0@   KL  `@ `  ` K`  $` `8@  LL  =2 L@n$`@%L E KL #" L #2  0 L "  "  0& L "& @$ 2,J A"62 J\2 J ""  *@'`# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@Ւ =   㿘1!   K K @@,`P&!@ @` 㿘1!  @ʥ8&!@ 㿘!a !@  @ ! @VS"  ~"Ħ'@% P @  X@V<P< @ H  KD " XX.@  K.`  `.`  .`  .` .`  '  ?8h8 '<'@'D'8 @H 2 LH @ "@` @  @@   K@d p( K@? X '@U+@>' "@># `@ @_@|  @@`@@}c 2@>Ȑ   c@"` z{{{{{{{{{{{{{{z{{{{{{{z{{z\zdzz{zzI @Jg" `8o-"H  XJ+"F J ?`F  u2B a00 `   +  *@+  *@  *@* @* @"    @ *@"  @  㿈M O?'@Ґ @, @, @ʐ  @ 8  , M? `0 a   ` 3 @Д J`@B@T " @ `  =@/*@*@T " @! 0 M g  o a *`:  u*` : mid8` :  +  - =`=*` }  ?* : ` n" *` €$`" `" b II -@ & ? ?@ <@ < ="  +` -@ & ? ?@  X@i  -@p m& ? ?@ M<@R?2 << = ``<="  -@K H& ? ?@ @-` -@3 0& ? ?@  X@P M  ,9*` .@T`g"*`o`= -`X`+`-0>0;`u06*" -"   +* ("  %" *2 ?* "  * " +-  =  *   - +  X"`" `: J@+-X2@   `J@-+`8  X`8  `( " **   " **  "J@" ** ʐ $! c@㿘'L'P'T'X@L㿘 h ! ~ K`@3#`@X# K#@)`@|z㿘 @&@G 2 `   @>&㿘! ;ߒ"(  "(㿘@  K K @`&@@` &` 㿘 @&@6  & @2& & & 㿐@   K K @v` &&@@@  􀢠"@L@ # J?` '@ # $'`@ߒ` ?@8& K&` , @` "@, L "  " @֒ਢ ,@`@ "@J 2@`#@4@& ` ` &`@    &`@R_?z@RZ9"``2& ,*`:  # "" ` *`?2$ @y*` `* &` $ &`@ & $@ਠ ,  "$L  $ 㿘 ;&c㿘 ;2#㿘! ;c<"4  "4$\ c@$; c@㼐 ~"?  c" '` $ < `7 < @  &㜐``"Pb@""P" 3 !/@  *`  @ *  " ` 2 @" & @.  "ܒ @ %@ @ "  '@ @- X`%` @M`@ @" E&@@    <D &@/ %     ?  ` 2 .ဢ߀݀`2 @@ٔ!` `ؘ  K @` 2@@"` @`  "` < "c  ~"  K@z h ~"Ĵ >`' <!Ȗ @Q#@h ?А@! @F OЀ   K`А@>  L { / K- K+ K) KL f"e4i` b2f``2c`  ؒ *2#"0  $@0$@Ĺ0$@IJa0 #\$! @ĩ@0@ )  @@ @` @  "& 2   22 & @} 2 Ģ``4 L  f   K@y!@㻀 ~"Ī >`' <!Ȗ @#@ ?@lF! @ᚔ O 9  K`А@ 2 '4+ b2($@@@   @ @ @ +@z b0@2  bĤ4 L ΀ f b  K@y!P㿘 ;c @:@Y  c  c @<㿘! ;#@! @   @4  @ 2  @㿘!"耢  K K!`@gap$"@ ;c"c㿘!"耢 " ;@$" ;"#㿐b耢    K K!`@Eap $@ y J?` 2'#!"@, L@ #@ # 2,""@{ "*  K @ax , L%L "  " @x ,@`@7" " ""`  "'$L " *`:    $@; , @ux " $,  "$L  $"㿈L@ 0  `L@ x X2 @ ` @, `< !:`?   `  H, ?Г:`! $, : ?   `D : ?.    ` ?? ` @, `ʖ*:  . `$? a   ` 2$?$$:  . *  $ c@%2 c@㿈 2 ''   @ ?) `"@좒    @ ? @N_ @@NZ"@@ @NN " $ c@㿘c ! @#@N8@ !  $N @N+ " 㿘@g#% } !#@G  @\c@N#$*` @# @ @#@Kc @Gc "㿘!@>#@.  }" @8#x@ Kaؔ  ' ~'''''#`'@ϒ耢  ?2"2   *@`*@ `2E   *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@`    *@`*@ `㿘'L'P'T'X@L㿘@Mo! ~ h  Ka@p#` @Õ# Ka@f#@ K#@_a@v㿘  @$ 㿘 ?*` * cN  2! #` @ǐ  $`@ 2$` 1 K Ȕ@&   @l  㿘 ?*` á* `N  2! #a؀ @  $a@ 2$` 1 K!@ ! @;  㿘!Ǥa  @*!Œa'  @"!@!!`@ "     @ " @㿘Ӑ 㿘Ǡ@!@    @ a,@@!  㿘ǒa  @ِ!Œa'  @ѐ!͒㿘 "@Ly '@Lo @Lj"㿘Ǡ@!@L    @ a,@k@!  㿘ǒa  @!Œa'  @!͒㿘 "@L( '@L @L"㿘1! " K@1!4ǀ`"!0@c &!4   K!@a&!@ 㿘@ 㿘!@8!  "!, @/!㿘!!  @#a4$!`"!0@1 $a4㿘!@!@!X ~"'TT'  { '@T)Ǥ / K+ K!0 l!8` !8@F `%!0@ !0 # R 1P'a4 a4̒#\'#` !8<@Р@a4 $a4$a4$<)!8ǖ<@ښȀ @%!0!0`"%!0@t!8@HȠ@%!0  @!0̒@ܜ@',!@$ '@ 2L!!`? "`@ @  "@ q0 +Ā`b L :`  \@ o !ǐ V%!0!8 !8@ N!0  K@ !8 @@!8 Kaؔ@њȠ 22!0̒@-@9',@X(a&@X$a&@X a蠒 "!0@ J@ !0@  K&I&@< @Xa耦  " @ !0 %!0@O @Wa耦  &"@ !0@Wa&@Wܒa蠒 "!0@e @ϔJ@ 2!08!0 &Ā!0Ā  Tc@%& J ,  *"@`    ""@*"@ `" Ā@  '"@  ~"  K@s!$] c@㿘ǐ@a@%3 c@%$ c@㾈 ~"ĸ' @J   "bĬ?   K!  " @I "  !p'p'' P `  @ 0      %@ڣ   ?????'̐ ?'•  / @  ???''????'???'Ā XĀ S @@픐@Ò@-+ /O? a   `  O`  X*`@ R`/ O` ~!*`@ R`/, @p: O` ` ɀ@I@,̀` Kb@z @J , p @j? p@I'`p : P 6 ` 2 @ .  * 0 &   "     Ā `@I@SĀ`"```ǀ`@H"  ~"  K@rS"㿘ǐb@   ā` ~"Ġ'`''' ''''' '$'(''`  ``0 0 ```Ô@H? ""  K@r" < $ b(" c4" p ?" d ? l0 " - ?" s ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$d c@$ c@%% c@$K c@㿈 ! } K 0#d   #\#` @  㿐L? a   ` 2  ' @ @#  J@`:`ဒ `@ `  `2 .@J`".@ .@``֠ 㿘!ǐ"Ȁ  "ȁH` ~`` K`#\`P#`'@ #d@Y@d K K"h@bx  [?@@}U G J?` '< @ΐ ,  K, b@Ô$ @Ā ' KĒb@ @ @h@  @  @T @,@F? "  K@ph"x ~"Ī'@ K K"h@bx NX?@.@R  J?` '؀; @[ؐ ,  K, b@P$ @M䀢 & Kb@܀ @,耢 @@!  @ @ @@F? "b  K@o"㿘 &N    !N?   ` 2  Kb@FA@ @FG? " o c@$  c@JJ2 @(*`*㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& 㿘 ~6 (2.?  *@`@  /2*@N @M  K@荐"В @t "%  @ 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@Ւ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@   `- `*`  #@-  㿘@@㷐  #\#`@  \`  : /6@ " ^ "$  /;< 9@(@2 @ 2  2  @ /< 62@ `$ @1  @2 `2@  /2@  / 8  6 /  #\;`@㻈\ ~` d Ĩ'i @C6"@U 2` ` @Ɣ$ U?@C~`€ L?` "H GD @ /`41 )#D .` ." @4 ` @ ? 6#\#`, 2`  2J`` @`@@,F  K@l"؁㿘`@ `@, @Q@័` ` P?@fL&`  `` *`@,&`?$@&`  @ `"@: @@u& @& "@@: ?` * $@`&@@` * $@` @   #@@Bİ?" ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@?`@ & 㻐 ~"Ģ'  @q$   b Kb@s$` @` @@+Ub  K@k"㻐 ~"Ġ'@G$ ? @$€!b  K@km"㻐 ~"Ġ'@$$ ? @(€@hȒb  K@kJ#    (*@ ` 2  㿘N@  @1   @M $@ $@$ @ 㿘 " @ 2   2 㿘`" &@@`@Ґ 2@&㿘"#0``(J@ #0@r  `@Ҫ#0"@h @#0" `#0J@ #0@Y  ` @ґ#0" @O  @"   K#0c" "  "" `#0J@ #0@7  ` @o#0" @-  @"  `#0J@ #0@  ` @W#0" @  @"  `#0J@ #0@  ` @?#0" @ #0" #0 $"`$&㿐N@ ' ! KJ@` :'`J@ `'@N#&@N#& @N# [ @ TJ 2 M& @N# G @ @J 2l 9` 9& @M#& @M# - @&J 2R #@4M # @& @Mϒ#  @ J 28 @45 @4 & $0  K#& & & $@M#& @M#& #@M0`& `& 0 & 0  2& 0  2& 0 2&  Xɮ@y""` @ *@^  K# K#0 } )@% c  ##` '@  $   # Y 2c$ c$#`'#\ #(@?ؠ@>c$ $c$W$ $c$Y$(#!ʖ#(@ : #($LB$ Ԓ@̀ @$ `J@ @Ð #И@ $#(d&# }` "$ @#`@`@$ $`#(d 䀢 "p@l@ɒc8@,c8*@"䀢 Zm" 2`/"@Я ʐ ' 'c$"@S# S O"J +$ -J  @"  ʐ "c  "c @O " @  }"`cbЖ,"2("J  @@4Ȣ ` J@ f#8@\ @#8X"@G܁P ~" Kc@  1'' K'/РА#H@9 1" '' Ȕ  "    b  K@hM#P㿈%ڠ } ? )Ѐ`"Ԁ0`2$#` #@2 #$%"# Kc@耢 $%"$ @ " @ $%"$ర H ~\"Ĭ 'H'''Ķ? '  K# K#0@H'H  K#` K#x KcH@Ô '+J+- 0#cc @ϐ bҖJ   @I  H@ݍ'Hc@<G @}'2@/ @d @?`J@ @ c@ ( "'@N'"@H'`'@ #@ʚ   "M'@/I'@/  :0 %02J  @ @ʐ  ` J@ @ @    & @H f '  2/АВ@˔  ''ȐȒ@r 2  %c0@H@'  K@fݐ#h ~"Ĥ'@d` 1 /АВ@Ζ`''Ȓ@=    K@f#㿈 3/D'D@v  ''@  㿈ɨ"@Y'" @ . ɐ"䀦@ʠ#   #\ p`  2#` @ $ 2'@ "܀`?㿐ɐb'$ 2'㿈ɨ"@'" @ . ɐ"䀦@ʠ#   #\ ` g 2#` @ $ 2'@ː"܀`?㿐ɐb'$ 2'㿘#@౐b!#$"#""c @ۻ ː#8$#$"#0@b܁ 㿘 㿘#@b!"ʀ"#@ $"!#$ʀ`"# @ۖ ː#8$#$"#0@zb܁㿘 }?""  K#    1ɀ  &"! K#   } &" 1"؀   KcД#@  &"ذ 㿐b  ^ X & $* .@` `&* .@` ` @)  @$  @  &* .@` `&* .@` `&* .@` `& * .@` `@  &@@   '   ~"'P'L'T'X'''"`` ` @|!?"77@  '' ''@L?  *@ۥ "& @ڼ'@;]& "?  K@dҐ#؁㿘@ِ   $ $ @  $  㿘  @2 *@j$  2$@چ? $  * "  $ 㿘`  @ .`@ @m` @*@g@e㿘  @: ,`@@g 2 `@* 㿘L@  @ ! `?  ` 2`L@  `L@  @ !  J`@ ?  ` 퀢  L   ! `?  ` 2 L   L   `L"&  ``&@   @@* & 㿘@  "' `$ ,  ,{   )u    "@ٵ @ٯ@٭ 㿀'@ ( @V @ϐ ?,@?@א`@''  @ٍ  ?( 0@耠&"@ 2  L31 K0  L0#  @@䀢   㿘J`"^ J #X "  တ@  ` 2J 2  &J 2L ( X& 2?0  &J` !@  ` "J "L"@; &@?@B@  * 2 㿈  L @S0S?@008 1 *'5 }z  ? @0 "` &㿘  ` `@  `  @     @   㿈&  L @0?@xU ʖ 1 L ' 耢 " ?:( @T 01 "@F  "@?  @8@6  Ð@' 0@# 㿘@N     KN  K#耦` KN@  K# L@@  @ 㿘 L X  L X` L L X@H㿐` @ܐ" @܊    @Ő  㿘ז   Ж  Ɩ    $ @N7 L"NN? ,2 N`@t`  @ׅ  @n 逦@{ 㿘 } ! }`$ %  $`@g    " @`   @Y@W ` $ @  @$@㿐 } `' +!#@   L h   : $#@#@   L`  1 @c0@@n " } $  }฀  "@" "ฐ 㿐!#@'  ' L h    $#@#@  L@' ` 7 1 @ `@`  `  3`  2  2 @ "    ( 0 㿘'H'L'P'T'X@H㿘 h ! ~ L`@6# @[# L#@,`㿘 ! @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0  U??@6  + > @6֦? ""?,  @`?a @ `  ?ܠ?a @ `  ?a @ `  ??à4 `2&@X  N "q @ڞ @ `"j N@ "f @ړ @('_ &'@&@SĀ  T  | Ė ?''?'?'' ` #\ ` b $ ؟#     L`@w`Đ?"`h@5ఒ !c`@& & @*@`@Խ'@ ' @@@*@c@&@ā㿘`? "`@  "@@  ??     zg# "" " " * * ! @(*`  *02 @$_ c@㿘@ @` $a c@$I c@$ c@$ c@㿘`0   `"`a ?"a`` `&`` 2 @@ě "@@5? %"``"  @m ? `@?&`*@``&@`  @V ?l(8\|xxxxxTxxxxxx(P(    " @@u!S 4y * @` $`@ͅ  $` $`@3j @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@ا$ D$ H@  `?$ @:   "@(  @8  @ u`$ $@ -@ Ғ@ @ Y4 (< DbE$ L$e& & & @ ` "`@ i`㿘   @J @:  J@ | 2@  @&J@ |!` & "@ 9  "@   " @ Y "@    " @ K "@$㿘 @?ܑ* : ` X&"* € @ @C   D`" D D  ,  " @Ӕ @J@ )} )  ,  H" @ J`)g&@ c@   ( "( `, T"`,@  `( "`( 0 G"0@ C@ >  `@:5 @~ 0@ , @ @В  , &@:` @:,  @ ! `  @ , :`@ڐ @  @?֐ , :  ? {`  ` ! `  ` &@ , :  +"(  ? *"  , {J"@( "@  "@ "@"@ "@s "@ "@  @$" "@ٔ  @ $@Д S@0 @J@ ,2`& ` ! `   !@@@  @o @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @ݒ  @ ! @?֐ , :  ? {`  ` ! `  @ 㿘 @ @ &@Ր *J㿘   @ J@ ^2 `&@1  `( "`( , ", @-  @  ` :J@2J`` & @   `( "`( 0 "0 @Z 㿘J@ ``\ & @ @J J &aa)|a{`." `[`*,`:`#a(),`:`! a}a9,`a1 ~b[,`:` `@r| @ w@Bs@  o  D`" D D  ,  " @ @ `  J@ \J` ) \G )  ,  H" @} @ ` J@ \ J` )`,&@ƒ (.` H @\ `@@@R @    "`H`2:`@ ,`:`@ː  @"J *  &"@G "@( "@; "@| u s`$J \o`$J {k`$&@l @ #J@ , ` & ` ! `  !@P @E !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @ @  `$  㿘 !   . J@*`А @ "   ?  `  $   @Ӓ 㿘     Mcx@  2&    Mc@   (@Q  &@  @J@ ^2 `&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@=   o ` 1`?,'` % @ `@ ?  ` "?@ * :  @ `@* ` ,`?<@` @1- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @@˒  @@@>0@\@d 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @  @  `  J@ :J` ]3`@q 0m   &@h J - ]@^ @ @ @T  @ ` J@ = J` ]`?&@> 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @ ` * `@   .`㿘 } & @ J? a   ` 2" ` @  @8 2` @J`2`@В 0!L  @ `@* ` .`L `  `@@҄ L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@c . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2   }aX" aX@@ 2`@J`"N``@   @ 0L@  @  `  X*`P( @  `  ~*`P(*`: 㿐 &  ]&/// & &㿘 ` `8` ! `   * : Ւ0@V`   `4, "`4㿐 &  ^  ]&////ː& &㿘     .  `y L*` € $" r&  "@(`Ԕ  "@  @F" "@  @= $@ 0M "@ "@  "@'"@ܔ  @ $@Ӕ ` @ 0% "@ܖ "@0@~0@t0@  "" ˄H" " 㿘  " 4  $4 @ܓ,  "E" @ ; " $@,    :`  @$@ @r "   -  < Ő, % $*@,`,`$`$`  @˵`" @˰`"` `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@Ő `  @&` 2 `` "&` @&`  0"?@&`  &8    ` "     `&8   `  "     㿘  '`8? @  Ò `4 &`4,@ @ 2  ɔ 2,@  $ @ $ @㿘  @c@ .` *  @. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@ޕ* "@    (@> "@㿘   @.` 2&  0& 㿘 &`  @*` &`  &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@ې  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@L  " @F  " <@@ < @:@8 ~"Ī'@^ (  ~ M#@Ӓc^ @S!  < ~ Mc@ǐ#0O`, ~ X`,& & & & & $@$` $` $`@$`@(`'H 'L'P'T'X'\@!@7H !,`€ $@$`@ $`@#`@& `&@& b ~ M#@c, `@@̐@ʐ b  M@R#  ~ l ~"Ħ'@{*!?% c/Z @)  ~  l4 p   @ #@`W  M@R#㿘` $  !㿀@( $` @}`   @c$ @t   & &   & '@g$ & &  & @\ `$`@2`8  $`''``@G  @6S @1 ''  €@6B "  @$`$`@&$ '@62``@㿘 $@   @@ $  @@㿀 $`!@ @  @ 2  M@# @$a  `@$Ƅ c@$< c@$  c@㿘 @PZ 㿘&@&&f  @*&"*? &&  㿘 ~t ~` |"t 'D@` = ?$@" 5 ~1 N7 ~ `" p " &xN@ :#&x ? ` @{ 2 @܀ a-` `! ~ p`" N@ : N#ؒ  ~ " x" xN@ ? :"` :0^ ?`  ; "# t ;D*``"%t `:` ;#`5` ~ p`" N@ : N#S  ~ " x" xt ??%tN@Ā`: t??%t ~ p`  ~N@ : O 0 ~" x  ?2'@ `2   "@㿘a! ~ ?  O@ 0@ $  *`:  + -"`*`:  + - ~ ~ t`) ; %#$t# ;`"#' ~? ~ ~"`"# t|J`t!%# ~ ` N#`$|! ~ ` t"@ " $t ~ $t?% $`6?*@$|J -  NJ 0 ~@1 - * ~ N#`` $|t * @  %c$t`# ~`?! ~t  t ?`$ t"@ " $`t $t   ~`?2|t"`|J` "`$|J` -J t! ~   N#`$| $t O  t" "@$t?% $ )t* @| "%JJ`-`"J`-   $|`:@ 2 G? N#`$||J  :$| -J  -@  -|J`"?J` ~t $t ~ p`  ~N : O  ~" xr ?6 W25`J` ;1`|J`!t $t ~ p Nc` $|N : N#h֒ W ~" xN`:L ?J :* @$|ޘ  Nc`$|<`J@ : |J`3t 0$t|%cJ "J`"%c :t $t ~ p Nc` $|N : N#h ~" xN`:  ?  :* @%ct N#``$|$t㿘  _ 㿘U 㿘K $ c@$t c@$ c@$$ c@$P c@$ c@$ c@$3 c@㿘 @%e? /"@㿘N0k N x XfN  a? a   `D U .@N H E O @# ' O) O+ Oa @ ` D 4a @ `    X*@ R` @W"`(@h `@ a  .@* .@ݴ`.@ N ŀ 2\[?ǀ a   ` `% OX% ' O) O+ O # @ `   @ "` , h `@ r*  Nް  .@`/.N  @ `  Ϡ 0q?/EN @? a   ` 4@3N  % O% a   ` `X @"`  ,` O O O h@N N* @ ܰ .` 0)@'&@ `       `  &@* @ & * @ &@*  .@`@ ` @$$ @$  ("?㿘 ~ O`ؔ@#@Ė㿘 ~ Oa@#@Ċ$R c@$Z c@㿈`  `@''''Ð㿘:? A ? !?` OH!H`  O!P D ?" Ȓ  Ő’  $ ] 㿘q bm `9 1 *$㿘 ~  ~ ${ c@㿘*`$ # O  А :`a@ƒ 2  .2 N .2 *`  ` ~" >`' <#!@Ǫ '̨''Ā  "   ~  ? ̒c! '̀'  < ͖a!@n#@ ϒb4@Ԁ ` <  Ԑ @1%Ԑ @'˔"  c"""c $ @pE* =2 @p>* 62 @p7* /2 t.r 2q3 0 ̐!ؐ@n]$  Ϛb4@ Ԥ%@ Ԑ @'@ސ ͐!!"  @Ԑ@'%&#ؐ@n.$ &ê` "`@Ƹ͚a! #@  @'Đ' @w @w@w Oa %@~ :`07`0@v'Ā  OԒa` %7͚a!@m#@ &t`Ԁ  m` %̐!%?]`@YԲ @U'@uԀ   Oa`Ԑ %@~6J @2 @Ŕ ` 䀢  ?#@  Ԑ @&%Ԑ @'͔  " a! '`̐ t@ Ȑ  'x'@ @DԤ'Ժ``" ̒ '̀`͚a!@mX#@ ϒb4@Ԁ 2   3 %'@ ad  ːc@  @Ɛ ͚a!#@ 8 @Ԑ@%' @͒a! @ <#c <"c  ~b  O@K!؁㿘 >` < !@ΐ#@n ?2 @G 0@ @   @ 0@ 㿈 >` <!Ȗ @ū#@n ?`@$&` ?      <@!H"# /" ̤ " " @ . 2N@g 2 N?  a   ` I-N? ."DN͢!$@sǔ D!̠! @`!$"c& c"& " $!@' @ <"#J?  a   `  .2 NJ ?J .N?  a   `D < "c  @ : 2NN :2HN $N? .@͢!$@sb !̠! !@˒!$"#' & ## &  <"l#`J?  a   `D 2 + :  : . J 逢?J .͒! @Ɣ O   Oa@  L 9 L f"( y b %2#`2 @,@@  @e*@ ۖ@@ `2L ̀ fx ~" >`' <!Ȗ @o#@m ?@`? ?@ ?@ < "c߰ (`%      ?#@"             0 @ / @ " <?" 耦/a  O  $ #\@" - O 7 <? %2@  @ "t& Ob@%a @۔ O   Oa@Ӕ  M Z +ˬcM f"F y b D2B2?@:@@ 5  @c@   @#@͠!$& & @%c쀦 %`@@B  & &  <"#@   ~M  f ~"  O@H"(㿘! ~  O O"8@ubH$ @u ~" 㿘! ~   ~ `@6 $ 㿐 >` < #@=!Ȩ ~ ` + < O O"8@ubH $ ?@u;  %c J?` 2'#!̬! @b, N #ߐ@ # 2, O @wbP ͢ , @q[$   @qTa$  @a$@ '  ' ̰     `@ːa$"cc# # # "LL "  "  "`&  @vP "&$@,  "!$@L  `*`:    @$@`@vP " $@,  "$@L  $@ @ $' @U%c 㿘 0 @q   ,   @q̒ 2 㿘̐ " "      @ 㿘̐``  " " " #`  X " /ː䀤a O @v)bP Z ,%@oǐ L   OL "  " bX@v  `L " , `  %`@ ̐!@$@`ð $`L  ̦!*`:    @$@`@uڒP  `,  `L  ` `$@% p ~b̨  | |'`  @q 2 *   O `#\ @X #c䀢 c@$c@[| Obp@.܀ Lc䤒  < "c"  O@F"㿐@;    |`  |@q ! !#耢 #@p@!$#| Ob@~ `#袒  < "c㿐@D  .@?` .@`.@`@7 㿘  % !   & &   @ && @ $&@@$@ `&@ 2@㿘̐ " " P >` < #@!Ƞ 5 ahal ad @,`@ah @al   `@   2`  0* P@ &ђ ?  +`+`@RR@ 22""蚄?" JJ@ `2J  㿘@<  " @ޒ ( `& & $`& $@$$@@ o O b@s e?48 `.  @ Q@a O`D&`6`8&` $@ * 2``6`:6`:`&` &`%   פ@@1 &"  2 : $ O" C &  $ & $@0@ "@2@@ @  㿘`(`D&`$ @@+ / @2`L`  `@@ &`( `0&`&`& 㿘  ` @٠ T 8 6 @Ӑ $ ?   " @  @@ @ #@[@V"㿘 $@8 `> `4`>@ +4`:`'`:* 2  !@ * 2``94`:$  O"   $` @ 4`:$``< "4`<*2  Y`"  <$ @ 0 @" < "  " @t$ 4 :` *$$@e $  @Ĕ? "#@ <`4 <$ `"\$` $```2`@   $$@ D$``R@T`8 2`>$  o $ $ 〢 2$`@I * 2``4`:$   O"   $` @ $`4`:`< 4`< 4`>` $  J /@  /*@`(`@h`DS$@ T`8?2 @@["$F `$* T`82 `<$ 25`)  $ ` @; ` @6"$ $$$` `2`` OⰐ@? $ $$$`   4`:$㿘 6`>@   "㿘` @@  G"@" $@2?  :  9 27   "@_@2  $& $ T 8   J`/ $ @&  O" ? @& ӂ 2 \  㿈 @'H  HH`X  @5 :%  2 $ `  ?`  4 ''쀥'H 2 '@@g  H2 <@y%  <' @r5 <'@  ' $ J?`/  $B  / * U 8"@ '    2 `L` .2 `L` ?` ` `@`   `@ )@ `@ " @* @@@: 5 : $ @& $"ɰ "   $  '@ "4 8$  ` $ $   4 :$ 4 : 6$  쀢 " $ `  "  $ $  D $ #4 : $    ($ @ڒ D D$ @  4 :* 2  *`2  $ &```@@c 2c $`@Ő耢@Q $   2-- $H29 U 8 2   $ M     OⰐ@a?  5 : $@]& $2 H   5 :@Đ@@} 5 : $ @]& $ ?C" @x( $ `@ `@?5 "* @;b` 2&`@2 T"Y " @)&`  > h>> > > > > (> 0> 8> @> H> P> X> `9 < @ ((&`0 &`, N`D`.&`4N`E  ?`Dc  2`  `2``0"&@`R`8 6`,  @  @    㿘 ( *@ $  2 $   "$ @$$ $   "    @A  `"`" 㿘`$ H@,   @`$ ``6 >& & ( M ?& @@# D㿘@  㿘 a   @@m&  ?"  @&  2 &   "& @&     D" "  2 D""  P86㿘   @88   ( $ .    "? ?`0@`,@@? "м@@"㿘! ~" "@; $? && @6@@4 " @. $" @* $@&m㿘@ (7 ?"@ ̔ <   O@  -" Ğ ?$@) 8  (& & ("` "  @A"` В? *  @&   & && & & & $@=& @ِ  㿘  `@ `= Ò3%``@$@#6 $"    ,*  @$@ ֘ Т06```(q{6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **ƒ-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =&%``@$@#6 $"    ,*  @$@ ֘ Т0a$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  Ė%X   ` $  @@ @-: <  (  >(` :`@?? D8 >` > >> `` "`@`  @{㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @[@T?@J kby@9@2?@& 2 8@@ ? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   a#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘 @ N * @j   )  @ N@" `   `2  `      ,  `        `0 "  @(? `"! `@ `  ``_`! @ `  2 _` `$! `@ `  `_{! @ `  {_  {  @є2  @ @Ě]`& ` `㿘  0@ N * @  )  @ N@ `   `2  `      ,  `        `0 "  @m? `"! `@ `  ``_`! @ `  2 _` `$! `@ `  `_{! @ `  {_  {  @2 2 @ @^`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@; #7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(`X   ` $  @@ @: <     >(` :`@?? D8 >` > >> `` "`@` "`$@`$@ǰ 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @{@t?@j kby@Y@R?@F 2 8@0@)? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿐\   a#% .> @8 @"A @!@ @C . ..MAKEDEVconsole tty memkmemlenulllezerolestdinestdoutstderrksymsdrumklogeepromhopenprombpf0rom biofd0aromfd0bromfd0cromfd0iromrfd0aomrfd0bomrfd0comrfd0iomsd0aomrsd0aomsd0bomrsd0bomsd0comrsd0comsd0domrsd0domsd0e hrsd0ehsd0fhrsd0fhsd0ghrsd0ghsd0hhrsd0hhsd0ihrsd0ihsd0jhrsd0jhsd0khrsd0khsd0lhrsd0lhsd0mhrsd0mhsd0nhrsd0nhsd0ohrsd0ohsd0phrsd0phsd1ahrsd1ahsd1bhrsd1bhsd1chrsd1ch . .. pppfirmwaregroupspwd.db protocolsservices2Wdisktab.shadowX disktabY fstabZ resolv.conf[4 hosts . ..chowndhclient+xdmesgfsckfsck_ffs+xifconfig+xinitmknod|mountl mount_cd9660J ( mount_ffsx mount_nfsxnewfs ping ping6reboothaltroutertsolumountdhclient-scriptbioctl disklabelxPrestore . .. binmdecR sbinR shareR . .. ftpgzipgunzipgzcat sed disknameswgrepegrepfgrep|lesslLmore\wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root bin:*:7: news:*:8: wsrc:*:9: users:*:10: auth:*:11: games:*:13: staff:*:20:root smmsp:*:25: popa3d:*:26: sshd:*:27: _portmap:*:28: _identd:*:29: _rstatd:*:30: guest:*:31:root _rusersd:*:32: _fingerd:*:33: _sshagnt:*:34: _x11:*:35: utmp:*:45: _kdc:*:59: _kadmin:*:60: _lkm:*:61: _spamd:*:62: _radius:*:63: _token:*:64: _shadow:*:65: crontab:*:66: www:*:67: _isakmpd:*:68: network:*:69: named:*:70: proxy:*:71: authpf:*:72: _syslogd:*:73: _pflogd:*:74: _bgpd:*:75: _tcpdump:*:76: _dhcp:*:77: _mopd:*:78: _tftpd:*:79: _rbootd:*:80: _afs:*:81: _ppp:*:82: _ntp:*:83: _ftp:*:84: _ospfd:*:85: _hostapd:*:86: _dvmrpd:*:87: _ripd:*:88: _relayd:*:89: _ospf6d:*:90: _snmpd:*:91: _rtadvd:*:92: _ypldap:*:93: dialer:*:117: nogroup:*:32766: nobody:*:32767: ip 0 IP icmp 1 ICMP tcp 6 TCP udp 17 UDP ftp-data 20/tcp ftp 21/tcp domain 53/tcp nameserver domain 53/udp nameserver www 80/tcp http shell 514/tcp cmd nfsd 2049/udp nfs nfsd 2049/tcp nfs  (Hu_ < @Hu))3(@ Hu_(@@<@T UH}@?H}A Hv SH}H}DAHv SH~H~ %AHv ՀH^hH^h  HAHv ՀHv oHv P -AHv oHz*Hz* CBHy Hy Hy  THyQw`Hy}Hy}Pf)Hy 8Hy 8Hy 8z!HyBlHyBlHyBl`s KHy3Hy"hHz%uぴ pH}P8pH{xH{xʘJ!H|2H|2H|20]!H|2H|2H|2 !H|2H|2H}˭(=D!H|2H|2H}Qڏ{!H|2H|2H|2pp !H|3IU`H|3IU`H|3IU` l!H|3IU`H|3IU`H|3IU`Y!H|3IU`H|3IU`H|3IU` !!H|3IU`H|3IU`H|3IU`r!H|3IU`H|3IU`H}.zٲ1!H|3IU`H|3IU`H}_C=!H|3IU`H|3IU`H|3IU`o!H|3IU`H|3IU`H} t f!H|3IU`H|3IU`H} F!H|3H|3H|3i#W!H|3H|3H|3|<#vaH|3H|3H}q1`iaH|3H|3H}qjmaH|3H|3H}qfaH|3H|3H}q!H|3H|3H}q6?!H|3H|3H}q61~/!H|3H|3H}q6 J4!H|4zHH|4zHH}q6_aH|4zHH|4zHH}q%N!H|4zHH|4zHH}q FaH|4zHH|4zHH}qI\!H|4zHH|4zHH}q XaH|4zHH|4zHH}qU°!H|4zHH|4zHH}qHnaH|4zHH|4zHH}q|!H|4zHH|4zHH}qoDaH|5 H|5 H}qddw!H|5 H|5 H}q:aH|5 H|5 H}q!H|5 H|5 H}qraH|5 H|5 H}q"(X!H|5 H|5 H}qڄaaH|5 H|5 H}q^\!H|5 H|5 H}qdaH|50H|50H}qjv!H|50H|50H}qbaH|50H|50H}q IQ!H|50H|50H}q ԌVaH|50H|50H}q !H|50H|50H}q ?aH|50H|50H}q !H|50H|50H}q >ˡaH|50H|50H}q  !H|6DQH|6DQH}q 4i aH|6DQH|6DQH}q GR!H|6DQH|6DQH}q aH|6DQH|6DQH}qU@!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2    @  #  @ N @  @ @ (p N?   ` 2c *:  _"^ @ :[ N@?@   ` 2U;*@  "# @ :B N@ @  2 @ :7 N@?@   ` 2* *:  _"%  @(! N?   ` 2*:  _  . c`$ .  `.`2@ `.> @"Y#\@"d @>0@"a 0@>@" 0@i0 ,,  @ `?, ` ?,   @ & d&@   @@ 2 .` @ @.@ 2 2>, /` " x`/` @>, " & #\e 2ca# ?#$!"#\O F/  > @ /   @ /  "?#\>&@ ,   :, :#\% 2#  :@ , , &@  ::#\  "   : 㿘  ,@ 0 ( N` @.  , @ `@Ò+  @ N@`@3 " `   `2  `      ,  `        `0 "  @O ?  `"a `@ `  ``_`a @ `  2 _` `$a `@ `   `_?{ a @ `  ?{_  ?{  @ L @ `@`@@ߘL& L  `㿘  4@ 0 ( N` @P  , @ +  @ N@ `   `2  `      ,  `        `0 "  @~ ?  `"a `@ `  ``_`a @ `  2 _` `$a `@ `   `_?{ a @ `  ?{_  ?{  @& L 2`@ǒ @ `@A`@<@L㿘>!`+@ @( "v`M) PV~ўȄ@ d ƞ@"y@@o@耠5$@  i"@&("`8@2@ ``2@| {@v `2v@o 2p@i 4j@c `(`` ` Y@T   @ @. @@O@ I/@("F#A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  M ֒$1 c@ P` ͦ!8''@7 y @W!' P# P1 P9 P; P! PجЪȴl'   * ` *J`|`:2 0*@Ē`8@Ē @@є : X $XĔ@ H?"$(@`P P X$0@ P `$,@ h$4@  ~@` 4Ē h@? 4 Pp@?20@,$8 Px@?2438$< P@r?.4H P@h? 4J P@^? 4L P@T? 4N P@J? $P P@@? $T P@6?$ P@,? P$ @tϐ P Ȕ @tʐ PД @tŐ P ؔ @t P@t ͒ !̰4r ` a/////@?H&|Ģ &@|Ġ & @x?2x @t t  @5?, @1. . Ē@Ɣp? s  . Ē@Ҕ  ~@2`. *`:  p  , : ? P4@tP ͐! 0Ĕ/@? l*`$:  4   aW$@B$㿘@  @@X "&@`@ 2@ ! `  ?   >    #@_x  ȌȼȬȜȌȼȬȜ ~ 㿘 1"Ѐ "@&""" @~!͐`@$"̒̀` """""Ԑ @ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ x ~"'X\'DX 'H'T' ?X #bЀ @T !"@$ g"̐b@"' Ĭ@$ X       A' P$@wޔ #/ ~!`+   u4 #T@K찒 ` @@@@F @P @ H"D!" " c '`+M@  `(8,L \24,, %$@ $@ڐ 0ڤ@*M@@*[$ 4Ϩ   ζ? , L " #"T@ 2ݦ`@( 2զ   U  @`??w  ?L: ,?#\$ ?  @k ~" ?2 :,??J %L  : $ " ''L?`: :, '"@  %$@$&@ '@3 v@+01@$ @Đ@@? Pa = X $S$H"@ 2@@ "? ~@? ~D#@  ~"  P@,!㿈@''`?''  ? J ? ?  &@J `?J@ J JJ|:? ?J:|?  㿘@@㿘1"؀ "@vZ&""""b"܁ 㷀 ~"Ĵ' ""b؀   P@Xa %"0.װ %͢ -ͮЀ` Ԁ ""P "@XF젒 "` @@v %"ؐ`%`  P@Xa %"?Đ*?쀢`2L""܀?  a   `  ͑*:  : #"ܔ  J?`\2#"#"ܐJ?`\2""ܦ + P"@W젒 "` @@uƐ %"ؒ`%*?a@s'L :2$@`' $@$" @ 쀤բ@ ,@ Pa@X'@- #\?;    +  P@*ː! 㿘 = ?@ɐ d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ !*` € * ? *? *? *? *? * ? :*???*?  2N"@`d 2  -?@+)? dN :  ^ \ N`:`2 *" ?"@ 2  ?@?&㿘I = <?@& d 2L5? d  `"@@Ò d 2 `#?@ݐ?@ dL : 2*@*@`"@?"@@ 2 `?@?&㿘 # 2N@2? 0  `N@ x X `    `@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@o.`.`   (8 J2J "  ;#@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  㿐 '`v$O c@$ c@ B c@"` 㿐N@ ="`@?@ "o @4*/@* ,`` a  ;"``%͠  2 `$>@?*` #` .@$`'$@" L' ;L  =2 $@s  `*`" (?`*``* : , *`: ,   =2 =,@ *`,   @* ,``  㿐 ;"`*`  "  "@ $` c@ ~"Ģ' @@*   @ 0`(`@ @7`/` @  @`1 @)    0`(`@ @7 / ` @1 )  @@  ` 6.  7 / @  @` 7`/`@@ 6. @ @ `@0`(`  7`/`@  @`@ 1 ) @@ 0`(` @  @`7  /    1 ) @ 6.`  @7 /  @ @ @ `$7`/`  6.@  @`(@ 0`(`@@ 7`/` @ @ `,@1 )   0`(`@  @`0 7 / @@ 1 )  @  `46.  7 / @  @`87` /`@@ @ 6. @  0`(`@`<3 @ + @  7`/`  1 ) '`(@`8@ `$@`< ` ``@ `0`@(` @ @ 5`5 -`-@ @7  / $`$`@`,@@ ` 1 ) @ 6@.@ 3`+`@ 7 / $`   @`0`7` /`@@@ 6. @ @ 2`4@0`(`*)z#`  @@ @7`/`  3 @1 ) +  @@ `8@` @ 0`(` `  @" @@ d  ?` @ ?*@  @& @@㿈 ~"Ī  '  % *,@    Pa@ PaH    aa P b  P@!7!P㿘͐    @# *`2 .    >`X>@>`>`>`>` >`(>`0>`8>`@>`H>`P$# c@ ` (  *88 " ("  ($ c@" ( $ c@㿘 @? @KH㿘  @K@  $$h c@ ? π  ) " " ""@ ?㿘 `2B?=?$ &$@"?  @$@@&@` `@$` ?$&@͒$@: &?, 㿘 `5 2 $` %$@Ԑ? @ @@͐$@@@ɒ@$ $@%@$@: %?-`㿘  )2,? ?π 8'?"  `*``*?@    @Q ?@ &@@: &@@E ? ?㿘  )26? ?π 81?,  `*``*&?@    @  2@?&@  &@@:&@@   *&@?     8 㿘` ` . . .  @ `2 ? `2`?*  㿘 #    ```4?@1?@ @$``?` @,@`   ,@?`.@` @@.@`.@\`"㿘   &?` *`  * *@ 㿘@4@㿘`,`2*?@!@`  0  H "'@ A   .'  '@&* '@?㿘`$` ?0 '  '@&@@`:'@ " '@ "  '@?㿘@Ӕ@" $ $% c@㿈'HN@ r'D wHJ`   "@ '  ͐耢  ~@f 0~"` ~@]!` ~C" ~"` ~@N! @Fx"耦  H R` 2 HJ@ r|耦 " P֒ t  Pp耢 " Pʒ h P P PDh!Xa`@  ` ~@!HJ@ r@}N0@wHH" "`3 ~b  ~@!""b  ~@!㿐 ~"` ~@ې!"   2  `b  ~@ǐ!$?""@b  ~@!@h @” ?Q`" @??D@DDDD㿀 ~"ĖP 'P'T'X''L   +  ?#`L "@  "` + "@ ;"`"  P@T!px ~"ĔP 'P'T'X''L   +  ?#`L "@  "` + "@"  P@ !x㿀 ~"ĖP 'P'T'X''L   +  ?#`L "@  "` + "@@"  P@!㿘 ;"`h?p ~"Į'  N @b / L' P!@  P!@V  ?#` '< @bf P   P!@>@;$ P P!a  '''''' 8 D P@] /,`@V, ;"``=@#|*` € @  **@`2*  ?#`) Pb$`* @)$  Pb`"ْĬ  Pa@ Ԩ 2M  ` "  P@3"?  J H 2* #2HJ㿘  㿘 ~'H'L'P'T'X#`@hH㿘@b `@d @b` @b{`  c``` @    㿘@@b , ?@ 28  @   % @  &@ ~ P#@g3b  @  @ @ @o@&@㿘 :     @  "2 J "2 J   "2 J  J 㿘'H'L'P'T'X@H㿘! ~ h  Pb@@f#  @g# PbH@f#@W P#@fbP ~(P㿘 ( k? "6?@b @2 P (    ? 2 0     0@ :f   < :@ f  "  :@ F㿘 $  c@$ c@  ~"Ģ' L@ /2.. L` Ϡ`@`U$ @ϒ$  Q``@`H$ @@`>$ 0 " > ?" /5 Q@` / @$@#@b$-``@J?`/#,.O j@`` e Q@``h 2 \*? /@ * T"@@V4$  `2L `G < ( 8  # &5 ,O /.    *? /@P * "@`L`/`#x,,@U$#o@_$rJ /"*"  Q@ p㿘   ` *  " $@$  @?@s  J " $ c@$  c@㿘'L'P'T'X@ L((||||||||||((((((((((((((((((((((((((((((((((((((((((HH000000d000000d$0x($$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$<$$$$$$$$$$$$$$$$$$$T8$8$$$$$$$$$$$$$$0$$H$$$$$$$dX888$$p$@$$$0$ ~"' 0 ``  ?"   @ `? ! `  " %!   & &  4@cY 2@ !@  ` 2 @2   @ z`#,  €  4@c3 2 @` ?& & d`ޢ`@ h2ڢ``ע`@ l2Ӣ``Т`΢a̢`@,* ƦР V ` hQ  Mh J H @bA b>   @ h7 d2n@``f*``22`@2a2 ``= M:J"? ! `   `    b@b #b %  ? &  &@b 2 @  ` 2  8@",  €" d  @@bq& @$`@$& &@ @ Ө"?d/ J #  ?& &   4 @b:  "0 L@`  ?& &  @  4 @b 0 L@`  ?&  ,&",'"?d# #   & &`4@a 2o a@  ` " `?&  ,&  4@a $  ! `  " $5,8!T@Y ?Հ`MS!*` €`@ @ @@T/,@ ~!-`4R (,@  ~!-`R `` 34,@@+,@@  @$@ꀤ@ ,@ , ? &  &@aO 2@ (ư @ x Xd@גd$h,@ @ `   `2``@:2a2`2``2z*v"8!t@8 ?Հ`:2 ̓*` €,@@"',@ @ $ ,@P @@ `,@ , ? &  &@`Đ 2@@@ (8 @T/ e E@F @Ad$,@qb `2`":"$ ?  Q@S  @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘 2 * $% &&@@@@` &$@ @8@ "@&&㿘 !'H   ` `2 -+L  L0 L x XL )0  ) #?)  >tm r   $ `%E    # I "m B  @ @  ?"1 + u9<@ !b @ @  1"?# ?u<@ B   a @ `  a @ `  a @ `  H  H"@㿘 !   ` `2 -+M  M0 M x XM 0  >?tؒ? ?u?   ( O !@ @  5? ""? ?ty<@ B    a   ` `ͦ a   ` ` a   ` `  `  '㿘 0 @2@n$ #$ 0" 0"`  ,< & ,`@  @` 0&"@ 0 " ?㿘?: <#`2`0@!C`0   `"` a ?"a` 2`0  " ` @z H?` &` ?6` &``  6` `0@  `` & @ "@/?&@*` '&`` ` ?߀6` @@ (` 2 `` &`&@``@@&`<`0&`8"`0 "``B &`&@.`B$| c@㿐1 Q#p7θ  5 ;3 Q&@&a&l"#h'a#ܶ  .( > @?* Δ㸖h (@ (   (. @?*? (κ( Qʹ  .@/@.?$ QHʹ〶  .@/@.7$ Q ./$ Q` , h'hh,h  , "''@#   Q#Ά@4("('Ά(@4(@'@(#ײ`` ʐ  Qͮ  hh    hh  )Β! "@  @  !!(@'@('$" Qͺ  " %@΄ @  aa(@'@('` 􀤠O Q@ .$ QޖΘh QḔ` ( ( . '   (@&@$ . $(  ~ ȁ܀Ζ ؒ     2*`0"؁㿘 ~!Ȁ`2 u  3 ch  l #h6  a" ch b6  $ d6 . @ *& 5@ *`( h5 f * 5j a, @ l  #hΗ-@ "h Κn.ch @@ δ"@b @"#lc(&ch @     < Qa @1 @%1 )22 0@ (@@ !!h2@ 1 @   h#h 1 *!h  #h3`1   @#h h 1 #h3`   !h  h 3`1 #h @ @#h  ` +` h h @ @$@ $$$   㿐'L`'P ΄h' '΄('' 97#hh3$3@3.`#( ., ;1 @(31  @5@ @1 @   . @ @ @@cؖhڮhh#)>' ~!~     6 . ( 0 .`@.  @6  / 00@@ @@/α6 h?1Ұ#h6` (o ߵ.h.h3. ch@`? h4`4` c `+  4`, 4 * 4  #4c %/ L h  @   @P  㿈 ~!Ȁ`  / / / / / / //''.@.`.`.`.`.`.`.`㿈N@ $ ~N` 1@@ !Ȁ`2Z * *  " (ϐ 2 N@ _k@   N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ*    N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ* @ % ]  N  *` *"  N p 2 N !͒ @Tr"@1""9 N` z  `?ŀ Z  @ ?ˀ 9 -  ?ґ+ :  z `?ŀ Z  @?ˀ 9 -4?*"*`N`"`@ `  +``  耢 B  ~Г3  3 .@ ? 3 `.@ `? 3 `.@ ? `.@`*  3  ? 3 .@ `? `3 .@ ? `.@ ? `.@`*3 ? 3 .@ `? `.@ ? `.@.`" 㿘.`6`I R0N N @6 3 0(0.++N `! `<0(.7`N  `(.7` 㿘 2 a $. .  R . .@X= . @6㿀 ~"Ĩ'  ' ,`2  `@`*`,2  2    8  ǔ "İ  R@   ~"Ĵ' R`@ `N@ 2& ~N``$``a2 ~` `N` $ ~@5j   *  ~`@* @2`  ~" /@Ր  `  ?#@ @v @ ` ?@ `@   ?#h#f 7  @^,   $@ ?#h# @9   ??#h   * 2 " *2 " *2 " * #p $ 2. . .  .  R @W[ @& @a @ !?#H @=  #x? #h? #p??????  R@  *2@ @- Q @0 @(*`@ @2 @ (*`@   * @2 @ ?* @*`@ ڔ*㿘&0@2 2 c@2 . #d((33c@3. #d(( 2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( $33c@3. #d(( (2 2 c@2 . #d(( ,33c@3. #d(( 02 2 c@2 . #d(( 433c@3. #d(( 82 2 c@2 . #d(( <333. #c($@ hD@&@&㿘&0D@2 2 c@2 . #d((@33c@3. #d(( <2 2 c@2 . #d(( 833c@3. #d(( 42 2 c@2 . #d(( 033c@3. #d(( ,2 2 c@2 . #d(( (33c@3. #d(( $2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( 333. #c($@ h&@&㿘 R`@ؔH*`2`  *0 : *0@`( ` 2㿈.7 6ܐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' r'k', 2`*`& `**`2 &  6 ,  2  J'C'{, 2   * *`+`&@2& ߠ / 2  ֠㿘.56㿘.6  `O *`2 `  㿘.6  ` *`2 `  㿐 3``*``*@(`@ `*`+``+ @ @  '' 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 3``*``*@(`@ `*`+``+ @ @  ''7 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 ?  @  . ( *`*@ *@ @ '** +   '..􀢀2 . ...2 . `. ƴ㿐 A*`*@ *@ @ '** +   '?..2 .  ...2 . . @  . (  Ŵ *`*@ *@ @ '** +   'x ..2 . ...2 . `. @  . (   ~ `? 2`*  ~"# ~! bd'@$  bd@1w @d@$ " 0/ 5 V) " @  $" @*`@" @Ő@@dd@@@ߐ@@@@@ߐ@F@   @В?    ??@ d @ < @ <   d@ x@Qf@ @  @h@@ @S  @@J   `@M@`@}  @?@u@ܒ #@2+ *    %  +  *   %  +  *   %  +  *   %  +  *   %    %   `% *`Ė ?耢 ? V@J!HH;j&. ㉘ `v  " : "" " 㿘  (0 3`+ +` `? @@ # > `@@9 @r &@ @l`@?@ @$㿈 ~bĺ'`2*@`*2*2222 ///////*2@ `? @" /@ ~bh  ~"  V@А!X㿘Ɛ   . . 2 .  .   >`P>@>`>`>`>` >`(>`0>`8>`@>`HX< (. .`&5ک x@  @@0`(`@@:1@V5 - @  ۪@@5`-`@Ą @0os@ 1 ) @Ȅ =_㯂@@0`(`@̄@@*5 - @Є * @ @5`-`@Ԅ @?Q@1 ) @؄ `&؂@ @0`(`@܄@"=@㯨5 - @ ?ք㱪@@5`-`@ @"W5@㾈 1 ) @ "@@0`(`@@?f@ᓨ5 - @ )P㎄@@5`-`@ @m@!1 )  =@b@@0`(`@@ @0,@ 5 -   @Q@ @5`-`@@@:m㪈 1 )  5Ą@]@@0`(`@@ @S5 -  6(y@@@5`-`@@@9Ȉ1 )  xs@@@0`(`@@ @0ք5 -  =5C@ᇪ@ @5`-`@@@V 1 )  *x@@@0`(`@@ @?;5 -  @٪@@5`-`@@@#J1 ) ?B@@0`(`@@!} 5 - gX"@ @5`-`@@?yN 1 ) )/D@@0`(`@@5 - =҆`@@5`-`@@/p1 )  &߆Ƃ@@0`(`@@:I 5 - 5;̆@ @5`-`@@" 1 ) 6u49@@0`(`@@95 - 蟆@@5`-`@@1+e1 ) 1= H@D @@0`(`@0@ʿ㗄5 - 5*@㧄@@5`-`@5@?$91 ) 1Vք@Ä@@0`(`@0@#3 5 - 5?@}@@5`-`@5@!aф1 ) 1@O @@0`(`@0@?95 - 5(P@ @@5`-`@5@ᡄ1 ) 1=߄@₄@@0`(`@0@/N5 5 - 5 ⻄@@@5`-`@:ᴄ5@㑄1 ) @ % %%%$ c@%# c@㿘`  ,    ` 2 `@"#   ` @*` @y.  2` ?, "`` "` @ `  "`"`"` "` 㿘! ~" @} $" @} $㿐`+ `@&.`@"` @ @2@@ @@ :  { @& &  @ @ `2 㿘&@  @6&   2   @|  &  &?  @ 2?  "   ?& @ `2&@2 &@ 㿐! ~" @| $Ô "`"@| $㿐! ~" @| $   " @| $(` `@{ " @|u $ "&& $ c@%0 c@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  ppppppppppppppp㿘@`@ @(Π` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  #P,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘    @    @h    @ :, @ ~" .",   @ ` :  , ,  , @ 뀤, 㿘@f e㿈# ~bĀ bĐ  % ?'  @zܚ ?쀢  , ,bĒ , , 8 ~"Ĕ '?''Ė  V'''''a` @z ?' @w$ @2 @' ''' zs # d J ? * ``J ? * ``㿘    ~ ~"b"b쀢"    h`h ?*` # `  `  #`h ~ "`h *` *     *` #@ ``  `  h ' V _L@@E5᠀ ",@  &L@`  `h  h `' V@y @E=耢 2,`   ?ւc0 ~"'L' #S  N : /@D / 2  Vb @ q 2  N /@D .   2N V"( "g?N :" N /`?`% V"8"X?@y@y # $@DƐ VbP$@;$@; @D . 2 `!  22?eג ?)?֤#H?{ ۀ ?&`&`##@# &@ &`ސ$&`ې(@&` 2,` !?` $4?``24?@`2?$ٰ?&`$%z[, @*``  @ zQ @&°? @6(`` $$``@  @6`"ؔ@ *` \``@& ` @6` o$  H$  `C$ ` @?``@ `  @6 /@ *` `@ /@ @6` !@ ?$J$7$ @`@ ` @`" "` L "` C?``@` @6`" "`L "`.?``@`` ?@6O``,`+ @ @ B @&`O $% @ ?֐# *@`@&  L-  L ?֐#O` J 2`` !4`!?* ؒ @ 2` `2`  ` @ 24`? h  @ "@`?   @   #@ `` +  `@ &` ?    @ ``?* @@ @ `@  ,``*` @ $`@ 6&``4"`? ?bؔ @  `,`@*# ` ``@( ` @ &`,``?+ `@ *`㈒@ "@d hlp@  t"`"`"`"` +   * &`@"x| "   " " " &``&` 9&` @6`"ئ@` @9@ " `,` `   ``@& `? "ؤ@`` @   ,``*` p  <`  ~"  V"X㿘  `5  @1/.`+ .@* *`@      @  @ @   @   @BX`? JJ Ѐ ,-+2 JJ 2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ; *@" * @&@N :   < 2@  &@㿘N -   + ’   @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` w  "$ N . `      &@` !ma 2N  / v` &`㿘 `  d 2  ! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ V"`*`@ * @*`" *" *   Ȓ    &@ dxڐ d,`@*`@*`x͒  :@``: @.`"@  &`@ ,  + - @* *` V `   &+  * "*"@ *` `  @u|!'N <  >L >2r?$ l$L 2ђĠ "b? V"Ȓ 2&@L / < ` >L >2K?$ E$L  , ;  2L5?Đ1'L 2L` V"L , ;y  ࠒ "?L , Ƞ "?L 2?Ą# &@# &@# &@  #&`#&@#&@&@"ت@ ` &`'; V ĔȀ$ $$.$..$.`b &``  d 2  ! ,  , *@ *`" *" * @ ` $`&` 2?  `@"ؐ@ * ㌕* @ @ `㈐@ #bؚ #@ @ @ @@6  * * ``  @9 "؆@@ @@ @ ` * *  `( @ `2*   2""@#* * ` ``@ؘ # &@ #### &@ # &@&@&@ &@&`# &@ # &`#&@&@  &`&` &` ` "8? #@@??@@?8 㿘! V!  !j 㿘 +` ?"`!      㿘! +@t @t 㿘 V@sJ"蠒 # +ڞ`  *#@? :@s!@ $` *#@>!L 2#   " # ""   V ha""@>Ӕ"0`  L :` `<㿘! +@s @s 㿐   ' d* @ ^ @'" ?* " v]!xavZaX *@ *`@ *`*` *  *  *  * "@*`"@  *` " ' ?*  ` Y   ,`@*`* ,`@*`* F&@ # # ~ *``@ # ~  : *@ 6 & "ؒ? *` #, @  &  c  b*"@ &(㿘! +@r @ @r 㿘  +`  ؔ ,@rݖ " 㿘# +@r͐` +` !  "`#@rĐ`#@>` ~" )#&(㿘 ޔ㿘  +`  ܔ ,@r " 㿘 +Ɣ 㿘  < ui d&ue!88㿐 D  !! * 2.  4  *     *   @2   @   ?   @ɑ*''Tau,`@*`" *" * &$u!n ` ?'@# ?$" * *  *  $@$@'` V"   d 2  ! . .@ 6Đ,`@*`" *" * ' V%T"DB't,`@*`" *" * $&@ T! ?"   V@? Q  j d 2  d! ,` ,`   V"  R d 2  L! ,` ,`& @  2u  8 d 2  2! ,` ,`@ Ӥ&@l8 V &ʐ?ǐ'xN  "@@ &   & &t .&.t <& <&`   d 2  ! ,  ,  V* b` &*``*`&& 6& &$& 㿘&@sh@d "  2` "  2`㿘@ &8ss8q@"&@㿘@ &8ss8qՐ@"&@`` ` ` `@ ('P&@ `'H`'L'` '`'`'`'`'` '`$'`('' ' < o?В < g?  `?ܐ' W?j'l Q?Ԁ )!n% V_? 9؀      d 2  ! ,  , @@ `'Ԁ!n(' V؀     ڒ d 2  Ԓ! ,  , $@ 'Ԑ  Ԁ!nݢ' V"@ 'Ԁ  ''ؐ  ?ؤ`*    d 2  ! ,  , * @Ԁ@ؐ8 ̰?Ȁ`;'''l'4'ʒ?ŀ ?' ;'''Ȣ  ?,`##cK8@   #`? , c* @c@@  耢@2-`? (/ * @耢@@ " 'LH  Ȁ 2耢@츇?전?Ϩ?]?4`4 @ :`: @@''@4'LH  ? ``&' @?'@`$耢` xH  @' 2"' ?LH P "@㿘e  [ 㷐  'L & L`"  && ##@   # 6 *" *?  "ؘ  * `2" - #@ <  6J?#-@*@ * 28 64# #,@ *` * @ @-`?"@  && Lt`2 "@  " `?&& ؕ,-?㿘! +@nX Y# ec@nP 㿘?" 㿘$& bdR 㿘$& bdI   *` 㿘j'DDD&㿐a'DސDD@'ِD"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  p ~  bĀ' V#H V*"@ `  V V#H*`#@ VP @(@m  V#X V# #h #\#` #d @=i?_  W"  VՐ#㿘 㿘 + +`P  H@m  H 㿘N@ `@mCN    2N@ 2N?㿈/ / * @*`"* "@*` @g '<   ?" "? 0"  +` +```` `(`0`8`@8@8`8`8`8` 8`(8`08`88`@`H8`H`P8`P `0!`0" `0     !'@l'`X?ֈ!㿘 <#` @Z     V  X 2 $  ?6 6 && & & & & & D& H 0" 0"` 0` ` @l!㿘@A   " `  ` "@` 2`[ $㿘@Y |㿘 +  , 0bФ $@$$     @lU!`X!*@X"  <"#8 '  5     m   _ 4 d W 0^ ` j  0v   "z'k k s 0m h k y 0R  e l   l a a f 07 ^ 5 7 0"$ g  d 6b'O $0"+1'!\!r 0''m耢 ?8 '  mt耢 |?z  (  $ !n l!'^'     'U'  'O'ܐ         $?ؐؒ  @j6 ? @>?  =?.    ?'ؒ  @j ?*?@X*O:!   0?'ؒ  @j ?0c?  " ؔ @i ??L$8X\@e֐    ~ Vc@&`,ހ   "5``"`IxF x"@|'p"`'t@?pp@'ht@'l@?hhl'` 'd&`&`,o \ @`\'\ l[  Ū`"@  š`#"s`ś &`,L&`0(k``X``@ 2e`@. @.S .@.`,`, XD@ `€   &`,&`0  %@@-ג`,D@  @  X'X @.''&`,`, ~"  VĐ#؁ ,"@0"`4"`㿘  " 8 8@% +D("$"($"(""" "  "" """   㿘   " <k < `@ 8@dN@dLtldtlXdL@dd8  ????' $ $ $ $ $ $ $ `?"V  2z? 2v? 2r? 2n??h? "   "]?$$  $ $ $ $ $ $$ ! W l` l 2`"    "/? ꀢ    2/' ' ' ' ' ' ' '   $ @ $$ $ $ $ $ $ $  W'  ' l' ' ' ' ' l`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   n2m? lg? Vl$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @+`` `` `     2 `?&   "&@ &㿐 >` < !@g#@  q @ ?  WaH@2u @Tn O  WaP@2f  1@gY!h`* J@ %J@ f" y b  2 @ @@  `J@ ဢ f@g.h`@M `  &  <#` . ؓ*` €???`@x& '   ²`+ iO@ 2# @n  "  "``@ѐ $  ? @  & @I` ~"Ĥ'&'ܦ@ܒ G @< @ @ 0@`,?@ $#?@  @r   ` ` ܰ &܀ "@"  W륐!X㿐@ 2E @  2 > @1V %   .@ $'?@aX#?,@t   2 @Ĕ?&`2@a5㿘   @}&` ? 㿘`@`Q &  $  $ $  $  $   $ `$  @e$ `  *`@$  $ *  ` `@e:0 㿘@ h`"Z    2T         H?F?D??   #@/̀ `*3?g`""-? " '?    W!@ W!8  ??ТА'@V?@2     2  2    W      㿐N 2`%??@?  ?@?@ ?@@ ?@ &    ?@&? ?b ~"? 'D#T"  ? 'L'T'? Ⱥ?  ? `  ``  ~ D?`?D? cPc#؄ؚ@#@   < ?TD@ +#@ ?l   < `@``@d   <u 'L ?#L" L?cT@@@ F?/??P?T"D @  C?#l ">@@ * 2 `@ * `4 @ * 2 ` @  ```3@`'`?cT@D@@ $ ?l؀ " @dDؠ @ @/vے @`0`/`@*耢 x?' |'' ' ' ㌐ ?'  c ' @ @t@q#\ WL@ %~@``@ \'`' d' h' l ' ?#X??'  p ' Wh %@X@`` 2R@`` 2L@`?@cR ` ?䀢  cL?#@6?cL@@`T@c TT` 'T''' ' ?#'?'c'   '?cD ?@*  &@      2 @_ ?L?L"   ?#T@ ??cL@@`  ?#LZT?#ST?# <   <"c  ~  W蕐!؁8  ??????????''@]@   <@]@ 2 `@^S <?"cT     0! 0@ '''''''' '@''' @?''Ȑ@U @^#@^!% Ā   $ `     2$ @]@]?ch ~"ĺ'?#@S 2 Mz c@M ? # Wa@А  W ,@Ȓa ?, ް L  *`:     "@ , @  ? ?L  ?`#`#` #`#`#`#`#'''' ' #' #' '   K ? #@$@`G ?  2@?#b  W犐!x W W"@b    ????  $ ` ` L  @2P  ? ???) W @- `*@ !@ 2*@`^\ `J@*:    `"  @! " `*@``"`J@  @` `'` '`'`'`'` ''' 2' @&@`  2@   $` ` P 1!p  !p?`??? @ܐ  1Z  1!l`!l@\ ` $al .' W@aP!p Wb @# !' W` @'` '`'`'`'`al?E'   $ ` ` @a$!p0al@ 2al)   $ `` 㿈 >` <!Ȗ @a8#@[w@  <?"ck?@ F    <T"#`;?#`)@ $`` ` ` #\#`@ #d  @@ 4@ѐ   2   2   @&`@`2``. - € <   <  <  < "c@[ ?  <"c@[ې0@[ؐ㿘 >` < !@`#`@ ѐ     <"#b " < "#N J .Jd?`2J J .`? 2 d@ "dJf2  ? @` 4[㜴   2 D 8`7"3D -D@B 4=`=4㜀 "   " `2 ``  2`""`  `" ?@ ?` $ ? $㜰?㻈 ~"Ģ >`' < !@`#@ , ` <"#%? W@+ $$ ?L .", @@/$$ < "c?b  W"H߼߰ߤȝ㻀 ~"Ĥ >`' < !@_ː# &@ߐ  <G"#$#d#` #\  @Ú   @$@Q  < )"c@p 6 < "c ` 2Ā`7"D*` € <   <  <  < "c?  W䦐"`㿘 >` < !@_f#@}     <"# " < "#N J .Jd?`2J J .`? 2d@ ^pd2  ? @f 4a㜮   2 D ;`:"6D 0D@E 4@`=7㜀 "   " `2 ``  2`""`  `" ?@ ?` $ ? $㜰?㷀 ~"Ģ'@Ӑ ` <"#'? W@^s?"N .2h@K , #\p($@.L$b  W㺐"㻈 ~"Ĩ >`' < #@^v! @2x  W@]"» 2p l W@ƒb f@  ZJ?` '#O@], L@  @? a   ` "`;,@@  0 !`L@?   ` 2`L@ "`1 1J ? a   ` "*$@) !x@- !x@ @- "  W)"H >`` <d !@]#@   <"#?`  @ @p6 @4 *` * $  >*` a ?$ 'F'$@]?2[?$@Ԑ@8 ̰.2 @.2  @  ?4  <$@` @ @  @ @  @x 4  $@` @. , @l2 . @h2  @i /`2 @a ` @Ja4 &㿘 >` <#!@]O & @)?  )@@.@?# .@62  . .`@   @& @# `   &6` 㿘.`  .2 .   ,,`6 ^ 2 ʒ6 , 4 ^“6` ,`6  <2 " ` ?* @   @( 㿐#@Za 2@Z52a#2  @ 2 22@Z*2!?c  2! 2 4!a  22a 7 25 - 9 21 4!! s*  `!@Z#퀥`  W" ,,`2   , \4*  2` , 2  K` ,2`f <6ኀ`68@V(%<<  @ZC(  : @ ` ? @'!6 :㿐 { `8!/  2!@ $ 2v 2a! 2]_! 2aa  2 2 8@ *`6 82`4! 2@*`72` `:X`X|  P  T㿘 >` < !@\# <c <$h @\ #,` ` ,`㿘 >` <#!@[   6 M I ?#̐ @ @2  @2      ' @[  ""   0?#   @ @2 `"  @2  㻈 ~"Ĕ' %@˜$ $@@x* `4 @s* 2  ` @  "   "  Wࡐ"?㻈 ~  "Ā '% #? @$ @@7* `4 @2* 2  ` "  We"؁X ~" >`' <'D'H!Ȗ @[#D'@4 ?",?  'H"$  '  <''Ā@ '  ' @  `   @? ` *@  P`"  ܤDHP`;!*` €   )4ݰ? P   @ `'  %   H`L @ J`@ @ܒ   $L $`@T"`@\܀   "`HJ@HD ''''`@I] H`  7ֲ`@ְ  ֲ@"@*` 7ր "@ 6)Ā`& @'u @K* 2 'ؠ 77@"7ր`@ ր  @^1 "b* &7֑* 2 ""`@̒ ֒"@*` 7 @   @`  % H  L @ " H @"ܒ   $L  $`@ *@@  " D $ 1   ` D 1  D  D`@\܀ # & DD `@@HH D   /'7`@\  w& D"D `@HH|H  *s@ *@.`"* *  \~c#`@ '7 [  I``@0O L'>"!'а`@ [ߚЀ <' '@`@ $ (o `@ (2 DH `@    2   *@o@!` "@    " @`'S  `a @Q  T`  D`TܚH`1;!*` €   )4'? D"ج  `@'@" Ȁ`? = "? <""? ~"  W"㿘!  @  [5?   $ @" D"H"L㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@x  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ "? >*@*,2$? $     ? " ?` င `  ` X*`P 㿘D`4 ` "' 8?, ., \" Ȑ  < ` "&`."  `?*  @ `Ц &*?J .* J." .`.`Ѐ    Ѐ -_2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*` X(P㿘@ 㺨 ~" >`' < !@Vݐ# <c <#$h@VՖ  ''    @ Ā@h ~@   `\ X &Ĥ dP?  x2&|@O ~&| &2  E ~ A ~ 2 & 2 & 2 "&  5 .6. &@Uѐd<*@ ' &d Xa(&  @!v&`# X 2B X@U!0 ;`@!g!N` '&DH" \ "NN` `  .  $  ' N`` 쀢` NN    2 .$@a@ }' XaH@!' /b' _@Ui X, aP@  .O N XaX@W  ( XOƀ  #ah`2>N "  " N 0 .`!@  X@ a` 2.!'ah@*  2@ XOƀ  : X@  ƨ N   L y b f*  ,  L y b f *  " Ӱ ap@  T XOƀ  Oax`2N "  " N  `!@ y@ m 2.N` &DH \N   . " $   N    N   2 .$ 'ax@ 2q XOʀ  2k X`h XN "  " N f d X0J ? a   ` "*  ?0?8  ?H?@'0'8!  5@$'$̖$ &$$` 2!$`/``@T9$ @T!$`/``@T* `" " " " `$ "@Ga@   XOȀ   NN "  " N   ;# X! ! `@ `  `2N N`" N@a 2NN`;瀢`N.@1 R / h"@   X !@t 1l.   a   `  * N  ; 쀢?*: .@  $@@,@{', $@@,@u',l"@  *` %@ @% @_%  @ Y / @*` "  ####Ƞ@## ̠###.   a   `   N  ; 쀢?*: & ./ @4 @Q  ?    4,, *,``  .a@   Oǀ   Xa@l@ `4& d **` &d@#N` @0  @ .  `@!`#`N`  &DH&H  PN  .Nd`2N @y . $ `$   & X@R!  X@a & ~"  X،!ȁ 㿐 >` < #@SL!ȢN x#% X*`:   XN "  " aؐ@  ' @J NKK? a   ` @ ;+ad* < 1$ad@Z  + Xa@S   X`a@I  X`$b@?  X` (b@5  2N` $`N   2 N  0 ???㿘 @ڔ  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  ` @M@M 㿈  ?'  @P ??  (|ܝ㿐@ ?㿈 !, : ?   `  0   N x X    !, :  ?   `   S2,  ?Г:` ":  ?   `D , :  ?*   `  : . 􀤀E $ =? a   ` < $:` `2E (*` €?#!耢 * #?#耢 쀢`* *`  耢 쀢`*   *` * `2&@ 㿘  0 @ @HA? /"㿐N  / (  X"@u " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿀 ~"Ġ' @P N :   N :"Nx P N   `H ?# X"(@  X"@@  ",ܮ ) `:`.2I N ː ȑ4, ,    6  @2d  ,bN`   8! 4, , $   ? %@ **  @P   b  X"X2J@ "J`  2J@    X h     @ ` " Xh @ @ @`  @ # 2 @ 㿘 @? @$㿐 ^?@=`0@`  `@@"`0@KX `0"`0   `"T` "a"aT` $` $`@KE` 3\@;\ `@Jd  ?@J\`2  `C  $`4` $`$`$@2(" $`4` $@ $` "$` $`$`*@<"㿘   2 2&   21 2 Zؐ!@ 2&!㿘 X#ݔ 㿘 X#hՔ 㿐 >J!` @    !&@Ԑ!`?㿘 >&J!` ! @ ! ! !& 㿈  ?'  @M ?? 㿘`40C "@"&&@Nʔ8,   `a ?"a @”!  !㿘@  Z Z"@Sb&@@` &` 㿘 @&@I  & @I& & & 㿐@   Z Z"@/b &&@@@ג  􀢠"@L@ # J?` '@; # $'`@J` ?@M& Z&` , @b  Z,@`L@L@ "` "`c@ ,@  J 2@`?#@4@*`2 & & ` 2` &`@B   &`?v<"` & @X&*`:  % "$ ` *`?2$ @J-*` `* &` $ &`@ & $@4 " $,  "$L  $ 㿘 >a؁㿘 >+!؁㿘! 2 >a5!  !㿘 H* D  @I "?& H& D 㿘 4@C 2F&@ @:  $&@ @ "$4 4$  @:  $@Ò D@M $"@$@`P $@D@L@ ئ&@D&@ 㿐@; 2 ~  9! 6 $ # 6 Oݐ 6  " Вa$p6 6 & $& ,& (& &    @;W 㿘 @\  6 "( <#`(`L  ">0@";0=@9 @2P  @ ? 2 !?  0 :@ d < :@  d  " : @ DE       "2 @7 h Ȁd!p@2 T & ^y 2  <   (4 А$$L4 2T ^` @B 2$0 @" P  @ ? 0 @ :d "0< :@ d0`" :@ D8<" @d  "@@d   @2)L4&L@@ @D 4%@2L@%@&0$$@` @@"0@Gw 0"  ?X4 L  :  @ @?2$$0$` @@"0@GR 0" @ ?24 @  @ "@$$$@8ܐ  ?@?20?0` @@"0@G# 0" $ ?4 $ 㿘 ;   J H ? 2H  J  㿘 ! @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   + #fN} $ $`   - , "P %  <?"% L" ,#"?L  @`? @ `  ?ʠ? @ `  ? @ `  ??` &@㿐@&    "  2 @E 2  @{  "x   ?''D'''  ܘ @IU      @E;ܮ  ܘ @IC ܚq  h   2c ^ `    ` ?@` ` L`x/ 2 `  @F> : `    * @"   ?     + "    ? 2@`2@@ + * @ ,`D "@E0ɐ"* @D @Ev? @J ܢ @    2  1 2 )  %` %` @I . %`  @I   ?@`` ?%` @Iv x`%@ h`xf / 2 `  @FO"Y T`` %`` %`%`   * @"   ?    . @"'   ? "%` "%`" %`  @Iu@@I@ Ց.%@ܨ *a @DÐ䀥@ D%@""@D 㿘@D㿘@Ia @Cڐ @H0 p Z#' Z#' ' Z "# ''''2'',"    @8: @H԰  J  ,  ` `" 4 @# # `" 4 `@` `/ '@@ "  㿘 !'H   ` `2 -+L  L0 L x XL )0  ) #?)  >-ݖ ,   $ `%E    # I "m B  @ @  d?"1 + .<@ !b @ @  E1"?# ?.<@ B   a @ `  a @ `  a @ `  H  H"@㿘'L'P'T'X@L㿘 ``@%㿘 @Ö`㿘 @ѐ `㿘 @Ӓ``㿘'P'T'X@Ph ~"ĺ'<  `@  Z Zc0 ##X #ߖ#` : ) ~#`  `@@2̢ Z@((  (6'$@@̖ Z@  & 6$@` 2` 2` h &`` Z@n & 6$@` "` Z@Z & 6$@`   :,@` ,@`*` B$- Z+ Z:  %!`%N m`%`@ @@' c@  & 6?& N %   , , ?$, ?*` ő: ,@ & 6@` $@' Z$c '''' 5 `  `` @@a@@ʖ ?`7@E@O@] @@ ?`7?``  Z# 3   >@ $@ Z$cД ''''А5I6`@ ~`@y&` ~"  Z#؁㿘?"& I?&&   ~"Ģ'2   l ?3& P[ ?-b  )  ? j ?/??????????? Z/c7@ hHʔ j? H&& b  Z˩#㿘 2&& "&   &㿘H?&& &  `"`㿘 5  GPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPGXGHTHG(ILII4PPPJPG(PPJJKxKLNpNOpOPPPPPPGHHxHHPLHPIIIJ0JTPJpPJJKKN`NNODO㿐' ["p@ "`2*? *H ~"Ĥ'Lp`%fL`z`Q *` €Y`` [ *` |  ["x@yG`` [ *` `  ["x@i7``  [ *` 0  ["x@Y'``  [ *`  ["x@J`'l  @O [`   ' [ `  [b@ `  [b@ ["` [b@` ېג "  [b@Ͱ` [ b@ݖİ` [b@Ֆ` ȷȳ "  [b@–` [b@` [ b@ ["@Ô`  [  [ @ [{" [w"@ [b@t`@'`'` '`'`'`'`'` '`$'`('?'ؠ [Ȓ @O@O [F! ["@vD` `?GX" [b@P7` "  [b@E,&GC i `'l`` +!?! 2m!!  d 2n!!! 2mn!! !m!! d !n!ې!אԒ! !m!n ̐&?Ȓ $?&   4` -` - 5-:  V g  [b@ '   @՚ ["``` " F  [ F  [b@}` [b@u [l` [` '` '@fd' '`'l  @Q`'l  @H`( @r@` D`  ~b @ @c9` 5`$`6 [ [" #@QF7 <F4 <* ,  <,  [c@#  [`  . L    [d#㿀# ~bĠ' @ې@ b  [K#@ `@  (*@  㿘ƿ dƻ dEҒ dEΒ dEʒ dƫ d  `d ?`    [`  [# b  &  [b㿐xђ  ?&㿐 !АAÒ"@'c"@* "@*`@*`'@B  ! ~"'''" ` ` @B0!`#`? "77''''@W*"  [Ǚ#(X  N "g @B @`"` N@ "\ @B @$'O '@@ΒĀ  F  | Ė ?'''?'''' ` #\ ` c b4 П $     [`@c8Đ?"`h@谒 `$`@!  ` " @@! D@ =  2 2 h@;V l   @@ l?& \& h  h 2J h [ [D㐐$@ #" @< - ?"0 hAf !`#  '''Ē '@@ܐĒ@ C&& hC"lC"̰ @;АȰ     ?   ??//'a'b  @" 2  [@Ԑ#" @; #    @" @;  |'''' #\@bb"| DЀ  "   ~ [D#@&c `€ ?Z& h @ `* @7 `/# 2 & H"W @;[S   & L. H. I& P& T ` . J ` . KԔ A. L `. M `. N ` J. O6 X& h@ 1D  |'̑2`@:`' ` ? @& \a''b H   \ & ` [@A#& h \ I ? [@#a&%a`2&@   \$ 㿘 ` @?& \& `㿘n 㿘 >!  @   2 ` @`$@$@:Ӑ0 ```__```$``````````㿘1 2!Ȁ 2!@9!&!!ȁ㿈! 2 q `€@y \@?! 6W \$@ `< W"Г*` €@ \ @$4 \+0 \X@ 61 \$@ @  \h@ \p@ \0 \@   \ \`@!  \@ޒ 㿘 ~ \#@֒`h  \ \#* 㿘 ~ \#@c8㿘W  <,  <`   <`ې  \Ԑ @0 \@@!  Ő  \P@! ,`,`㿘ː ~ \#@`h  \ X* 㿘! 2!@8 !Ё㿘  `"@ J@  "@ 2N@@>^  @ *@`N &*@`@8Ð  @8 d 2  ~ ]``@2#! < $ <% <$  2@ *` 26 @9o@9my  6#$`  d< &@'  @   ! < $ < <$ ?O`@K`$`$@$` $` $` `L$` $` t>$` @;' ''''Đ`0 @= @ 2 `P` #`@f``€`P$`H``Z@Z["\`@  $@$$ `@8 @8 h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@ג q $@Ӓ  $ $h 2@d   ` % < $ $Y % <c ,&@'`,'`''@m'耢 F@  $ "'0<Ȁ2' @L $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@X $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " P?? P `@ L@7@7p2   * $, ,  '7?#rے Ь"@  ?l r̐"@'"`'ܐ@? ؖ"@ 'В"`'Ԑ@?В#* $, ?h,  $ `" & $` 0?  , ""%""` & (& $? 2 6 & $& (? & $& (㿘 b:?&?$ $$ ( @㿀! 2"Ѐ 2  < @0 @ 2$"+  < ' < ,  ,&  `&  && &  &  & @3 (@1 @. @& <  `@㿘 2"Ѐ  ` (<   qpppqq㿘@   ``@ C!㿘@  㿘 @` " `    ``€ @`  @`㿘@Ւ " @   @ޒ`  @ْ`@` 㿘@̒ @` " ` 2   ` ఒ`@   㿘 &`&` 2 @ @` @`  @` @`  [4*  "@ "@ "@  "@ "@"@ "`"@"`     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &``"  " " " "    " " "   "@   "     # d? *(#d d*`  *` *`d#@ #  #"@d 0#d*@  *` *` *` "  #㿘  " $ @9  @$  㿘 @ "@$  @9  @$    "    @ " "        " "   㿘@㾀 ~"Ĩ'`2`!'ǔ쀢?2`^?@9     '`  ' ? .G"'` ' ) .`*  .@ ')䰒 01  )"= ! 1٘  "v"@ l쀢  h""  ]ߐ p  o6 a?a!'''#\ab7ڐ ! / !'!`d''''' ^#\`  ڀ   < "`< `<`  ڀ 2  < "`< @܀?"6 ;6 ځ㿘@m @h`  @c` @^`  㿘@3} D  ~ ]#@ `05@@ $ <@ @3j$ @  $  ~ ]#@ ޒ`@400 $   2 $    $ 8a& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @1 2  & @ "㿘   4   8 2 @f 󀦠 8@> & 4"$ 4@㿘!    " 8 @7 & @@$  @$ @  2  㿘   7E ?   "  , ?  "@ @  0"@ @  㿘 ܐ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘 @3 @3㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` " @? ?"   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@6 ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?p ~"ĢЦ' N  @6'$` ]` ''ܢ@ $@@6$`` ]  $@:$@$`%ǐ   ] 㿘 5  㿘`    `*. "  0.5ْ ` -. 㿘 ] @ޒ   \, @@b@  "`?@S@  " " @.㿐. ] !8 ]  aP#\#` ""㿐 ]` #\#` ``8   㿘? ?  "" \5 @1S 㿘?2 ="    6    ?@ .@ 2`@:`+  * @    @ ` @ 4@ 2  : + @ *` Ҁ6 ?6 ?@ ؒ@ hHHH㻐 ~"Ħ' "?N @ / @w 2  ] ]@4 2 ] ]! ]@4!0  ]!8J B  ?* : `(3a!ؓ*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@?2 L 2 L ?  ]s!@ !h ?,Fƒ 7$?#\   @4ِ 7{?2???#@ @/U  && ĐZ?J       (+  2 " 2+J " ?J@   J@J`  㿘@& " @  2  @`@`㿘@  `@  㿘@ޒ㿘@  @` @(` 㿘@c @㿘@\ @㿘@/  @"` @`  㿘`@ܖ$㿘@ @` 㿘`@Ɩ$㿘@㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐N@'Ȓ  .@ 㿐@'ڒ  .@ 㿐 "    0@  @ '€@€    @ &@  㿘Ȓ㿘$ "       2  b2      2     a@`?㿘@l "2  2+ "   0"   @,&@   ~ `#@"c     @-i&@㿘`–$㿘 "   @ "  2    €㿐 @   "7 @1' -8+ `  ` 0!  2@,C&@   ~ `#@c@ ,1@,&@  㿘?㿐 "   / 00@  `'' # `€@€  @€        >@  㿐 "   / 00@  `'' # `€@€  @€        >@  |ldt  f(             㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘(`   "L 2 $?  "\L`X  0,3 ? L X @. 4GA,? `L X`  ``%<' L/2?,] e,  `^ ]"8L`*Δ!  &@O , A, a,D` ? "1! "7 4`/ DW  '` #`? a L` `Z" ,  `@ `  `*:  z ! ~"'P'T'X'`#`ذ ''" ` ` @/۔!?"77''''@ P*"  `L#`㿘T 2 0°? 7"   `" "a"a  @ `" @  &? " 0@*  0`  @@" 0@*  0" D "$ @*$ D$ 4 $ 㿘 0   `a ?"a@  ? ?$  @`$㿘  @^㿘 <#` U$  2 0  J? "  @J4 "  @= C? $  ?4 $   4 ` @@" 0@*  0" <`$  8 '$  2 @d g@8"  $  $  ?Ȑ*@$  4 2 @ 4 4 $ ? 㿘'L'P'T'X@$L(((((((((((((((((((((((((D((h(((((((((((((((((Lp(|(l(((((ЀЀЀЀЀЀЀЀЀЀ Ѐ0XЀЀЀЀЀЀЀИЀЀl\\l\\\\\\Řl\l\lLLLLLLLLL\\\\\\\\\\0\\\\\ǰ\\˼\\\\\͠\\ͤ\\\\\\\\\\4Ǹ4\\\D@\pͤ\\ͤ\㿘` @ &`&`&`   ~"Ģ'''"`` ` @-!` ` `,`$7''7'''''@ @ɐ 2? @`  @4`   `Q#p8! ~"ĺ'H'@Q''`0   `"` a ?"a` ` 2 ` @ "` ? "   HW` p'ؔ ('''''@- ' ' (@,آ   %'ؘ?'؀ YԐ#" S$$@ ' 'C <pԔ'Ԁ`,ظ '''Ь?/K 'ؒ`Z/h ԓ*` €O߀ ؐ / آ L?Ѐ  33  ̖`/@ *,`: @*`" @ Т L?Ѐ  L $  ('H@`-`@'д'Ц '؀`-`@`'Ѐ Ӕ '  +/J*I'ئ L ?Ѐ  33  ̖`/@ *,`: @*`" @Т L?Ѐ  L $  ('H@`-`@ '؀`-`@`&O?NؐЀ  33  ̔`/@ u,`* "@ oТKИ  '؀$!3- 33  ̔`/ @ X,`* "@ RТJؐВ` '؀$2' ('H@] J h2 @'(J l2 ' "$`ȑ-`@ `, `-`@[``''S `-`@J``''B "`1-`5$` @` -`@ `*`:`(:``* !: (` -`@ `*`:`:``* : `-`@` :``:  6J  -/ߠ`D g  G "  `2-` `"-`@` ?`''ش?@Y  a   ` -/ `#w @^  `#o  !@ #`#\@ޚ'gG?@$ gg E e ef'@ ' @ 耢`   @   `4  $    -/߀ `J-`J@ `4-`4@ @ `-`@`2( `-`@`x*" `-`@`j"$ `-`@`]"`-`@`ԑ:`M:`-`@`B" `-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  `  `-`@`  `  `#'   x`-`@` `#  @ 1/"@*P #)/߸ `-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  ` f  `# `#'`-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  `   2 /߀'?$ S "  7 `F#Ȩ  4`,  `4 0 , 806 03,   `0,   ` `0, , 4`  ` 4  ,@)/  %/Ƞ /ߨ ''O߀ `' '4O" `.`3 aH $$` ' 'ʒ äp`aH$$@ ' ' pO߀  ߔ $$`  0/h/ih $$` ' ' p4" `.`/ X $$` ' 'r kp`4$X$$@ ' '\ Up"`-`/ X $$` ' 'B ;p`4$X$$@ ' ', %p! e$$@ F a BV `# $$` ' ' p耢@  $$` ' ' p?``/ X $$` ' 'Ғ ˤp`4$X$$@^ `` `# $$` ' ' p$$` ' ' p `-`/ X $$` ' ' {p`4$X$$@ ' 'l ep$$耢@R$$ @ ' 'O Hp"@`-`/ X $$` ' '4 -p`4$X$$@ ' ' p  `# $$` $ @ ' ' p  `# $$` ' ' p$" $" @ t 耢 4 R   ./h/ih $$` ' ' p a B$?$ .@ ?`4`/ X $$` ' ' p`4$X$$@$$` ' 's lp$$ @ ' '_ Xp 1" `,`3 aH $$` ' 'B ;p`4$aH$$`'`'- 2'`  &'Ԑ#А"  '  2` 'p   2` '` @ ?' "?'`@o (LC ' ~  `|#P ~"Ē '''/*` *@*`**` * *`@%Ԓ Ħ  - @} Ā % ?   N `Zxh"*` €N ?Ѐ 33  ̘`/ œ*L@@ *`# Ж `L@?Ѐ  L@ $'7N*? N ?Ѐ 33  ̘`/ *L@@ *`# Ж `L@?Ѐ  L@ $ @4 *@`@4 *@ Ѐ NЀ  33  ̔`/ ]+  * " W?И NЀ  $vq oN h2k@ hN l2d a _]@K4ʐ  @;4  @.4  @ 4   @4  @4 @ @4w  @4i @ߒ4^  @ђ4P @ƒ4E  @47  @4* @ @4  @4  @4  @s4 @h4  @X4א  @K4ʐ  @=4   @04  @"4 @ @4 @4 @4z @4n  @ߒ4^  @Ғ4Q  @Ē4C   @46  @4( @ @4  @4  @4 *@v t* &#\   @#<??&Y? L `=h"@*` €`+ @''`-`+ @''`$`+ @''`: `+ @''`: `+  " `+ @''`Ț ;@  ~? " I' ~"  aW 㿐@@* @6@@z@ #\   @"?&@@#\   @"??2?@!@H@& @  @"$@ &@㿈\ f   e E  #\@  g G f' fJ 02 @? a ( B  '@@? a ( B3'@   0`*@@ '`" "@ X ~"Ġ'`, -,   +,  쀦` >  0.%S ` `0..   Đ 0. `0. İ&  a 0 㿘 2@"G" 2,"  " * h 2#0,``&: 2` ! *`"h@o*`$ $ @"&$ $ 㿘  ! 2@""  2b*@ "&@""@ 㿘   *`` " 㿘*` *  *` * `2&@ 㿘? ?* & & 㿘? #  " @"4`4  *  $ 2  , p  * @!  , " & 㿘 $  *` Q  "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘ؐ  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c! @  !4`4 444 4  $@? #!ؐ 4 4!В4 @   4 $@  $'  "' 㿘`  !l*  >``2% 50` ' 2! 2@ "]"q$0"@ ~$@' 2 2@ t@ R$@$@ k`" >`FA>``2@㿘>`@ *   `` "? * ` " * " 2@ ` " " ?& `(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  :  4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐 ?. . 6  `''`'ِ   " *@ $ 2 '$   $   $  $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?`  " * " *#??āh@'H @  !?  ' ?  ` 2L - + '2LL` `0 *  L`0 `\* : (     -`*   ?4* *  ?ЦL `/`9뀤 :@E =L`0ϦL`0 π 6`e  (   ?  -`*  4* *   -`*    * *    LЀ Ӛ`e `EI 2  2"L`+ `-І LЀ .`0ϦL`0"π !ЦL *  L?Ѐ`/`9*$ "" 2     H &@  '` a!PB?`  a`@* @'&'D a!PBD? ? @ 2;$`"pH'`   a @.` &'D?aH"@ $$ a`@*@&@ &.`' B@?"#F?IH  a @*` &'?;H$@T  a @* &'D?4:y( "" !x ?H   a+ @&'D?: ?, '+ @(&' B? $ #'?'_ 'YV   a @* &'?F:/   aa + &'D?: + a @" a!H#H? J#"F? H?J  ?x " "H8@?0' '*'u  $0o@# @@"?  ''0W?@  ?   2'?'0C @ a!H? F 0/  a!X! * a a!`&4' ?@ a  a x a!` a!h!` a!p!pB'!pB&'??@?؀ ȉB) @@)?,?А '?Ƞ  ' @cȅD?   #'?'0E '0@ a!`  a!pBB?Z?Љ @ȅD? @@ "F"'   a?@ a a!x  a! 0!   * @ | `     쀢 @ &  ?3 6"  @  4`$ $@ &  `mh`*  m % N   ?@6420.H 2"䀢 #㿘 t -    `L `1?#  3 @/4`4    "@ @2 @:`"44 3`: ('  "' ܐ 0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' h?'P  'T '@ * ''@  a T#"@̀  a? a a\! \! ! B T " a\!   ;Ȼ2g Ⱥ| ?* &' d2`   @Ȑ"̒*2   ̐"*@'  a!B?{͔ ? '? a! a' aa!ș D a aHFBL ' B# ' a @, $ȇ%)'#?    '@% ' 8    "'u \. €?'? 'P'PP 'PP' 'P``' ϐ   Ⱥ  '  a `@* @<"  # aȠ !  ?Ȁ  a /`@ &' B<  `ȅ!?Ȳ a``@* @>`$Ȁ %B? a  /`@ $ȇ%B?ȡ<  `耢  aa 9' 쀢  aa艡 B ?' aȀF!?0D'@'& a!'и '$% ?ȅ) )P?䀢 I a`@* @ $ a%" ȑȍB'`0.ȍ…&' W? a!Ɓ) 0 @6V?ȕ$ a%!ȑ DDB?ȅ'`0,Ȥ…&' 5?ȅƁ)} 0`@4?Ȑ* `@@ $ a% B!Ȁ@B'`0,Ȥ? a"D-Y 0ȉ&' 9?ȤL 0"Ⱥ`D??Ȧ  ZX a @, "P # '  aa Bȁ  1. Ȁ@̍B'`0 L,Ȥ ?ȉ"#B  ?ȅ$%L` 0L 92.  , a!艡 B a?!D`'Ԁ  'Ѐ ؀d3 6" &$' % , @'Ю` `@4%@%&@䀢 ` 'Р  `̀2'?2 ' @ `''   *` ` '@``` "```@@`耢    `В  '쀥䀦  ߔ   1Pɦ8  1. Ħ`O'Ѐ 'R` 'Е*@ < '   Ѐ 2     ' ' 'В  'к`7Ԣ 0Wm  KA`  ̀ `9* 4`e,& ```̀` % 4`2N,`"K,``:  9E, `9` 9,,;,,@  < `ؒ 0,@  4 `L  1L 9   ,. L 0"ʐЀ  Ԁ`@ 2, 0.  ,T"\2"+dd a0(# $ 5 !8       $((()(*(+ (,!(-"(.#(/"   8"8 "` "`"8;`` (` `?# *`?;```0  ?2 `2 #0 ?(@ 㿘` ` ` 2 @@ "@q? "`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @` ``&@$`$`$@$`` "`*@@8`@"@$`$@.@` @&@@@l$@ 2` `` `,` $u` ` @ `@"@$`$@`" $&`b   `  ` @ "@  `@ ` `@ @ @Д@@@$@ +0@ `,` 0   @`@"@$`$@2`@   `" $&` ` ? @4` 㿘 <#`2  2  $ "  0`  @@" 0@?  0" &   ?6 &  6   2  " @b?@   &  &   &  㿐  C & & '&@%@4  *  C  & 6 & &@"`& & & @ZV  2` 6 (T  &&&_  &< А`?`&$&@(&@ $ L( (!p@"$㿐@ ?`W% > ~b  @      @  9 2$ #\   @2??( 2$  $ $ $ $   $ $ $" *@ *`$ ` $  "`"`@k  "  @o㿘  㿈@ !`R 5 h >` 6" h .,`*  `# "' 2?' ' '@-   $ @%  @??< 2  h? % hb" %b9%b㿐@J`D ~b  @ >"   #\   @y?? $  ِ $ $` $"@Ŕ   $ $ $ @  @㿈 5 l` l   '?   @ݚ ? l? l`! ~"Đ'@8"İ@   a#p㿘 `S㿘 2 @8 |  @ o ? "㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘   ? T` "??`X2"  `  ?2  X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@`    ?"J@ @"J@@ 㿘 㿐#\#`  Eǚ 㿐#n) @    ``  @n " @ " 3  `!3  Вa$p3 # $# ,# (#  # 㿘T ؔ  P > B< P ?Đ*@4 㿘 ! V    ?Ē* 6 V 8 㿘T   ݖ?  2  ?Đ*@4   4 < P㿘NV 㿘N r   w a  0 0       & "m  "N + b @ N  +@   @ &@ (`` mr  "@!ܠ ?$! $!ݐ?$!m] T !#4   Ā@`@  ` @ K0  " $! !$! !!?!m+q2o O!a@2i O ?   a!  €#x @ " Z O (1 @ʐ 2[   D* !8  *@ :@ *`$!@   `@$!0@@$!0  ! @ ?$!$$!4@ j $  lٰ @ܐl%"!ܒ`8l#c & & & & & & & &  & Z!@ l" 㿘 ?@ @ 㿘 " ? !?l? "( !` ! @$ $ $ $ $ $ 4$! $ 8$  D @s  Ē @o @` g :  @$ $ - " @ *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$ l@   "$ @  㿘 4R  & @Ơ  *  D# *#  * ,& $& `@" " ?!.`2 ? & ,& < & 0+& (@ , @4& @㿘!4@   k!؀ !!ؐ?* &! @ ?!??&!@ 8!@X 2!k! 6!!8, @ "!@ !! , ! "!@ ! "!@ !?S@  k?"㿘` k "?"? !4  @  2 ?@  2?&!0 㿘!4 4aa!  $ a$  #x$ @!! @ ?! ?  ke? Okb"$!,!8 đ. ` . @ @  2?  .  㿘 @F k< "&!,?㿘  "!k+  !  k# "&!,?  @㿘 k !  @  k "&!,?㿐 @ @ٖ ?P ` ` -` G`   % 2  `@ @ G`   @ "s ``݀@ǘ +2 `'@* 2 `@ "W ``  T?` ` @ܖ F?F ` `C `! ``+00 `6 `,@  @  & "@&@ 2 `@  `?@  ?0 @ ?? ` ?-`㿘 "!$j9 "$!,?  $!$ $!(!$   $!($!$$!  ! !$ $!( ( @ "j?$! @ "  ($!$?$!$\  !(`$!(@@4!$!(*  `2@ *@ @א $! $!(`  @ `!$$!  $!$"! @ "! !**`     @"  ?0! `@   &@@ ? " &`(! 2   &@  "@& 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @5 !ؓ,` "  ?!! `&!&! (@    D*` + "&  ,  & ,& 0@c㿘@  @ ]&@ O @$㿘! € , (  0㿘 @   $!؀`$!  @ܑ.@   i/?2i*"   *** !ؐ"@  㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?@  ,$ ! " "@!&& $! "㿘!! @ @!`"@`"@!$@$`&!`"!!   ` ! @2`@2     @ @* $`@  @  ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` @  2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     @͘ 21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   @o 2?`"  "  @ Ò @&  " @"!2  @"``"` *` @`"!"`!"@! ` .L......t.``7 ``22`(* * * * * * * * ؔ   (  㿘  ? gO   " @Ӳ @ 9 79799899998888T98p99989898999998989999997999988,8H98d9998989899999898p h ! a'Р#@   7a''@  ''@ '@ '' ac ''А   a @`p ! acА h 7!0` h '@ Ԑ  7a'Ԑ @ '''@ ʐ'@ '' ac '' Δ 㿘 c! 5` @ 0ْ  a# 7aD""aD X"@ %@"@& X @ ᨀ<7 a- 7ᨐ *  \`(*  0 "kD$ &"$%D"* @, 0 "XD"$"@%D  ᨀ ᨀ an#ᨨ " 7# 7 `? a d a @  $?$ X& X   ᨀ2 X aD# Xᨀ@ a=#㿐#@ X4  #\   @ ??l 7aDh"aD@q  a *  7- 7a  *  \ `! @ 7   %$`$ X8a ܒ 7a"* @@   7! ` "@$ X"% X#\   @ ?? 7aD"aD Xa@ b 㿘 7!P@ 7"!H㿘! 7!H/ 7!H 7aP @ $!HH ~"Į'en + 7   b ʔ ?  ,m  2z b@ސ 0 >"ojLđ* : `>Y#*` € a* !U"a!R"a a2 M"a J"!  F"a 7C"! 7 ?"a 7<"!< 78"a< 75"!  7 1"a  7."!$ 7 *"a$ 7'"!0 7 #"a0 7 "!( 7 "a( 7"!, 7 "a, 7"!4 7 "a4 %a8  %a8! ! b @$!$!L  ia8  7 "a$d!"" & & &  #\   @?&  b `&   7aD"aD @ @O8&(&   b x㿐 #@*` *` #\   @??O  7!D@"!D @n  :+  *@ 2*`*" 2@ @*`" @  * @ *$@ `"  *   .*`  bC   !D* "@%!D &  &  & &  㿐  2! #\   @#?? 7 !D@ "!D   "& `T`T  & @ T$  "@" 㿘  *  6`] # 6`*`.`" 2  @  @ *  *  * *#@  @"` ?$ 㿘( 8@ bĐ ?@ 6`*`.`" 2 @  @* * @ `22 *㿘 ? b    &@ & >` .`"    "   .`2* *"2` @ * @*@@# "`㿘V?c 0 `X #  6 6   : 6 * 2 #4@6 6 & @ 6 55 2@*6 6 6 6 &  ` `.`  ?2 * #@ `" 6  2*  (   #&  b В㿘 ( `   6`` >```*``} 2 a ߐ bܰ  Z"`  bӐ ` `  "    , ;`Ð  ?",    `:?2 @ b2`4&`*` 4`@$$@ 7?a$": * ` , `  `@z`㿘` @ bw   (?.  2 b!0m2*   2  b!(0a( #   ` 4  *    `2( `"@ "   : `" @ "  * $1" b*!@b' )"@&"  2" `2   7!`2  @g  []㿘U 7 a<?#"  #? @ % 5tՒ? t  t/aհ  @"<`" @+  bǐ!P 7!@<@ "!@ 7!$`<$@ @  7!(` <$ @" ?`<$ @ 0 5 t`   @ 㿘 5p 2 7  b"p!` 7" ~"`@az "㿘 ~"`@ 5 t bap 7"! b  7@ 7!4` bU!aR  &"! 7!  $! 0 7!8I!$!b  @   7!4` b0!a- "㿘 5 tW s?@  `` *  H 7<,$ #@   b-!< <  b"! 7!` 7#? <" @I   b!P 7!@<"@ "!@ 7!$` <? " @Ȓ ߒt%t'0" 7!$` @ :t * (\@ "@  b֐!0+㿘 # ~b ! 7@! b a 7" $!,h!$!b @㿘  5  t  7 b! !<?c"@ @ `f  "?@  ? *   !< bu!!<$@ !<@@ D C@@?@ 7!,`:@#@? @ @!<`@@" @  "!< b!P!< @y$  b!P$thE% @(A%  7!$`!<@$@ "@ 5% @4 @ 7!,`@ 7!$`&`$$@@  @ 7!,` `   8@i0㿘 ~"`@' 5 t ba 7"!B b  7@ 7!4` b!_  %"! 7!  $!  0!$!b  @   7!4` b!_ "㿐 >"?' @/  a   `        ` @"`j"  K  @ `j  @2@  0 c@2" ; c?? ~" ;aP / ;' hp! ;1 ;T! *? T#!P*`-T 'h % 'l'd  d @ _T T $"X-T  aT` `-aT   @-  ` aT, , TT*  @Y?"&"\b  bW!㿘 ~b  @< ;b\? "b\ ;!P` ; ; !T!T*!T @ ( @ +@  +@ "  @ @㿘! ~" @ l" @㿘 ~"`@ ;!P` ;U ; aT T?  *aT aT` `-aT  x@-  ` aT, , TT*` @㿘 ~b  @ ;b\? "b\ ;!P` ^ ;bX ; ;TT (T   ` + *  *T  (T ,   ` + *  *T  (T +` +  *  *T (T ( + *  *   @]㿘 ~"`@Q ;!P` ^ ;bX #% ;T`' ;\? $\ T ,T ` `  ,` , ` , ." @㿘   8 .  ]= ] ;TT (T    ` +  * @* ` XX XX$X0X8X@XdXHXTXTXTXTXTXTXTXTX\Xd㿘 @W `]SN I   < ; <" bb@> <:    2 "-  ?`#"*` €#?###    (",&  &] "?Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @* 4 ;` / "`#8*"@ J=2"`"  J JJ 2 J=ې    㿐ƒY V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*(㿈'XX#d#h#\#` 3 Ł J " " @ ` ?  2  㿐#\#`  3` $2 c@$ c@ $ʄ c@$x c@$J c@$Ą c@㿘,` ``$, @2 `{,`2`6 $, 2 p`,`2`,``2 6**`@6$ 2`2`㿘`. `@I"?. "  ,(* *`@`2 `" @ 9@4(*`22@22(2$(*   @4 248?$8``.`㿈      2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'z2%* "@ , 2 $ @ @ "@44 @ '" "'`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@! 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2`) c  @V   l  i,`,`2  ' %@ '`' `# '`2#  * @  `@ } @Ӑ "q #. * @  `@ ]@ 2"?O .`* 2`@  *` `8,`,`2  *F @ے 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?v "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  ̔`@0 "`?@۔`  .` 8` & 8 ([` 4 $ ?㿘 4@@ `2  & 4 & 4``@W.`,`2 `  &` ` *`*2*  2224`㿐!  6@  ?6` {6`  <}?*  D@ 6  *@  <?  k ?*  D@   >  ? K?  `X? OB"6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.`.@@  `@?7 .@.`` 㿐!? @ 2h?  ဢ@,! "@ :  $'++ + +    @ 7 **  <ǐ?*  D@ 6  *@  <   ?*  D@  j> 0? W O"?㿘 !!<   , &!  " ې?* $ ĕ.2 !8.`" $      (㿘 D, `$* : ?=@ 1 8. @@m Ā2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$  b% *` ,$   ?$   * ?2% ``m b, Y  2m ` g $Z b% * ,$  , ?$   :** %  * @% , ;V  :**$   * @%  p*` $ ?%$  D D .  4  ?* D@$@ g b. .  6 b@ 1!+ V " 㿘`2 ` '*  D@  $&& $ !8 : +`*`   @  :**$   * *# 㻈 ~"Ģ'_A 2 b7"x  b" bʘ$#?V? ?"'D ɞ?&!eW! y  5 ! ?b  b"㿘,``$4, @2 `[`$ 6, 2 R64`4`` *`$ @2`* 2 㿘!@6  .`!8$ .`     0  2{ 㿘`*  m* 2 *`*  4`$ , 2   +  +  42*`4$ 2+ * 2 4 `|%0+   &@2 @ ,$@,`4 2 Ð4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2  +  +  42*`4$@ 2@*  2 +  4 > 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2` M`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`  8 ?$ 8㿘`,  " *`2 (  `$*, 2  & 븖 $@``" *2   **2  ?,  ɐ ??㿘 @+  ? 닐 "    +  @  `+ &@  㿘`.  `2.*  ? ` "t?`  .  `*  ? K ^` ?* @   2  "?3 -,`E?  &" !&  * !$  &!(&!$&!  ? )&!  &!(`@ 2# !$&!  &!$ ,`2 @?&  !  ! &T "?㿘`   "@(`! Lz A&!, &!( * ?ǖ 0&!  `,!$&!  &!$* 겔 Ĕ $?,` 2 @ ! `@ 0S "?㿘@  ?&! &?㿘```? * 2 "@ ` !  0$!  ,&?@* V ΐ ,` 2 @ !``W@ 0SS "?㿈\'P 2d?@ P* 2`` 4 P $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ 㿠%s: %s not compiled in instbinUsage: %s ..., where is one of: %shostnamedmesgexprmvbioctl-shshkshsedmkdirejectmtrmnewfsinitfsck_ffschownchgrpchmodgzcatgunzipgzipcpeddhclientmount_ffshaltrebootftproutedisknamesinstallbootmknodfsckumountfgrepegrepgrepmount_nfsmorelessping6rtsollsifconfigcatpingcpiotarpaxdisklabellnsttyrestoresyncmountdfmount_cd9660dd" P" t" " " @@" " " " D " P@@" lskipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdconv option disabled%s%s: illegal numeric value%s: %s%sstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%s: end of device%s: short write on character device%s: short write on tape device%zu+%zu records in %zu+%zu records out %zu odd length swab %s blockblocks%zu truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryA.%sskip reached end of input""""""p"h"`"X"P"H"@updaterdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rs:session number is %s: %srealpath %scd9660%s: Filesystem not supported by kernel%s on %smainusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'hiklnPt:only one -t option may be specified.-h and -i are incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file systemempty type list %lld %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s @Y Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*lld %10lld %11lld %5.0f%% %s @Y df: %qd: %s usage: %s [-hiklnP] [-t type] [[file | file_system] ...] ffsext2fssoftdepsyncsynchronousroot file systemroread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasyncasynchronousffsAadfo:rswt:uvforceonly one -t option may be specified.updaterwrqnoautogetmntinforealpath %sunknown special file or file system %s.root_devicecan't find fstab entry for %s.malloc%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountdmain,/usr/sbin/sbin/statfs %s%s on %s type %.*s: %s already mountedexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %smountfs%s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmaxmfs%s%s=%lu %ssizemsdos%s%s=%u, %s=%uuidgid%s%s=0%omaskshortlongnowin95direxeccd9660norripgensextattprocfsversion %dlinux) prmountempty type list%s,%s-ousage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s$OpenBSD: main.c,v 1.18 2007/09/02 15:19:25 deraadt Exp $./restoresymtableTAPE/dev/rst0TMPDIR/tmp/b:cdf:himNRrs:tvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure mainusage: %s [-chimRrtvxy] [-b blocksize] [-f file] [-s fileno] [file ...] option requires an argument -- %c$OpenBSD: interactive.c,v 1.25 2007/09/25 09:51:48 chl Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of files to be extracted delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list If no `arg' is supplied, the current directory is used lspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help runcmdshell%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! getcmdcommand lines cannot be continued missing %c ../..ls: out of memory directory reopen failed %s: %s%s: name exceeds %d char printlistWarning: undefined file type %d %*d %srestore interrupted, continue$OpenBSD: restore.c,v 1.15 2007/05/13 19:07:32 millert Exp $%sleafdir %10d %s %s: not on the tape ./%uaddfileMark entries to be removed. %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state |NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add links createlinksCheck the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$OpenBSD: dirs.c,v 1.31 2007/06/03 20:16:08 millert Exp $Extract directories from tape %s/rstdir%d-XXXXXXXXXXwcannot create directory temporary %s%s/rstmode%dcannot create modefile %sopendirfileRoot directory is not on tape extractdirs.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zd char treescan/pathsearchMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%u < %u) reclen name too big (%u > %u) putdirbad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopencannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create filewrite error extracting inode %d, name %sreadwrite error extracting inode %d, name %s writegenliteraldirno memory directory table $OpenBSD: symtab.c,v 1.17 2006/10/18 21:18:59 deraadt Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found lookupname%s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopencannot create save file %s for symbol table fwriteoutput error to file %s writing symbol table Initialize symbol table. no memory for entry table .opencannot open symbol table file %s statcannot stat symbol table file %s cannot allocate space for symbol table readcannot read symbol table file %s Incremental tape too %slowhighinitsymtable called from command %c $OpenBSD: tape.c,v 1.36 2007/09/25 09:55:33 chl Exp $-/dev/ttyrcannot open %s/dev/nullCannot allocate space for tape bufferVerify tape and initialize maps %sTape is not a dump tapeConverting to new file system format. .cannot stat .bad block size %ldTape is not volume 1 of the dumpheader read failed at %ld blocks no header after volume mark! Cannot find file removal listmaxino = %d no memory for active inode map Cannot find file dump listno memory for file dump list Changing volumes on pipe input? %s%s%s%s%sYou have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. You have read volumes: %s%ld, Specify next volume #: Volume number %s: %s Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) noneCannot open %s tape is not dump tape Wrong volume (%d) Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %lld Skipping %ld duplicate record%s. sactive file into volume 1 getvolWarning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe inputioctl MTFSFDump date: %sDumped from: %sthe epoch Level %d dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special fileextract fifo %s %s: cannot create fifo%s: cannot create fileran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks getfilewrite error extracting inode %d, name %s writeseek error extracting inode %d, name %s lseeksymbolic link name: %s->%s%s; too long %luunallocated block in symbolic link %shole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failedEnd-of-tape encountered partial block read: %d should be %d tape read errorTape block size (%ld) is not a multiple of dump block size (%d)Tape block size is %ld Note: Doing Byte swapping gethead: unknown inode type %d getheadVolume header (%s inode format) oldnewbegins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks findinodeChecksum error %o, inode %d file %s $OpenBSD: utilities.c,v 1.15 2005/06/14 19:46:05 millert Exp $mktempname: called with TMPNAMEmktempnamenot on ino list%s%ld%dRSTTMPcannot rename %s to %srename %s to %s newnode: not a node%sMake node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s cannot create symbolic link %s->%scannot create hard link %s->%slinkit: unknown type %d Create %s link %s->%s symbolichardbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s NODELEAFinode number: %d flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$OpenBSD: dumprmt.c,v 1.25 2008/01/02 12:59:35 chl Exp $Lost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?malloc/etc/rmtinvalid user name: %sO%s %d rmtopencloseC R%d readrmtreadW%d writermtwriteL%d %d seekrmtseekI%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s"). rmtreplyProtocol to remote tape server botched. (rmtgets got "%s"). ""x "p"h"`"X"P"H"@"8"0 "(" "" " ""werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard"""rprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOP"""""¸"°"¨" "˜""ˆ "€ "x#"p3"h#"`3"X2"P3"H3"@#"8@"0@"(@" @""""""-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5"Ř"Ő"ň"ŀ"x"p"h"`"X"P"H "@ "8@"0@"(" """""""""""""ĸ"İ"Ĩ"Ę"Đ "Ā -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk""""""""ɸ"ɰ"ɨ"ɠ"ɘ"ɐ"ɀ"p"`"X"P"H"@"8@"(@" @"@" " " " """"ȸ"Ȱ"Ȩ"Ƞ@"Ș@"Ȑ"Ȉ"Ȁ "x "pC$"hC"`C$"XC"H"8"("""-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho"ˠ"˘"ː"ˈ"ˀ"x"p "h "`"X"P"H"@@"8@"0"(" """-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostoposttablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s print%s: %s %s %s%d-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZmainusage: %s [-a | -e | -g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.17 2008/05/28 19:31:38 millert Exp $Ffhns.%s%s/%s%s: disappeared%s and %s are identical (nothing done).linkitusage: %s [-fhns] source [target] %s [-fs] source ... [directory] @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.134 2008/08/04 15:58:13 reyk Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsBEf:NRWb:cdenp:s:tvwbckmgt%srioctl DIOCWLABELunknown disk type: %sioctl DIOCWDINFO%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOBootstrap doesn't leave room for disk label\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:d%d#%up%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:A?P>>=p %c: %16llu %16llu %c: %15.*f%c %15.*f%c %7.7s%7d %5u %5u %4.4s %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu total bytes: %.*f%c rpm: %hu interleave: %hu trackskew: %hu cylinderskew: %hu headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] sizeoffsetw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: editsh-cVISUALEDITOR/usr/bin/vi%s %s/bin/sh # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sgetasciilabelsector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %lldwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %lld offset %lldcmplabel usage: disklabel [-c | -d | -t] [-v] [-p unit] disk (read) disklabel -w [-c | -d] [-nv] disk disktype [packid] (write) disklabel -e [-c | -d] [-nv] disk (edit) disklabel -E [-c | -d] [-nv] [-f tempfile] disk (simple editor) disklabel -R [-nv] disk protofile (restore) disklabel -N | -W [-nv] disk (protect) %sdisklabel -B [-nv]%s disk [disktype] (boot) %sdisklabel -Bw [-nv]%s disk disktype [packid] (write) %sdisklabel -BR [-nv]%s disk protofile [disktype] (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically.Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%swunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelFree sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) editorNo space left, you need to shrink a partition (need at least one full cylinder) No space left, you need to shrink a partition partitionThe letter of the new partition, a - p.Command aborted Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partition to nameThe letter of the partition to name, a - p.Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to modifyThe letter of the partition to modify, a - p.partition to deleteThe letter of the partition to delete, a - p, or '*'.partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. %s: [%s] %s: [%llu] %lldRounding to cylinder: %llu getuint@Y Error, partitions %c and %c overlap: # %16.16s %16.16s fstype [fsize bsize cpg] sizeoffsetDisable which one? (^D to abort) [%c %c] has_overlapChanging device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.Invalid entry tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.edit_parmsfailed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd""p""p""@""""""""X"8""0"""0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current partitions. By default, it prints size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'l' command prints the header of the disk label. By default, it prints size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk or a user geometry. It takes as an optional argument ``d'' or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate and display details about the available free space. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: ? [command] - show help n [part] - set mount point a [part] - add partition p [unit] - print partitions b - set OpenBSD boundaries q - quit & save changes c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition u - undo last change e - edit drive parameters w - write label to disk g [d|u] - [d]isk or [u]ser geometry X - toggle expert mode l [unit] - print disk label header x - exit w/o saving changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary./dev/%s%s%s%c %s %s rw 1 %d mpsaveStarting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. This architecture requires that partition 'a' start at sector 0. The offset must be in a free area. Size of the partition. You may also say +/- amount for a relative change.The size must be > 0 The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' Can't stat deviceioctl DIOCGDINFO[d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. %llu%.*f%cOpenBSD area: -; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] \ysFO]RIRINْ=8Xv2d@4$15~JvfJ9<:o_z_Ve2kMҸQM^NNe|.Oq-tYt&k묿\YIouvgȖwd9&^g5-|u\g:~Kʟ>ko |I'HM:7L%ڬ=9X,i>>쇇Y^e ; @fË~|H+~x-6k)1o1gFβ3- h N?z3y|2lnjשZ^Mm-w@RK.u항x)':@0/l) 7ݫkw|ةVnL3ݡuW<9%ghT"RPY䮳.|Mt]tq|56qۦ3{XnfjO/i <޹1{gJ]wON VQH 1󵵝ZJ$^yDNҸ_5rp o5̛n['[W!kK D&WtjDpsYѶC:ݝ].NgYU, &9v#jjb`|mʗ^ L)`}܆16` 0HG|cqڐY?@u"3Pul{16ԞB5j ހ5"ͷubzvuvu8 :H2pEX``4`` Y%Y~=\iݛ[Zn%rEkhz?Y?^Õ{E#=7@>p>imGۼUAޑߚlB l1p0\Jk@M8yHL~=&4c:)"YxAlBیKstiJ X;f#֯5#NJ#wխ?sv,.l }~#!=vslFȃ4aQzϑiHDZ TC(̑mRiPPlփfjJJ@q/hFP эnk]=b$-D6o+` :SLbl Jwa25قCck@x8[ 'sn4Rp8.*Jdrw[s˔TVeA|A#a-yNkd]c;80,1sZ9r072LQC|fAZ/ `WH 4WǶ== jdg6UV [1dC+Uxl9t E)I@'Lk@@$E.X mG"q삂5^F7MeXU/џ geI^k {4Mmh󺝤 $qINJ29`hx+l5abW/aRK |[ ӐӐnNJO1Cvz᠄făjseA)U A l(oAL ?V1Xgt TO૛Y\{q]d寷>ҫ@?X(Z+aqI^$ d3Z۶%(&sH[[-?\"xec&ccUFwQrŮmwF5҄(Al_y/#hjP?eZxAhO)ʒ}> pɂn\pక$9?J{BZŐ P0%{duBjSr[:];/07xܧB.HTb󃃔%sX_ F!$-q=љC:WF\9xvhi.Jo!90SѴ):]Ud\:!]K;&8s`g+)t rB dMl7Rer59nJĀjJfIv*Z]΂!I;esuc).>fOC G&ԨF1\G_GO0b#}t݄VG\q{|BnE݆͜Q0^ 6?mdhMcjS3`)5@Asܮt(ASqssտ0䮖3ԃbā5fF{;YzL؍LOlT_!zM{ 7Yq)p}$dQU͂dL$~RhLf.:Lq|׌;kʀTnm$Ҭ|~L{XeX "U)K'hzh8k#Ab[JQrCS )>O- $Enn}K=kK}8rSwvhxp̧ usX/E+a~F'op]cl+:R!\p"L4ζjK,o.J6[arFJǃA :5j $~-I+PeiQ7Q0DˈQǹԄVtIloMZ=֡&g 61ou03Ԩmzq4RO;(P@Քf~ҏ3LSX\5:p7lAwHTKexnuFVF=O#CvSUf3XhJX8Dc31RÌ;⸀8SOW`}v@a1;4LH^X2`//bSq1UܹJhocXO} I(|ن6[~ ,&Zf^XfIkNZ–ĉMOxU_R1th+T_/Dtur_ C1xe3ly3\*D9.y R>U=ZӚфDu8W!jCb6(ɓ->:h)Cy18H#-qB8~4ٓ$6Y=9 hUQcqqP;'o K)} ﹧Bc"Br*L78+e{Wq^O|,* +ŮV>|haC*xbSA9X`FSP fJn 2`L0=*"(Vp8Ӣ;(d3n;xbÜ&GFlzx K& N&.O7NE qh[Si!i"sqZۇ^x0. ;;a3۞ 1 ȱ tV=FJ)SpBA  XǨd$\#T\ҴDJ4GOxHx0ܘ6 =C0X7Ygo7ŷٷSyi2O_禥|Z7}ë@#9waw} 9]i ]eF8$Ӏ8P>Ci5}ѱN&7}'_OF큖vɑ-1Zŋ/f3NN8[m @=EekpxwSO[l`CVnx?ߟnf#9pNs~>o) qvd:,8RaD VbAl=-?ԃ8FVg)Χ#Zx([8'0g 9@Q9e8!>PǧȻ@J`]06 PAse&Z,Xa O wt5jLb5AOBHt?O~,; 4N{O6`!?T:&b=ߖA G`*-/86zU " ϔ  .ݓ}vK> j<"_)œ'sl V3L C(箩J orUkf:2ⅇx*2-p8&ܮ5x,EI/N7-ڠ;@xf=ynj~ZZ&>D{`#!%{ p'}yq'J 76bR Nhh8DjX7`)5<侹ǫy0,׼z6mVsBlœ d`+у\TCi*X#t&m2N : S@ )ZERZr 1'}=P7MfeΠ~fqw SCRX{c X[L ."P*pXqOC!#c|c#ŸqYs'FT ?󼊔gZ8+ع)Hh±WfS3ЗusR)63ӌr1;:DSI+)s"\*D^0VdbH$(M/F1't/4 w#- 6FuA 0qV?>H-ea=`@ n/޽[@?f!)=Qʠ>O|@C| Oq^ Q;R,F ||I- zjͦS^7̥w5zMP? Dp_j9n7E4Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksget_physUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again ar_nextcould not pipecould not fork-c-dccould not exec %s$OpenBSD: ar_subs.c,v 1.32 2008/05/06 06:54:28 henning Exp $listCannot chdir to %sCan't fchdir to starting directoryextractUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. appendarchivedirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %scopyPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.$OpenBSD: buf_subs.c,v 1.21 2005/11/09 19:59:06 otto Exp $Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.$OpenBSD: cache.c,v 1.17 2004/03/16 03:28:34 tedu Exp $Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%lu$OpenBSD: cpio.c,v 1.18 2008/01/01 16:22:44 tobias Exp $TRAILER!!!cpio_endwrCpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %scpio_wr070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %svcpio_wrFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sbcpio_wr$OpenBSD: file_subs.c,v 1.30 2005/11/09 19:59:06 otto Exp $Unable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)node_creatUnable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sset_crc$OpenBSD: ftree.c,v 1.28 2008/05/06 06:54:28 henning Exp $Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %s$OpenBSD: gen_subs.c,v 1.19 2007/04/04 21:55:10 millert Exp $%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == -> ls_list%s%s %s ls_tty$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $%s: unknown option %c %s: %c argument missing $OpenBSD: options.c,v 1.70 2008/06/11 00:49:08 pvalchev Exp $ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0Invalid block size %sbzip2Invalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedb:cef:hjmopqruts:vwxzBC:HI:LOPXZ014578Unable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8-I-rUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPE/%sabcdfijklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory usage: tar {crtux}[014578befHhjLmOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: cpio -o [-AaBcjLvZz] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-6BbcdfjmrSstuvZz] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adLlmuv] destination-directory < name-list $OpenBSD: pat_rep.c,v 1.30 2005/08/05 08:30:10 djm Exp $Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %srep_addEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistentRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s tty_renameFile name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s rep_name@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.28 2005/08/04 10:02:44 mpf Exp $.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handler$OpenBSD: sel_subs.c,v 1.18 2004/04/16 22:50:23 deraadt Exp $Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]$OpenBSD: tables.c,v 1.25 2007/09/02 15:19:08 deraadt Exp $Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memorychk_ftimeCannot allocate memory for interactive rename tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to allocate memory for directory timesCannot canonicalize %sUnable to store mode and times for created directory: %sadd_dir$OpenBSD: tar.c,v 1.41 2006/03/04 20:24:55 otto Exp $ustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %star_wrUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00nobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sustar_wr$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $/dev/ttywrFatal error, cannot open %s%s: : %s@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.78 2007/02/06 15:25:18 jmc Exp $socketsetresuidDI:LRS:c:dfi:jl:np:qrs:T:t:vw:number of packets to transmit is %s: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %stos value is %s: %sttl value is %s: %smaxwait value is %s: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommainA??zG{A.ping: sendtoping: wrote %s %d chars, ret=%d pingerpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms summaryA@YEcho Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host benstuvusage: %s [-benstuv] [file ...] stdoutstdin-r%s%6d malloc#y#y#yD#yD#y#yx#yp#yh#y`#yX#yP#yH8#y@P#y8#y0#y(#y `#y`#y<#y<#y #x #x D#x D#x #x #x #xh#x#x x#xd#xd#xL#xL#xp#x`#xP#x@#x8#x(5T#x #x#x#w#w#w#w#w\#w#w#w #w#w@#w#w$#w%,#wx%#wp$#w`%#wX%#wPF@#w@#w8#w(8#w 8D\-descr-descriptiondescrdescriptionlladdrinstinstancemode-mediaoptmediaoptmedia-link2link2-link1link1-link0link0destroyeui64vltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-chanchan-wpapskwpapskwpaprotoswpagroupcipherwpacipherswpaakms-wpawpa-wmmwmm-nwkeynwkey-bssidbssid-nwidnwidmtumetricnetmask-groupgroupdelete-aliasalias-debugdebug-arparp-trailerstrailersdownup#z(2L:%d: wpapsk wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher wmm powersave on (%dms sleep) %ddBm%s (auto)HIDENWIDNOBRIDGEieee80211_statusBA no permission to scan SIOCG80211ALLNODES none restoreieee80211_listnodesnwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECTBASIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandsonly one `mode' command may be issuedinvalid media mode: %sonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %s #0 #(`# ###CARPTDMIEEE802.11FDDIetherEthernet############$#$#$#$#%#%#x%#p%#h&#X&#P'#@'#8(#((# )#)#*#*#+#+#,#,#,#-#-#-#.#.#/#p/#h0#X0#P0#@0#81#(1# 2#2#2#3#3#3#4#4#4#5#5#6#6#x6#hc#Xc#Pd#@d#8e#e#0#(# ####################p#h#`#X#H#8#(e1-g.704-crc4e3-g.832e3-g.751e3t3-m13t3e1-ami-g.704e1-amie1-g.704e1t1-amit1OFDM72OFDM54OFDM48OFDM36OFDM24OFDM18OFDM12OFDM9OFDM6DS22DS1DS11DS5DS2FH2FH1CDDIMMFMulti-modeSMFSingle-mode10GBASE-T10GT10GbaseT2500SX2500baseSX10GBASE-CX410GCX410GbaseCX410GBASE-SR10GSR10GbaseSR10GBASE-LR10GLR10GbaseLRHPNA1HomePNA11000TX1000baseTX1000T1000baseT1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTmanualautoautoselectmasterfh11g11b11a## # ####### # # #`#`###x#p#`#X #P#@#8#(##framerelay-ituframerelay-ciscoframerelay-ansippphdlc-crc16turbomonitoribss-masteribsshostapadhocdasdual-attachtxpauserxpauseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sunknown %s media mode: %sunknown %s media option: %s%s media mode %s %smediaopt instance %d6 physical address inet%s %s --> %s phys_status ##`########backupno networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu lladdr %s description: %s %s: no media types?malloc media: status: , unknown supported media: status inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime 0infty vltime in6_alias%i%i: bad prefixlenin_getaddrprefix %s: %s%s=%o%s=%x%s: %sin6_getaddrusage: ifconfig [-AaCm] [interface] [address_family] [address [dest_address]] [parameters] SIOCGIFGROUPgetifgroupsall groups:getifgroups%dd%dh%dm%ds%lumalformed link-level addressSIOCSIFLLADDRCOLUMNS1ACFLRSTacdfghiklmnopqrstux %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%llddisplaytotal %lu %*u %*qd %s %*u %-*s %-*s %3d, %3d %*s%*qd printlong%s%s/%s ls: %s: %s -> printlink%*s usage: %s [-1AaCcdFfghikLlmnopqRrSsTtux] [file ...] adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured as a router, not a hostmainfailed to open a socketfailed to initialize interfacesfailed to initialize %sfailed to setup for probing routersselect: %sifconfigfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedmake_packetlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %srtsol_check_timertimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %ld:%08ldrtsol_timer_updateillegal interface state(%d) on %sstop timer for %sset timer for %s to %d:%dusage: rtsol [-DdF] [-O script] interface ... usage: rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script] interface ... usage: rtsold [-1DdFfm] -a <%s> %swarnmsgmultiple interfaces foundreallocstrdupprobing %ssockopenmalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %ssocket: %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %ssendpacketsend RS on %s, whose state is %dsendmsg on %s: %ssendpacketrtsol_inputrecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%d) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %drtsol_inputinterface_upioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...get_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedinterface_upinterface_statusioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sinterface_statuslladdropt_fillunsupported link type(%d)get_llflagsocket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflagprobe_initmalloc failedsocket: %sshutdown: %sdefrouter_probelo0ioctl(SIOCGDRLST_IN6): %sdefault router list contains a non-link-local address(%s)defrouter_probesendprobeprobe a router %s on %ssendmsg on %s: %ssendprobea:b:c:dfHg:h:I:i:l:mnNp:qRS:s:tvwWinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dtoo many intermediate hops%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)setresuid-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> %s pollrecvmsgnew path MTU (%d) is notified main?A.@@sendmsgping6: wrote %s %d chars, ret=%d .%c\%03odnsdecodeinvalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%g ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOP???%s%s, (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%lupr_pack@@ HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] ? [%d]%s pr_rthdr-%u %uNodeInfo Supported Qtypes, compressed bitmap, raw bitmap truncated no address %s(TTL=infty)(TTL=%u)pr_nodeaddrpath MTU for %s is notified. (ignored) --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1lf%% packet loss round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms summary@YIPv4 addressDNS labelIPv6 addressUnknownRefusedSuccessNo Route to Destination Destination Administratively Unreachable Destination Unreachable Beyond Scope Destination Host Unreachable Destination Port Unreachable Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirect Destination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %dpr_icmphVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->pr_iphIP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESP TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ... patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xff02::2:0000:0000nigroupusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [hops ...] host LESSSECUREmore-E-G-L-mMORELESS--WARNING: terminal is not fully functionalCannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll alsrget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunseek error to 0%cESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off /?_-(P)+! [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found:%s helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar-%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%s/HOMEbin_fileSHELLr%s %s %s%s LESSOPEN-LESSCLOSE-c...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSm%*s plinenum~ Calculating line numbers! /dev/ttySHELL%s %s %ssh (press RETURN)Invalid mark letterCannot seek to end of fileMark not setMark not in current filelLine number is required after -l/%sless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for help%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeDon't use keypad modeUse keypad modeHorizontal shift %d positionsHorizontal shift: Show tildes after end of fileDon't show tildes after end of filequotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminal0123456789,Tab stops: Highlight first unread line after any forward movementHighlight first unread line after forward-screenDon't highlight first unread linePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modeChop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters directly, processing ANSI sequencesDisplay control characters directlyDisplay control characters as ^XNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptUse the LESSOPEN filterDon't use the LESSOPEN filterDisplay a status columnDon't display a status columnPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesQuit if end-of-file on first screenDon't quit if end-of-file on first screenOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileAssume dumb terminalAssume intelligent terminalRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffersMax buffer space per file: %dKMax buffer space per file (K): Search skips displayed screenSearch includes displayed screenBe less helpful in promptsBe helpful in prompts%s: %spostoalinenumtoainttoaiprint_intiprint_linenum?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataap_posap_linenumap_int?-fileNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off/dev/tty##########и#а#Ш#Р#И#А#Ј#x#p#h #X@#P#@#8#0#( # @#####acdirmaxacdirminacregmaxacregminacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgsyncupdateforcerdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %srealpath %snfs%s: Filesystem not supported by kernel%smainhostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCfork/can't access %s: %susage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'bin_file(standard input)(fd %d)%sinvalid file typeusage: %s [-abcEFGHhIiLlnoPqRSsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxyunix-byte-offsetsline-regexpword-regexprevert-matchno-messagesrecursivesilentquietline-numberfiles-with-matchesfiles-without-matchignore-caseno-filenamefileregexpcountbyte-offsettextversionbinarybasic-regexpfixed-stringsextended-regexpdevicescontextbefore-contextafter-contextline-bufferedmmaphelpbinary-files%s[[:<:]]%s%.*s%s[[:>:]]%s^(\()\)$r%scontext out of rangegrep version %u.%u without-matchUnknown binary-files option%s: %sfts_read(standard input)r%s%s:%u %s Binary file %s matches -- [[:<:]][[:>:]]malloccallocrealloc%d%lldafh:t:vonly one -t option may be specified.nfs/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCumountfsgetmntinfoempty type listusage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]$OpenBSD: fsck.c,v 1.26 2007/10/20 18:11:17 sobrado Exp $Can't get resource limit to max data sizeCan't get resource limit for data sizedvpfnyb:l:T:t:-b %smalloc failedonly one -t option may be specified./dev/%s: unknown special file or file system.rorwrq%s has unknown file system type./usr/sbin/sbinufsffsfsck_%sstart %s %swait %sno %s fork%s/fsck_%sexec %s for %sexec %swaitpid%s: %scheckfsInvalid option stringempty type list,%s,%s-ousage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] $OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: preen.c,v 1.16 2005/10/28 07:30:35 otto Exp $Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s SUNEXPECTED INCONSISTENCY:%s: %s (%s)%s, disk %s: %s %s in fstab more than once!mkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name [b | c] major minor %s [-m mode] name p _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrapnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x %s: devread: lseek%s: devread: readstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block xresolveswapstaticssthreshshowsendpipesarttvarrttrejectrecvpipepushproto2proto1priorityprefixlenpopoutnostaticnojumbonetmasknetmtumplsmpathmonitorlockrestlockllinfolinklabeljumboinet6inetinifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpireencapdstdeletecloningchangeblackholeadd ##`########masterbackupno networkinsertedno ringactiveno carrierbotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, flush, get, monitor, show dnqtT:v/dev/nullsocketmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) write to routing socketgot only %d for rlen %-20.20s done king bula sez: set_metric with invalid key-in requires -mpls-out requires -mpls-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %s0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway netmask missing%s %s %s: gateway %s (%s) not in tableentry in userouting table overflow: %s 64128inet6_makenetandmaskinternal errordefault%s: bad value%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybad label: %s is %sprefixlen is not supported with af %dactual retrieval of interface tablereadgot message of size %d on %smonitorso_dstso_gateso_maskso_genmaskso_ifpso_ifaso_labelwriting to routing socketread from routing socketRTM_IFANNOUNCE: iface arrival/departureRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routeunknownrouting message version %d not understood%s: len %d, if# %d, name: %s, link: %s, flags:metric %d, flags:if# %d, name %s, what: arrivaldeparture#%dpriority %d, table %u, pid: %ld, seq %d, errno %d flags:print_rtmsgnoneconnectedospfis-isripbgp route to: %s message length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s priority: %u (%s) flags: label: %s %s use mtu expire%8llu %8u%c %8d%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: inet %s; %s: inet6 %s; sodumplabel too longinvalid table id: %sUGHRBD M@dmCXLS1@2 3cJroute-sysctl-estimatesysctl of routing tableRouting tables spd-sysctl-estimatesysctl of spd Encap: %-18s %-5s %-18s %-5s %-5s %-22s SourcePortDestinationProtoSA(Address/Proto/Type/Direction)%-16s %-10s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %s Iface%-6.6s %5u %8llu %5u %5s - %2d %.16sp_rtentry InternetInternet6EncapMPLSAppleTalk %s: Protocol Family %d: %s%-*s %-5u %-*.*s %-5u %-6unone/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-*.*s p_flagsdefault(%d) %sroutenameinvalid%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%dillegal prefixlen%s/%dnetname6af %d: %s0123456789abcdeflink#%dPOPSWAPPUSH?%u%%%s%u%-16s %-10s %-6slabel_print/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] appendSTOUSTORAPPElocal-filesusage: %s [-c] local-files %s: not foundmputr+wwusage: %s remote-file [ local-file ] RETRgetitremote-filesusage: %s [-cr] remote-files can't get cwdSkipping non-relative filename `%s' mgetonoffConnected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] bytecount value is %s: %s Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory local: %sLocal directory now %s getcwd: %slcdusage: %s remote-file DELE %susage: %s remote-files from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file SHELL/bin/shsh-c%sTry again latershellusernameusage: %s username [password] [account] USER %sPassword:PASS %sAccount: ACCT %sLogin failed. userPWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1modefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. filenameusage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmore|%sCan't allocate memory for $PAGER?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenamerecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletecrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. domacroExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sCan't allocate memory for transfer bufferWriting %sReading from fileSuccessfully retrieved file. %d%s: %s(unknown)Trying %s... socketconnect%sr+Requesting %s (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]80:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Redirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}cdRetrieving %s/%s %s/%sgetmgetauto_fetchCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socket(unknown)connect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. hookupNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s:getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %lldr+w%s %slocal: %s: %snetout: %ssendrequest receive aborted waiting for remote to finish abort. receivedRETR./mallocnetin: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomeEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. Lost control connection for abort.%cABOR abort_remote@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46AaCc:dEegik:mno:pP:r:tvVkeep alive amount is %s: %s-retry amount is %s: %sRetrying... mainftp> sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. !$%sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46AaEegimnptVv] [-k seconds] [-P port] [-r seconds] [host [port]] %s [-o output] ftp://[user:password@]host[:port]/file[/] %s [-o output] http://host[:port]/file %s [-o output] host:[/path/]file[/] stringlistAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initftp_loginsorry, arguments too long. (%s) TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swLISTNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.remglob2%s %s? Continue with %s? ? help a answer yes to all n answer no p turn off prompt mode q answer no to all y answer yes Prompting off for duration of %s. Interactive mode: off. ?, a, n, p, q, y are the only acceptable commands! confirm%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. .Unable to determine real path of `%s'fileindir KMGTP %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterA.%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d ptransferA.>?Phaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainusage: %s [-dn%sq] p$($($($'$'$'$'$'$'$'$'$'@$'$'$'$'$'softdepforcereloadupdatesyncasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:realpath %sffsmount table fullfilesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsck%s on %s: %smainusage: mount_ffs [-o options] special node ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'/etc/dhclient.confking bula sez: len mismatchlink state %s -> %supdownFAILalias_routehandlerc:dl:quifi callocclient callocconfig callocInterface name too long%s.%s/var/db/dhclient.leasesasprintf%s: no link .... sleeping got link /dev/nullcannot open %s: %m_dhcpno such user: _dhcp, falling back to "nobody"nobodyno such user: nobodypipecan't open and lock %s: %mwcan't open %s: %mPREINITsocket(PF_ROUTE, SOCK_RAW): %m/var/empty/chroot/chdir("/")setresgidsetgroupssetresuid%susage: %s [-dqu] [-c file] [-l file] interface ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.DHCPOFFERBOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK from %sDHCPNAK with no active lease.No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping.EXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %doptions do not fit in DHCPDISCOVER packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDECLINE packet.lease file not openlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environmentPATH=/usr/bin:/usr/sbin:/bin:/sbininterfacemediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpirypriv_script_write_paramsunexpected msg type %ureceived corrupted messagefork: %mwait: %mexecve (%s, ...): %mscript_set_env: no memory for variablescript_set_env: no memory for variable assignmentillegal character (%c) in value '%s'%s%s=%sdaemonInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xwarning: hostname %s contains an underscore which violates RFC 952option_as_string: bad code %d\%03odhcp option too largecannot fork%s [priv]poll error/sbin/dhclient-scriptrCorrupt lease file - possible data loss!expecting a statement.semicolon expected.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.no memory for lease.unterminated lease declaration.wrong interface name. Expecting '%s'.expecting lease declaration.expecting identifier after option keyword.no option named %sexpecting string.option data buffer %soverflowoption data buffer overflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.parse_option_declExpecting media options.no memory for string list entry.expecting IP address.no memory for reject list!parse_reject_statementgetifaddrs failedno space to remember ifp%s: not foundNo live interface to poll onpoll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneCan't create socketinterface_link_forceupinterface_link_forcedownioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %minterface_statusCan't allocate timeout structure!interface_link_status/dev/bpf%dCan't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfsocket(SOCK_RAW): %msetsockopt(IP_HDRINCL): %mCan't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't set filter-drop mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mCan't install write filter program: %mCannot lock bpfsend_packet: %msend_packetoption %s (%d) larger than buffer.rejecting bogus offer.Can't allocate storage for option %s.Can't expand storage for option %s.cScpretty_print_option: bad code %d%s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largepretty_print_optionDiscarding packet with invalid hlen.DHCPOFFERDHCPNACKDHCPACKBOOTREPLY%s from %s rejected.eof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal buffer$B$B"$B$B$B$B$B$B$B%$Bx$Bh$BX$B@ $B0$B( $B&$B$B$B$A#$A$A$A$$A$A$A$A$A$A$A $A $A!$Ax$Ah token-ringtimeoutsupersedeserver-namesendselect-timeoutscriptretryrequirerequestrenewrejectrebootrebindprependoptionmediummedialink-timeoutleaseinterfaceinitial-intervalhardwarefixed-addressfilenamefddiexpireethernetdenydefaultbootpbackoff-cutoffappendalias%s exiting.exiting. %s line %d: %s%*c^ subnet_numberbroadcast_addr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packets$^$]$]$]$]$]$]$]$]$]$]$]$]x$]$]h$]$]X$]$]H$]$]8$]$]$]$]$]$\$\$\$]$\$]$\$]$\$]$\$]$\$\$\`$\$\P$\H$\0$\$\ $\$\$[$[$[$[$\$[$\$[$]$[$\$[p$\$[X$\$[8$]$[($\H$[$\$Z$[$Z$\$Z$\$Z$[$Z$\$Z$]$Z$]$Zp$]$ZP$ZH$Z0$]$Z$]$Z$\$Y$]$Y$]$Y$]$Y$]$Y$[$Y$\$Yp$\$YX$]$Y8$Y0$Y $]$Y$\$X$[$X$[$X$]$X$ZH$X$ZH$X$ZH$Xx$]$Xh$]$XP$]$X@$]$X($]$X$]$X$]$W$]$W$]$W$]$W$]$W$]$W$]$Wx$]$Wh$ZH$WX$ZH$WH$ZH$W8$ZH$W($ZH$W$ZH$W$ZH$V$]$V$ZH$V$ZH$V$ZH$V$ZH$V$ZH$V$ZH$V$ZH$Vx$ZH$Vh$ZH$VX$ZH$VH$ZH$V8$ZH$V($ZH$V$ZH$V$ZH$U$ZH$U$ZH$U$ZH$U$ZH$U$ZH$U$ZH$U$ZH$U$ZH$Ux$ZH$Uh$ZH$UX$ZH$UH$ZH$U8$ZH$U($ZH$U$ZH$U$ZH$T$ZH$T$ZH$T$ZH$T$ZH$T$ZH$T$ZH$T$ZH$T$ZH$Tx$ZH$Th$ZH$TX$ZH$TH$ZH$T8$ZH$T($ZH$T$ZH$T$ZH$S$ZH$S$ZH$S$ZH$S$ZH$S$ZH$S$ZH$S$ZH$S$ZH$Sx$ZH$Sh$ZH$SX$ZH$SH$ZH$S8$ZH$S($ZH$S$ZH$S$ZH$R$ZH$R$ZH$R$ZH$R$ZH$R$ZH$R$ZH$R$ZH$R$ZH$Rx$ZH$Rh$ZH$RX$ZH$RH$ZH$R8$ZH$R($ZH$R$ZH$R$ZH$Q$ZH$Q$ZH$Q$ZH$Q$ZH$Q$ZH$Q$ZH$Q$ZH$Q$ZH$Qx$ZH$Qh$ZH$QX$ZH$QH$ZH$Q8$ZH$Q($ZH$Q$ZH$Q$ZH$P$ZH$P$ZH$P$ZH$P$ZH$P$ZH$P$ZH$P$ZH$P$ZH$Px$ZH$Ph$ZH$PX$ZH$PH$ZH$P8$ZH$P($ZH$P$ZH$P$ZH$O$ZH$O$ZH$O$ZH$O$ZH$O$ZH$O$ZH$O$ZH$O$ZH$Ox$ZH$Oh$ZH$OX$ZH$OH$ZH$O8$ZH$O($ZH$O$ZH$O$ZH$N$ZH$N$ZH$N$ZH$N$ZH$N$ZH$N$ZH$N$ZH$N$ZH$Nx$ZH$Nh$ZH$NX$ZH$NH$ZH$N8$ZH$N($ZH$N$ZH$N$ZH$M$ZH$M$ZH$M$ZH$M$ZH$M$ZH$M$ZH$M$ZH$M$ZH$Mx$ZH$Mh$ZH$MX$ZH$MH$ZH$M8$ZH$M($ZH$M$ZH$M$ZH$L$ZH$L$ZH$L$ZH$L$ZH$L$ZH$L$ZH$L$ZH$L$ZH$Lx$ZH$Lh$ZH$LX$LPeoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversXvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-namemerit-dumpSboot-sizethost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadsemicolon expected.filename must be a stringno memory for string %s.expecting a network hardware typeexpecting semicolon.Expecting numeric lease timeno space for numeric aggregatenumeric aggregate too short.Bogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dnumeric day of week expected.numeric year expected.expected slash separating year from month.numeric month expected.expected slash separating month from day.numeric day of month expected.numeric hour expected.expected colon separating hour from minute.numeric minute expected.expected colon separating minute from second.numeric second expected.buf_open: %mbuf_add: %mbuf_close (connection closed)buf_close (short write): %mbuf_close: %mbuf_read (connection closed)buf_read (short read): %mbuf_read: %mcorrupted message received%mreceived unknown message, code %ddispatch_imsgcannot seek temp fileout of memorycannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read filecbc_decodeinvalid pattern delimiter p unexpected end-of-file& no previous commandout of memoryrcannot open input filecannot close input file%d newline inserted newline appended out of memorycannot read input filewcannot open output filecannot close output filecannot write fileunexpected end-of-filestdincannot read stdin%d \  \abfnrtv\@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid addressinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown commandno matchfilename too longout of memoryshell access restrictedno previous command invalid mark charactered.hup/ed.huphandle_hup..invalid pattern delimiterno previous patternout of memoryunbalanced brackets ([])trailing backslash (\)number out of rangeno previous substitutionout of memoryno matchinfinite substitution loop out of memorynothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_readmalloc%soverwrite %s? readlink: %sunlink: %ssymlink: %scopy_linkmkfifo: %smknod: %sutimes: %schown: %schmod: %schflags: %slchown: %susage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory $m$m$m.gzdeflatefghqrcfhlNno:qrtv123456789ab:cdfghlLnNOo:qrS:tvVzcatzipcompressunknown program nameGZIP GZIP is too longoption -a is ignored on this systemillegal bit count -- %s-o argument is too long--o option may only be used with a single input filemay not mix -o, -c, or -t optionsstdin%s is a directory: ignored%s%s%s: %s%s not a regular file%s: unchanged%s already has %s suffix -- unchangedstdout%s: unknown suffix: ignored%s%s: name too long%s: input: %smaincompression not supported%s%s: won't read compressed data from terminal%s: unrecognized file formatrcrc errordodecompressfchown: %sfchmod: %sfchflags: %sfutimes: %soverwrite %s? .-_taztgzzgzZmethod crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) @YOK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out @Yusage: %s [-123456789cdfghLlNnOqrtVv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfhlNnqrtv] [-o filename] [file ...] usage: %s [-fghqr] [file ...] 1.2.3put_header `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@$}$}$}$}$}$}$}$}x$}`$}incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.2.3@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.23 2006/04/25 15:41:07 deraadt Exp $HLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_readuser is %s: %sgroup is %s: %susage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-fh] [-R [-H | -L | -P]] %s file ... [owner][:group]group$OpenBSD: dir.c,v 1.23 2008/06/10 23:10:29 otto Exp $lost+foundwrong type to dirscan %d dirscanDIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILEfileerrorUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTmkentryUNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u linkupmakeentryNO SPACE LEFT IN %s (EXPANDED) EXPANDexpanddir$OpenBSD: inode.c,v 1.31 2008/06/10 23:10:29 otto Exp $DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS ckinodePARTIALLY TRUNCATED INODE I=%u%siblockbad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cache cannot increase directory listcannot find inode %d %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %lld %s I=%u BAD STATE %d TO BLKERR CG %d: BAD MAGIC NUMBER @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.33 2008/06/10 23:10:29 otto Exp $dfpnNyYb:c:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... -%c flag requires a %s ufsffsrwrostarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing The following duplicate blocks remain: %lld, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** checkfilesys$OpenBSD: pass1.c,v 1.27 2008/06/10 23:10:29 otto Exp $phase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlink convert symlink %d(%s) of size %llu bad direct addr: %ld bad indirect addr: %ld LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%ld should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%ucheckinodeBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.$OpenBSD: pass1b.c,v 1.16 2008/06/10 23:10:29 otto Exp $phase 1b, inode %d/%dDUP$OpenBSD: pass2.c,v 1.28 2008/06/10 23:10:29 otto Exp $phase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'pass2.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%d pass2check$OpenBSD: pass3.c,v 1.13 2008/06/10 23:10:29 otto Exp $phase 3, directory %d/%ld$OpenBSD: pass4.c,v 1.18 2008/06/10 23:10:29 otto Exp $phase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d $OpenBSD: pass5.c,v 1.37 2008/06/10 23:10:29 otto Exp $phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ld FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSpass5$OpenBSD: fsutil.c,v 1.16 2007/02/17 15:57:14 grunk Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: setup.c,v 1.40 2008/06/10 23:10:29 otto Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs  @Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED) INCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for stmap cannot alloc %zu bytes for lncntp cannot alloc %u bytes for cginosused cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead setupMAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label $OpenBSD: utilities.c,v 1.35 2008/06/10 23:10:29 otto Exp $bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [Fyn?] cannot allocate buffer pool deadlocked buffer pool WRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY CANNOT %s: BLK %lldProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check catchquit%s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: catchinfo?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsingle_usersh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootsession database close: %ssession database open: %sinsert %d: %sdelete %d: %s %s%s/dev/asprintf%s %scan't parse getty for port %scan't allocate windowcan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,-o %s: option %s a valueneedsdoes not need-o %s: option not supported%s: illegal value '%s'updateasyncrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size is %s: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %sspacetime%s: unknown optimization preference: use `space' or `time'.file system size is %s: %sffsnewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %lld%s: no default sector sizewarning: changing optimization to space because minfree is less than %d%% mainioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk labelusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special %s: initializing cg %ld/%d siginfocallocmmappreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %dblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %dreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %d bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each super-block backups (for fsck -b #) at: cannot allocate I/O buffer %lld, %sfsinit1 failedfsinit2 failedmkfs>inode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0fsinit: inode value %d out of rangerdfs: read error on block %lldwtfs: write error on block %lldisblock bad fs_frag %dclrblock bad fs_frag %dsetblock bad fs_frag %dCOLUMNSilog2: %d is not a power of 2 dfiPRr%s: %s%sfts_read%s: is a directory%s (inode %u): not overwritten due to multiple links%s: mallocrm_overwriteremove %s? override %s%s%s/%s for %s? check"." and ".." may not be removedusage: %s [-dfiPRr] file ... weofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejecttf:TAPE/dev/rst0%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGET76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d) density: %d (%d) %s=%o%s=%xusage: %s [-t] device usage: %s [-f device] command [count] strdupLost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sO%s %d rmtopencloseC statusS I%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pinvalid file mode: %s%s/usage: %s [-p] [-m mode] directory ... $OpenBSD: compile.c,v 1.24 2007/03/20 03:50:39 tedu Exp $unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %scompile_re123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'compile_flagstransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthcompile_trcompile_textunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.12 2007/10/16 20:19:27 sobrado Exp $ae:f:nuusage: sed [-anu] command [file ...] sed [-anu] [-e command] [-f command_file] [file ...] stdout: %sr%s: %s"%s" ..."stdin$OpenBSD: misc.c,v 1.7 2006/10/09 00:23:57 tedu Exp $%ssed: %lu: %s: $OpenBSD: process.c,v 1.13 2006/10/09 00:23:57 tedu Exp $%s %s: %s%lu \%d not defined in the RErstdout: %sflush_appendsCOLUMNS\ \ \abfnrtv%03ofirst RE may not be emptyRE error: %sunable to allocate memoryafree: %p not present in area %pLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %sRnprsu,ne-p: %s-u: %s: %spvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=dprtUx$ʨ$ʠ-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:usage: kill [-s signame | -signum | -signame] { job | pid | pgrp } ... kill -l [exit_status ...] %d %s%s%s: arguments must be jobs or process IDs%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm$X X$P l$@ $8 ,$( $ \$ $ \$ $ $ ,$ $ $ $͸ X$Ͱ $ͨ p$͠ p$͘ bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+alias%s: bad numbernothing to shiftSugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskc_umask%s: %snot foundprsu,-p: %s-u: %s: %sREPLY%s%s is read onlytrap -- %s bad signal %s%s: bad value%s: cannot %s%s: can only %s %d level(s)$$-setfv%s%*ld.%02ld%s%s%*ldm%ld.%02lds%s real real user user sys system :ptime: -%s unknown optiontime: -%s requires an argumentm:invalid file modeusage: mknod [-m mode] name [b | c] major minorusage: mknod [-m mode] name p$Ґ 8$҈ ,$Ҁ $x $h $X $P $H $@ $8 ,$( $ d$ D$ H$ l$ $ D$ $ ,$ $ $ t$ tmknod*=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator$$$$$)(!-a-o1%s: %s%s$Ht$8f$ c$d$s$l$m$n$հpprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)usage: ulimit [-acdfHlmnpSst] [value]ulimit: %c%-20s unlimitedinvalid limit: %sexceeds allowable limitbad limit: %sunlimited %ld COLUMNSLINESx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}[]?*&;#|<>"'`\ K4$ ?4$ UH$ݨ U$ݘ Ux$݈ 4$p 74$X 5X$@ 7$( D@$ D$ ?P$ ?$ U$ A$ Kt$ ?$ 30$ܸ 2$ܨ H$ܘ S$܈ U`$x U$h H|$` H$P H$@ J<$0 <$  D$ 7P$ D$ =$ 7d$ >$ ?$۰ @$ۘ U@$ې ?l$ۀ \$p =`$P > $0 Ah$ S$ K$ K$ G$ T|$ T8$ I$ڸ U$ڨ U$ژ ^p$ڈ ^\$x ^H$h Z$` [X$Xcommentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: x_search_hist nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionCPOSIXsubstituteexpand(NULL)%S%s: bad substitution%s: %sparameter null or not setunable to allocate memory%s: parameter not setfunny $() command: %s%R%s: cannot open $() input.*+?@! HOMEPWDOLDPWD%sPS4%s%scoprocess already exists%s: %s_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundEXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s$($ $REPLY-rreadPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %smissing )zero divisormissing :missing ]history functions not availablee:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %ssubstitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrink%s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX5x$$$argument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumeYou have %s%s%s jobs stopped and runningjobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sj_printremove_job: job not found (%s)no closing quote yylexhere document `%s' unclosed \$PS1PS2\%c%a %b %d%d%T%l:%M:%S%r%RPWDHOME/~/%s%cdoppromptmissing ] MAIL_%s you have mail in $_IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-iHOMEPATHSHELL-xKSH_VERSION-rtypesetksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin-sh/shSH_VERSIONPWD.$ # PS1\$-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV$$$h$$pUSERroot?include: %dshell: %dUse `exit' to leave ksh @(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.1 2005/10/06 06:39:36 otto Exp $node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s: %s0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF$a$p$hc$X$P$@$8e$0$ $i$k$l$X$m$C$n$f$$$b$u$$$p$pr$h$`s$Ph$Hv$@$8$($$$xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacs-usemetaemacscsh-historybgnicebraceexpandallexport%-*s %sonoffCurrent option settings set -o %sgetoptionso:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifier%s: bad numbergmatch*+?@! %s%s-%c: unknown option: %s%s-`%c' requires argumentunlimited%s'\''%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: flags %xshf_read: bsize %dshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: flags %xshf_putchar: no fdshf_write: flags %xshf_write: nbytes %dshf_snprintf: buf %lx, bsize %d0123456789ABCDEF0123456789abcdef(null %s)shf_vfprintftoo many <<'s too many redirections let%s: bad identifier forselect%s: invalid function name $$$$$$ $ $@ $H $ $$$$$$${$}$$x$p$h$`$X$P$H newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifunexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s aliasexportreadonlytypeset||&&!()$$$$$]]<>ERRError handlerEXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s< <<- << >> >| > <> <&>&%s wdscan: unknown char 0x%x (carrying on)/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s5x%` %X%P%H%8%0% % % % %%%%%%%LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript %ld out of rangebad substitution0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzstr_val%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-a:b:C:c:dH:hil:qr:vu:Number of rounds is %s: %ssd/dev/bioCan't open %sCan't locate %s device via %sneed -d or -f parameterneed -c parameterneed -l parametercan't use sd deviceusage: %s [-dhiqv] [-a alarm-function] [-b channel:target[.lun]] [-C flag[,flag,...]] [-c raidlevel] [-H channel:target[.lun]] [-l special[,special,...]] [-r rounds] [-u channel:target[.lun]] device target not specifiedstr2locatorBIOCINQBIOCVOL%-7s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsOnlineOfflineDegradedBuildingRebuildScrubbingInvalid%s %u%14llu%7s %-10s %14s %-7s CRYPTO%s%s %7s %-10s %14s %-7s RAID%u%s%s BIOCDISKFailedHot spareUnused %3u%u:%u.%unoenclunknown serial%7s %-10s %14s %-7s %-6s <%s> %7s %-10s %14s %-7s %-6s '%s' bio_inqinvalid alarm function: %sBIOCALARMalarm is currently %s enableddisabledTarget %s: %sBIOCSETSTATEDisk %s is not in an enclosureDisk %s does not existbio_setblinkBIOCBLINKno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one disksioctlIncorrect passphraseBIOCCREATERAIDbio_createraidinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dinvalid device listcould not stat %stoo many devices on device listduplicate device in listbio_parse_devlistinvalid flags listinvalid flag %sbio_createflagsdelete volume %s failedbio_deleteraidDIOCINQ%s: <%s, %s, %s>, serial %s bio_diskinqInvalid keyInvalid saltToo less rounds: %dPassphrase: unable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedderive_key_pkcshmac_sha1pkcs5_pbkdf2if%s: destination pathname too longmain%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %scannot rename a mount pointcan't remove %sdo_move%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times/bin/cpmv-PRp--%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fi] source target %s [-fi] source ... directory %d|&=<>+-*/%:()syntax error%seval5non-numeric argumentdivision by zero--%d %s _msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: %s [-M core] [-N system] ssethostnamegethostname%s mainusage: %s [-s] [name-of-host] /var/run/utmplogoutRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelreadlabelfsr%s%s%s%c/dev/%s%s%s/etc/fbtabr /dev/%o%s: bad entry: %s(null):%s: %s: %m/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...login_protect0B%lld%c%lld.%1lld%c/var/log/wtmplogwtmp\\#TERMCAP/usr/share/misc/termcapTERMPATHHOME%s/%s.termcap /usr/share/misc/termcaptgetentOOPS?nYacosacosfacos: DOMAIN error asinasinfasin: DOMAIN error atan2atan2fatan2: DOMAIN error hypothypotfcoshcoshfexpexpfy0y0fy0: DOMAIN error y1y1fy1: DOMAIN error ynynfyn: DOMAIN error lgammalgammaflgamma: SING error loglogflog: SING error log: DOMAIN error log10log10flog10: SING error log10: DOMAIN error powpowfpow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sinhsinhfsqrtsqrtfsqrt: DOMAIN error fmodfmodffmod: DOMAIN error remainderremainderfremainder: DOMAIN error acoshacoshfacosh: DOMAIN error atanhatanhfatanh: DOMAIN error atanh: SING error scalbscalbfj0j0f: TLOSS error j1j1fjnjnfgammagammafgamma: SING error G??C00=A@A@Alongjmp botch. inet6_rth_reverseno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error : xxswufsswap ,rwrqrofstabscan/etc/fstabrfstab: : sscanfRSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s rcmd_af0iruserok/etc/hosts.equivr%s/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owneriruserok_sa__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloopudptcp%ugetnameinfoip6_parsenumeric/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh rcmdsh: execvp %s failed: %s %#%#%#%#p%#PNo address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver errorrresvport_af__elf_fdnlistABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%u.%u.%u.%u%u.%u.%u.%uinet_ntop4%xinet_ntop6%s: %s%&P%&H%&@%&8%&0%&(%& %&%&%&%&%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%x%%p%%h%%`%%XUSR2USR1INFOWINCHPROFVTALRMXFSZXCPUIOTTOUTTINCHLDCONTTSTPSTOPURGTERMALRMPIPESYSSEGVBUSKILLFPEEMTABRTTRAPILLQUITINTHUPSignal 0sh-c/bin/sh%'%'%'%'%'%'%'%'p%'`%'X%'H%'8%'0%' noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%xregerror0%doffonsecurelocalrtsctssoftcarmdmbufwindow/etc/ttysr/dev//var/run/dev.dbttyname_r%s: /etc/protocolsr IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbyname/etc/networksr %s: : %s %u/etc/grouprgroup.byname%ugroup.bygid: grscan/dev/tty readpassphrasetcsetattr%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrether_ntohostethers.bynameether_hostton HOMEglob3.g_opendirg_lstatg_stat: master.passwd.bynamepasswd.byname__YP!+__has_yppwmaster.passwd.byuidpasswd.byuid%u__yppwlookup_pwhashbyname/etc/spwd.db/etc/pwd.db%s: %masprintf*netgroupnetgroup.byusernetgroup.byhostnetgroup: Cycle in group `%s'%s.%s(%s,%s,%s) ,/etc/netgroup.db+%s: yp_first: clnt_call0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL[:<:]][:>:]]authunix_create: out of memory authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problem%:%:%:%:%:%:%:x%:h%:H%:@%:0%:%:%9%9%9%9%9%9%9%9x%9`%9H%98%9 %9%8%8%8%8%8%8xUser defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0%:%:%:%:%:%:%:x%:h%:H%:@%:0%:%:%9%9%9%9%9%9%9%9x%9`%9H%98%9 %9%8%8%8%8%8%8xoption requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sPOSIXLY_CORRECT0123456789abcdef0123456789/usr/src/lib/libc/net/inet_net_pton.cinet_net_pton_ipv4n >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d assertion "%s" failed: file "%s", line %d, function "%s" //dev/nullgethostby*.getanswer: asked for "%s", got "%s"-_/gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswerbf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpagethostbyaddr/etc/hostsr %u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.byname...RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownUDFNTFSext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedudfntfsadoscd9660lfsmsdosffs/etc/disktabb0b1sfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx%s.dbtcgetentr:\|:cgetnextSHA1TransformSHA1Pad/bin/shsh-cexeclexecleexeclpPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shexecvpxdr_array: out of memory %s: : %s   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~...realpathvfscanf:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy$1$%s%.*s$md5cryptMD5Padstack overflow in function %s__stack_smash_handlerGMTabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual page../etc/localtime/usr/share/zoneinfo/tzloadmnposixrules,M4.1.0,M10.5.0TZ?SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%Y%.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s asctime3clntudp_create: out of memory clntudp_call%[%\%[%\%]@%]8%]@%]8%]@%]8tcpudpfbfexplore_numericgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswer# _gethtent/etc/hostsrhosts.bynameipnodes.byname%s.%sres_querydomainNres_query%.*s.%.*sres_querydomainHOSTALIASESr__hostalias __res_nameinquery__res_queriesmatch__res_send  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&/etc/resolv.conffLOCALDOMAINrbf;#domain lookupsearchnameserver%usortlistoptionsconfRES_OPTIONSenv_res_initndots:debuginet6insecure1insecure2edns001234567890123456789abcdef0123456789ABCDEFinet_pton6  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%c%c%c%c%cANYHESIODHSCHAOSIN%j%j%j%j%j%j%j%j`%jX%jH%j@%j(%j %j%j%i %i%i %i%i %i%i %i%i %i%ih%i`%iH%i@%i0%i(%i %i%i%h%h%h%h%h%h%h%h%h%h%hx%i%hp%h`%hX%hP%hH%h0%h(%h%g%g%g%g%g%g%g%gx %gp%gP!%gH%g0"%g(%g%g%f%f%f%f%f%f%fxd%fp%fPe%fH%f0f%f(%f#%f%e%c%e"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%d/etc/servicesr ,/invalidtoo smalltoo largesyslog: unknown facility/priority: %xsyslog_r: unknown facility/priority: %x<%d>%h %e %T %s[%ld]Error %d /dev/console vsyslog_r/dev/logconnectlog_r%nh%n`%nX%nP%nH%n@%n8%n0%n(%n %n%n%n%m%m%m%nH%m%m%m%m%m%m%m%m%m%m%mx%mp%mh%m`%mX%mP%mH%m8%m(%m %m%m%l%l%l%l%l%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%e-%b-%Y-+%04d_fmt_conv-0vsnprintfyp_match: clnt_callyp_next: clnt_call/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFD_yp_dobind%s: %s; errno = %s; low version = %u, high version = %u; why = %s(unknown authentication error - %d); s1 = %u, s2 = %u ... %s%r%r%r%r%r%r`%r@%r %r%q%q%q%q%q`%q@%q %qRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s %s: %s - %s %s: %s %tH%t(%t%s%s%s%s%sxFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKclnttcp_create: out of memory bindresvport_saxdrrec_create: out of memory : perrorlibcUnknown error: Unknown signal: NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC_catopen% %%%%%%%x%`%H%0%%~%~%~%~%~%~%~%~X%~H%~8%~ %~%}%}%}%}%}%}%}h%}X%}H%} %}%|%|%|%|%|`%|H%|(%|%{%{%{%{%{p%{X%{8%{(%{%z%z%z%z%z`%zH%z %y%y%y%y%y%yx%y`%yH%y0%y %y%x%x%x%x%x%xh%xH%x0%x%w%w%w%w%w%wh%wX%w@%w%v%v%vNo message of desired typeIdentifier removedOperation canceledValue too large to be stored in data typeWrong medium typeNo medium foundIllegal byte sequenceAttribute not foundIPsec processing failureNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisk quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0%%%%%%%%%%%p%X%H%8%(%%%%%%%%%x%`%H%0%%%%%User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0xdr_bytes: out of memory xdr_string: out of memory snprintf__sbprintfInfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.vfprintf__find_argumentsexponent?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5InfinityNaN0A??҇coCa?Ɗ(`ȳ?DPy?@$@@? ((((( AAAAAABBBBBB %H%H%H%H%H%H%H%h%`%`.isatty%$sniglet^& error: warning: unmapmunmapmalloc cache underflowmalloc free slot lostmalloc cache overflowmalloc cache/etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONSmalloc init mmap failedomalloc_initomalloc_grow munmapinternal struct corruptregions_total not 2^xpp & bitschunk info corruptedchunk overflowmodified (chunk-) pointerchunk is already freenot on queuemprotectrecursive call in malloc():out of memorybogus pointer (double free?)bogus pointerguard size in free(): in realloc():arc4_stir/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/binHASH: Out of overflow pages. Increase page size TMPDIR%s/_hash.XXXXXX/tmpopen_temp"x""4"$"9 "U<"Ul" "*d"/"""""""xF"pm"h"`8"X8"H"@"8"0"(,"  `"9`"="N"N""("(""8"."ì"""" " "x "h ("` |"X "P Z"H f"@ f"8 t"0 x"( " " " U" vX" " " "$OpenBSD: args.c,v 1.17 2006/11/01 05:46:20 ray Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $unblock and -DNO_CONV?@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.15 2007/11/10 13:45:17 chl Exp $$OpenBSD: misc.c,v 1.15 2006/03/22 18:08:04 dhill Exp $$OpenBSD: position.c,v 1.9 2006/11/07 18:47:46 otto Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.18 2007/03/21 13:44:04 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.49 2008/03/16 20:04:35 otto Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.48 2007/11/17 17:18:32 krw Exp $@"""""""""""""""""p""h"h"`"`"X"X "H""8"0@""""""""""@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.6 2005/02/02 19:23:17 jolan Exp $@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. ##.$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $"""$"$""D"""""D"0""x0"p"hl"`"X("Px"H"@"8 "00$OpenBSD: modes.c,v 1.9 2004/09/16 09:55:09 deraadt Exp $$OpenBSD: print.c,v 1.12 2006/06/04 01:35:05 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.12 2008/05/17 23:31:52 sobrado Exp $""""""Ѹ"Ѱ"Ѩ"Ѡ"ј"ѐ"ш"р"x"p"Ґ"҈"x"h"`"X"H"@"8"0""(" """"""ш"p""""""""""""Ҹ"""Ұ""Ҩ""""""Ҡ"Ҙ/tmp/EdDk.aXXXXXXXXXXx`$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: editor.c,v 1.168 2008/06/25 18:31:07 otto Exp $""""x"p"h"`"X"P"H"@"8"0"(" "@"8"(""""""""""""""""8" """"""""""x"p"h"""`""X""""""P"H abcdfiklnoprstuvwxBDEGHLPTUXYZ0#J4@L aD#JL aD#Jn (    aD#Jn `      aD#J(8e<e< #J(pd aD58y.? ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.19 2007/07/17 07:10:22 jmc Exp $### ####zzzzz(zzz$OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.29 2007/05/07 18:39:28 millert Exp $P.5$OpenBSD: print.c,v 1.25 2007/05/07 18:39:28 millert Exp $$OpenBSD: util.c,v 1.13 2007/04/25 08:16:10 sobrado Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)ping.c 8.1 (Berkeley) 6/5/93.Ad#8#(##X#P#H"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)55#Ha5|(#0#b5@|@##B5|#ʨ#xc5|#H#(#d5A|##e5|#ɨ#ɐ#pf5|#X#8F5|##g5|##Ȑ#Xh5|#8#HA|##i5|#Ǹ#Ǡ#xj5|#h#@J5!|# #lHL5|##m5|##ư#Ơn5"|#ƈ#p#Pp5HP50#@q5|###r5"|#Ũ#ŀ#@s5!|#(#S5!|##u5"|0#ĸ#Ę#ĀV5w5"| #X# #x5(D##X5A|$#à#Ày5|#h#@z5| #(#"5#~5!|##°?5#5|,#˜#x.5A|#h#P|( (press RETURN)... (interrupt to abort)## #p382@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ $OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $#՘#`#X#P#@#0A# B#C#D#E#F#G#U#V#a#ָb#ְc#֨e#֠f#֐h#րi#hL#Pl#@n#8q#0q# r#s#v#w#x#u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.20 2008/03/26 06:55:06 otto Exp $#۰#۠@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.16 2007/12/30 13:52:40 sobrado Exp $####(######## # # # # #######x#p#h#`#X#P#H#8#0#(# ## #!#"###$#%#&#'#(#)#*#+#,#-#.#x/#h0#`1#P2#H3#@4#05###h#@#(#####`#@#####p priorityrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATIC BLACKHOLEPROTO3PROTO2PROTO1CLONEDSOURCEMPATHJUMBOUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD LABEL#(#p#h#`#X#P#X#H#@#8#0}m#0#($ 5Ð$ 5$ 5L$ 5$ 5$ 5$ 5|$ 5͔$ 5T$ 5$ 5$ 5$ 5$ 5ф$ 5$ 5$ x5$ p5$ h5͔$ `5($ X5h$ P5p$ H5$ @5L$ 85T$ 05e$ (5 $ 5|$ 5$ 5L$ 5$ 5$ 58$ 5$ 5X$ 5X$ 5h$ 5X$ 5$ 5$ 5L$ 5$ 5$ 5$ 5$ 5$ 5Ѵ$ 5h$ x5L$ p5H$ `5|$ P5$$ H5T$ @5$ 85$ 05x$ (5͔$ 5 $ 5p$ 5$ 5Q|$ 5x$5P$5D$5$5$5$5$5ʜ$5<$5$5\$5ڐ$5 $5$5$$5$x5$p5l$h5$`5eQ$ <NOOP @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.29 2007/05/11 01:53:07 tedu Exp $@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.19 2006/08/11 11:47:39 pedro Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $$)( 0(EHC P E(  0(EHDHC ;Zx0N$OpenBSD: buf.c,v 1.18 2008/02/12 07:57:29 otto Exp $~X$OpenBSD: cbc.c,v 1.15 2008/06/08 13:58:10 tobias Exp $@ $OpenBSD: glbl.c,v 1.11 2007/09/03 14:26:54 deraadt Exp $$OpenBSD: io.c,v 1.12 2007/11/06 10:22:29 chl Exp $$f8$OpenBSD: main.c,v 1.31 2008/04/21 11:22:14 tobias Exp $$f$fH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.9 2007/09/02 15:19:07 deraadt Exp $5X$j$OpenBSD: utils.c,v 1.29 2007/09/22 21:10:49 sobrado Exp $$m$m$m$q8$q0$q($q $q$P ... ...$p$h$`$X$P$H$@$8$0$($ $$$$$ $$$$$$$$$$p$$$$$$$$$$$x$`$`$`$`$`$`$`$X$P$H$`$`$@$`$8$`$`$$`$`$0$($$$$$@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.40 2007/09/03 14:26:54 deraadt Exp $ |$OpenBSD: dkcksum.c,v 1.7 2004/09/28 17:57:46 otto Exp $$OpenBSD: getmntopts.c,v 1.10 2006/09/30 17:48:22 ray Exp $$x$h$`$X$P$@$8$0$($ $$@$@@@%s: can't read disk label; disk type must be specified......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.22 2008/06/10 17:14:16 otto Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.29 2006/06/14 02:14:25 krw Exp $$$$$$$ $ $$$$$x$p$`$X$$p$`@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.21 2008/02/13 14:50:51 millert Exp ${}abcdDgGhHilnNpPqrs tw xy !:#=~~ P$$$$$x$p$h$`$$X$P$$X$@$8$$$$$$$p$X$H$0$ $$$$$$$$$$$$$$$$$$x$p$h$`$X$P$~P _ @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.34 2007/07/27 02:49:38 ray Exp $%8@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $%%%%%%%%%x%p%h%`%X%P%H%h%`%P%@%8%0% %%%%%%%%%%%%`%H%%%%%%%%%%%%%%%%%%%%%%%x%pBKMGTPE@5MS7) >H~%+%+%+%+p%+`%+@%+0%+%+%*%*%*%*%*%*%*` %*P%*8 %*(%* %)%) %)%) %)%)%)x%)`%)P%)(%)%(%(%(xx:xx:xx:xx:xx:xx%3%2%2%2%2%2%2%2x%2%2p%2H%2%2@%20%2%2(%1%2%1%1%2%1%18%2%10%1%2%1%0%2%0%0%2%0%0%2%2%7p%7h%7`%7X%7P%7H%7@%78%70%7(%7%7 %7 %7 %6 %6 %6 %6 %6 %6 %6 %6%6%6%6%6%6%6x%6p%6h%6`%6X%6P%6H%6@%68%60%6(%6 %6%6%6%6%1 %5!%5"%5#%5$%5%%5&%5'%5p(%5X)%5H*%58+%50,%5(-%5-%5.%5.%4/%4/%40%41%42%43%44%45%46%47%48%49%4:%4;%4x<%4h=%4P>%4@?%40@%4[%4\%3\%3]%3^%3^%3_%3_%3`%3x{%3`{%3P|%3@}%3(}%3 ~%3(((0()?%;`%?(%? %?%?%?%?%>%>%>%>%>%>%>%>%>%?%?%?%?%?%?%?%?%?%?x%?(%?p%?h%?`%?X%?P%?H%?@%>%>%?8%?0%@%@%@%@%@%@%@%@%@%@%@%@%?%@%?%@%@%?@%@%@%?%?%BX  ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz%Y80123456789abcdef 555p$P5`p$h 5p$55%_ f8ixi4iTjinmnn$n,no@rrttLtttr|ssttLttur|<yzHz{@{|`}}[ 00000000000000000}%% %P.@r.shstrtab.init.text.fini.rodata.data.eh_frame.pltpad0.pltpad1.gotpad0.ctors.dtors.gotpad1.bss.note.openbsd.ident LL````"xx 0%5]+55E>EGePe We^egu 8l44a  n}of!NI n i & ! K F  _relayd*YYRelay Daemon/var/empty/sbin/nologin2&_afs*QQafs Daemon/var/empty/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 Server/var/empty/sbin/nologin2_ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin3]_ospfd*UUOSPF Daemon/var/empty/sbin/nologin3U_dhcp*MMDHCP programs/var/empty/sbin/nologin3M_identd*identd/var/empty/sbin/nologin3_ppp*RRPPP utilities/var/empty/sbin/nologin1_ppp_mopd*NNMOP Daemon/var/empty/sbin/nologin1_mopd_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 Server/var/empty/sbin/nologin1popa3dLDoj 9 4 S N  _ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin2'_ppp*RRPPP utilities/var/empty/sbin/nologin2_pflogd*JJpflogd privsep/var/empty/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin3V_mopd*NNMOP Daemon/var/empty/sbin/nologin3Nnamed*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam Daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_relayd*YYRelay Daemon/var/empty/sbin/nologin1_relayd_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmsp(fa#A< r j %  = 8 e `   J J_snmpd*[[SNMP Daemon/var/empty/sbin/nologin2(_ntp*SSNTP Daemon/var/empty/sbin/nologin2 _bgpd*KKBGP Daemon/var/empty/sbin/nologin2_spamd*>>Spam Daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin3W_tftpd*OOTFTP Daemon/var/empty/sbin/nologin3Oproxy*GGProxy Services/nonexistent/sbin/nologin3G_ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin1_ypldap_snmpd*[[SNMP Daemon/var/empty/sbin/nologin1_snmpd_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin1_ospf6d_ftp*TTFTP Daemon/var/empty/sbin/nologin1_ftp_ntp*SSNTP Daemon/var/empty/sbin/nologin1_ntp_afs*QQafs Daemon/var/empty/sbin/nologin1_afs_rbootd*PPrbootd Daemon/var/empty/sbin/nologin1_rbootd_tftpd*OOTFTP Daemon/var/empty/sbin/nologin1_tftpd_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X Server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ID y t 5 0 @ ; _rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin2)_ftp*TTFTP Daemon/var/empty/sbin/nologin2!_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/ksh2_ripd*XXRIP Daemon/var/empty/sbin/nologin3X_rbootd*PPrbootd Daemon/var/empty/sbin/nologin3P_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/ksh3_hostapd*VVHostAP Daemon/var/empty/sbin/nologin1_hostapdproxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshd [T vq ~ > 9 c ^  @ @_ypldap*]]YP to LDAP Daemon/var/empty/sbin/nologin2*_ospfd*UUOSPF Daemon/var/empty/sbin/nologin2"_dhcp*MMDHCP programs/var/empty/sbin/nologin2www*CCHTTP Server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_relayd*YYRelay Daemon/var/empty/sbin/nologin3Y_afs*QQafs Daemon/var/empty/sbin/nologin3Q_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_ospfd*UUOSPF Daemon/var/empty/sbin/nologin1_ospfd_pflogd*JJpflogd privsep/var/empty/sbin/nologin1_pflogd_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadmin*vm,%KB K F  [ V  } x 7 2 Y T  c nobody*Unprivileged user/nonexistent/sbin/nologin2+_hostapd*VVHostAP Daemon/var/empty/sbin/nologin2#_mopd*NNMOP Daemon/var/empty/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2_ospf6d*ZZOSPF6 Daemon/var/empty/sbin/nologin3Z_ppp*RRPPP utilities/var/empty/sbin/nologin3R_pflogd*JJpflogd privsep/var/empty/sbin/nologin3Juucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 Server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin1_rtadvd_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin1_dvmrpd_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin1_tcpdump_bgpd*KKBGP Daemon/var/empty/sbin/nologin1_bgpd_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam Daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/ksh1root \Vpk-( Z U   } x 7 2 Q Q_dvmrpd*WWDVMRP Daemon/var/empty/sbin/nologin2$_tftpd*OOTFTP Daemon/var/empty/sbin/nologin2named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2_snmpd*[[SNMP Daemon/var/empty/sbin/nologin3[_ntp*SSNTP Daemon/var/empty/sbin/nologin3S_bgpd*KKBGP Daemon/var/empty/sbin/nologin3Kwww*CCHTTP Server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X Server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP Server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucplf% >9 M H ] X  _ripd*XXRIP Daemon/var/empty/sbin/nologin2%_rbootd*PPrbootd Daemon/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X Server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_rtadvd*\\IPv6 Router Advertisement Daemon/var/empty/sbin/nologin3\_ftp*TTFTP Daemon/var/empty/sbin/nologin3T_tcpdump*LLtcpdump privsep/var/empty/sbin/nologin3L_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_ripd*XXRIP Daemon/var/empty/sbin/nologin1_ripd_dhcp*MMDHCP programs/var/empty/sbin/nologin1_dhcp_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd#!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet $old_ip_address delete $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address delete > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet $alias_ip_address alias netmask \ $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -dan } add_new_routes() { route delete default >/dev/null 2>&1 for router in $new_routers; do if [ "$new_ip_address" = "$router" ]; then route add default -iface $router >/dev/null 2>&1 else route add default $router >/dev/null 2>&1 fi break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi if [ -f /etc/resolv.conf ]; then cat /etc/resolv.conf > /etc/resolv.conf.save fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } case $reason in MEDIUM) ifconfig $interface $medium sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || [ "$reason" = REBOOT ] || [ -z "$old_ip_address" ] || [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias if [ -f /etc/resolv.conf.save ]; then cat /etc/resolv.conf.save > /etc/resolv.conf fi ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet $new_ip_address delete $medium delete_old_routes exit 1 ;; esac exit 0 . ..MAKEDEVconsole tty memkmemlenulllezerolestdinestdoutstderrksymsdrumklogeepromhopenprombpf0rom biofd0aromfd0bromfd0cromfd0iromrfd0aomrfd0bomrfd0comrfd0iomsd0aomrsd0aomsd0bomrsd0bomsd0comrsd0comsd0domrsd0domsd0e hrsd0ehsd0fhrsd0fhsd0ghrsd0ghsd0hhrsd0hhsd0ihrsd0ihsd0jhrsd0jhsd0khrsd0khsd0lhrsd0lhsd0mhrsd0mhsd0nhrsd0nhsd0ohrsd0ohsd0phrsd0phsd1ahrsd1ahsd1bhrsd1bhsd1chrsd1chsd1dhrsd1dhsd1ehrsd1ehsd1fhrsd1fhsd1ghrsd1ghsd1hhrsd1hhsd1ihrsd1ihsd1jhrsd1jhsd1khrsd1khsd1lhrsd1lhsd1mhrsd1mhsd1nhrsd1nhsd1ohrsd1ohsd1phrsd1phsd2ahrsd2ahsd2bhrsd2bhsd2crsd2csd2drsd2dsd2ersd2esd2frsd2fsd2grsd2gsd2hrsd2hsd2irsd2isd2jrsd2jsd2krsd2ksd2lFrsd2lGsd2mHrsd2mIsd2nJrsd2nKsd2oLrsd2oMsd2pNrsd2pOrd0aPrrd0aQrd0cRrrd0cScd0aTrcd0aUcd0cVrcd0c#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]=";chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]=";chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]=";chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]=";chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 bio R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M drum c 7 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 640 kmem ;; xfs*) M xfs$U c 51 $U 600 ;; uk*) M uk$U c 120 $U 640 operator ;; tun*) M tun$U c 111 $U 600 ;; systrace) M systrace c 50 0 644 ;; ss*) M ss$U c 121 $(($U*16)) 640 operator M nss$U c 121 $(($(($U*16))+1)) 640 operator M enss$U c 121 $(($(($U*16))+3)) 640 operator RMlist[${#RMlist[*]}]="scan$U" MKlist[${#MKlist[*]}]=";umask 77;ln -s ss$U scan$U" ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; pf*) M pf c 59 0 600 ;; openprom) M openprom c 70 0 ;; lkm) M lkm c 112 0 640 _lkm ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; bpf*) M bpf$U c 105 $U 600 ;; bio) M bio c 124 0 600 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 30 0 644 M apmctl c 30 8 644 ;; wsmouse*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd*) M wskbd$U c 79 $U 600 ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 78 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyIcfg ttyI0 ttyI1 ttyI2 ttyI3 ttyI4 ttyI5 R ttyI6 ttyI7 ttyI8 ttyI9 ttyIa ttyIb ttyHcfg ttyH0 ttyH1 R ttyH2 ttyH3 ttyH4 ttyH5 ttyH6 ttyH7 ttyH8 ttyH9 ttyHa ttyHb R ttyGcfg ttyG0 ttyG1 ttyG2 ttyG3 ttyG4 ttyG5 ttyG6 ttyG7 R ttyG8 ttyG9 ttyGa ttyGb ttyFcfg ttyF0 ttyF1 ttyF2 ttyF3 R ttyF4 ttyF5 ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb ttyEcfg R ttyE0 ttyE1 ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 ttyE8 ttyE9 R ttyEa ttyEb ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 ttyD4 ttyD5 R ttyD6 ttyD7 ttyD8 ttyD9 ttyDa ttyDb ttyCcfg ttyC0 ttyC1 R ttyC2 ttyC3 ttyC4 ttyC5 ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; bpp*) M bpp$U c 104 $U 600 ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 125 0 666 ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 36 $o 660 dialer uucp M cua$U c 36 $(($o+128)) 660 dialer uucp ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; ch*) M ch$U c 19 $U 660 operator ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 2048 ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M ${nam}i b $blk $(($n+8)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator M r${nam}i c $chr $(($n+8)) 640 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R presto0 bpp0 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 R sd1 sd2 sd3 sd4 cd0 cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 R tun3 bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R fd1 fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B fd0C fd0D R fd0E fd0F fd0G fd0H xfs0 ss0 ss1 ch0 bio cuaa cuab cuac cuad R ttya ttyb ttyc ttyd ptm local wscons audio0 uk0 random lkm R tty00 tty01 tty02 tty03 apm pf systrace xd0 xd1 xd2 xd3 R raid0 raid1 raid2 raid3 std st0 st1 fd ;; presto*|xd*|xy*|sd*|raid*|ccd*) case $i in presto*) dodisk presto $U 26 25 $U 0;; xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo ... . .. boot8bootxx8binstall@ installboot . .. installboot . ..miscxkeymaps . ..termcap ... -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi Elite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163:  (Hu_ < @Hu))3(@ Hu_(@@<@T UH@(@?H((AHv ?Hv ?Hv ?yAHH~r8H~r8 EәAHv oHz,(Hz,( }>AHv oHv PHv P WAHv PH~"H~" W AHv PHv PHv P P4h!H|6DQH|6DQH}qZUaH|6DQH|6DQH}qg`>!H|6DQH|6DQH}xaH|6H|6H}B!H|6H|6H}lBaH|6H|6H}ny!H|6H|6H}aH|6H|6H} !H|6H|6H}L83aH|6H|6H}M !H|6H|6H}e aH|7uH|7uH}a!H|7uH|7uH}!taH|7uH|7uH}l !H|7uH|7uH}aH|7uH|7uH}h_!H|7uH|7uH}a\aH|7uH|7uH}2!H|7uH|7uH}_*aH|7uH|7uH}-!H|8H|8H}%aH|8H|8H}.!H|8H|8H}uaH|8H|8H}t!H|8H|8H}aH|8H|8H}=3+!H|8H|8H}haH|8H|8H}(58!H|8hH|8hH}X6aH|8hH|8hH}J!H|8hH|8hH},aH|8hH|8hH}!H|8hH|8hH}㌧aH|8hH|8hH} Y!H|8hH|8hH}QaH|8hH|8hH} #[!H|8hH|8hH} aH|9?MH|9?MH}! !H|9?MH|9?MH}!w1QaH|9?MH|9?MH}"<!H|9?MH|9?MH}"aH|9?MH|9?MH}#^!H|9?MH|9?MH}#{CaH|9?MH|9?MH}$XĪ#!H|9?MH|9?MH}$caH|98H|98H}%E!H|98H|98H}% XaH|98H|98H}&8;!H|98H|98H}&p aH|98H|98H}'L6!H|98H|98H}'h%OaH|98H|98H}(}!H|98H|98H}(]yWaH|:p~H|:p~H})!H|:p~H|:p~H})npaH|:p~H|:p~H}*v!H|:p~H|:p~H}*]DBaH|:p~H|:p~H}+zfBj . install.md set_term() { local _tables TERM=${TERM:-${MDTERM:-vt220}} ask "Terminal type?" $TERM export TERM=$resp [[ -x /sbin/kbd ]] || return _tables=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "kbd(8) mapping? ('L' for list)" "none" case $resp in [Ll?]) echo "Major tables: $_tables" ;; none) return ;; *) kbd $resp && { echo $resp >/tmp/kbdtype ; return ; } ;; esac done } welcome() { local _q cat <<__EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD. At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C, but exiting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat <<__EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat <<__EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT _q="Proceed with upgrade?" ;; install) cat <<__EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat <<__EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT _q="Skip disk initialization?" else _q="Proceed with install?" fi ;; esac ask_yn "$_q" if [[ $resp == n ]]; then cat <<__EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit fi echo "Cool! Let's get to it." } stripcom () { local _l [[ -f $1 ]] || return while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 } scan_dmesg() { bsort $(sed -ne "$1" /var/run/dmesg.boot) } scan_disknames() { local _n _oifs=$IFS IFS="," bsort $(for _n in $(disknames); do echo "$_n "; done | sed -ne "$1") IFS=$_oifs } get_ifdevs() { ifconfig \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | grep '^ [a-p]: ' \ | egrep -v "swap|unused" >$_file _parts=$(sed -e 's/^ \(.\): .*/\1/' $_file) set -- $_parts [[ $# == 0 ]] && { echo "No filesystems found on $_dev" ; return 1 ; } if isin "c" $_parts; then resp=c elif [[ $# == 1 ]]; then resp=$1 else cat /tmp/parts.$_dev ask_which "$_dev partition" "has the $MODE sets" "$_parts" [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } stdsize () { local _p= _s= _sz=$1 set -- " " K M G T P E Z Y while (( ${#_sz} > 3 )); do shift _p=${_sz%[0-9][0-9][0-9]} _s=${_sz#$_p} _s=${_s##+(0)} _sz=$_p done (( _s > 500 )) && : $(( _sz = _sz + 1 )) echo "$(( _sz * 512 )) ${1}Bytes" } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while :; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until() { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_yn() { local _q=$1 _a=${2:-no} _resp typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y ; return ;; n|no) resp=n ; return ;; esac done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _err=$5 set -- $_list if (( $# < 1 )); then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_def:=$1} _list="$*" while :; do ask "Available ${_name}s are: $_list.\nWhich one $_query? (or 'done')" "$_def" isin "$resp" $_list done && break echo "'$resp' is not a valid choice." done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } save_comments() { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file >/tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >>/tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file() { local _file=$1 ask_yn "Edit $_file with $EDITOR?" [[ $resp == y ]] && $EDITOR /tmp/$_file } manual_net_cfg() { ask_yn "Do you want to do any manual network configuration?" [[ $resp == y ]] && { echo "Type 'exit' to return to $MODE." ; sh ; } } ftp_list_files() { ftp $FTPOPTS -n "$1" <<__EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 if [[ ! -r /dev/MAKEDEV ]] ; then echo "MAKEDEV not found. Can't create device nodes." return 1 fi cd /dev ; sh MAKEDEV $_dev || return 1 ; cd - >/dev/null } addhostent() { local _addr=$1 _name=$2 _delim="." [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].* $_name\$/d" /tmp/hosts >/tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do _action= _next= echo for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "Set name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_ifs() { local _IFDEVS=$IFDEVS _ifs _name _media _hn while :; do ask_which "interface" "do you wish to initialize" "$_IFDEVS" \ "" "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat <<__EOT The media options for $_ifs are currently $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask_yn "Do you want to change the media options?" case $resp in y) cat <<__EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media || return 1 ;; n) _media= ;; esac fi rm -f $_hn v4_config "$_ifs" "$_media" "$_name" "$_hn" v6_config "$_ifs" "$_media" "$_name" "$_hn" [[ -f $_hn ]] && chmod 600 $_hn && _IFDEVS=$(rmel "$_ifs" $_IFDEVS) done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } v4_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _prompt _addr _mask if ifconfig $_ifs | grep 'groups:.* dhcp' >/dev/null 2>&1; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$3 ifconfig $_ifs inet $_addr delete fi fi [[ -x /sbin/dhclient ]] && { _prompt=" or 'dhcp'" ; : ${_addr:=dhcp} ; } _prompt="IPv4 address for $_ifs? (or 'none'$_prompt)" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs ; then addhostent "127.0.0.1" "$_name" echo "dhcp NONE NONE NONE $_media" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up ; then addhostent "$_addr" "$_name" echo "inet $_addr $resp NONE $_media" >$_hn fi ;; esac } v6_config() { local _ifs=$1 _media=$2 _name=$3 _hn=$4 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol." ; return ; } ifconfig $_ifs up rtsol -F $_ifs addhostent "::1" "$_name" echo "up\nrtsol $media" >>$_hn return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp $media" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs [[ $resp == none ]] && return route -n add -inet6 -host default "$resp" || return echo "$resp" >>/tmp/mygate } v4_defroute() { local _dr _prompt=" or 'none'" [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate ; break ; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _routers _oifs if [[ -z $(route -n show -inet6 | sed -ne '/^default */{s///; s/ .*//; p;}') ]]; then resp=none return fi if [[ -x /sbin/ping6 ]]; then _routers=$(ping6 -n -c 2 ff02::2%$_if 2>&1 | sed -n \ -e '/bytes from/{s/^.*from //;s/,.*$//;p;}') fi _oifs=$IFS IFS= PS3="IPv6 default router? (list #, IPv6 address or 'none'): " select i in $_routers; do case $i in "") resp=$REPLY [[ -n $resp ]] && break ;; *) resp=$i break ;; esac done IFS=$_oifs } enable_network() { local _netfile _gw for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done ifconfig lo0 inet 127.0.0.1 for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} ifconfig $if >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" cmd="$cmd; dhclient $if" ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -qn add -host $name 127.0.0.1" ;; inet6) [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -host `hostname` 127.0.0.1 >/dev/null route -qn add -net 127 127.0.0.1 -reject >/dev/null echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files() { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && \ _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat <<__EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi resp=y isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" [[ $resp = n ]] && return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask_yn "Ready to $MODE sets?" yes [[ $resp = n ]] && return for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $FTPOPTS -o - -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $FTPOPTS -o "/mnt/$_f" -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } set_ftp_opt() { local _q=$1 _opt=$2 ask_yn "Use $_q?" $(isin $_opt $FTPOPTS && echo "yes") case $resp in y) FTPOPTS=$(addel $_opt $FTPOPTS) ;; n) FTPOPTS=$(rmel $_opt $FTPOPTS) ;; esac } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _passwd ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask_yn "Display the list of known $_url_type servers?" if [[ $resp == y ]]; then echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $FTPOPTS -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi fi : ${_prompt:="Server? (IP address, hostname or 'done')"} while :; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then set_ftp_opt "active mode ftp" "-A" fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/\$_${_url_type}_server_dir ifconfig lo0 127.0.0.1 if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp $FTPOPTS -o - "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp ; break ; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls -l $_dir)" } install_cdrom() { get_drive "CD-ROM" "$CDDEVS" || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" "$DKDEVS" || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" "$MTDEVS" || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue (($resp < 0)) && continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf ; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while :; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" case $resp in "") ;; ?) ls -F $_zonepath ;; *) _zonepath=$_zonepath/$resp ;; esac done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _s _m for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue ask_yn "'$_s' was not installed.\nAre you *SURE* your $MODE is complete without '$_s'?" [[ $resp == n ]] && _m="$_m $_s" done [[ -n $_m ]] && return 1 return 0 } install_sets() { local _d=disk _locs="disk ftp http" [[ -n $CDDEVS ]] && { _locs="cd $_locs" ; _d=cd ; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" echo "\nLet's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -z $DEFAULTSETS ]] && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return ;; c*|C*) isin "cd" $_locs && install_cdrom ;; d*|D*) install_disk ;; f*|F*) isin "ftp" $_locs && install_url ftp ;; h*|H*) isin "http" $_locs && install_url http ;; n*|N*) isin "nfs" $_locs && install_nfs ;; t*|T*) isin "tape" $_locs && install_tape ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat <<__EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the $MODE. __EOT exit fi done /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done ask_yn "Use the nameserver now?" yes [[ $resp == y ]] && cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi [[ -n $(ifconfig -a | sed -ne '/[ ]inet .* broadcast /p') ]] && v4_defroute edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } questions() { local _d ask_yn "Start sshd(8) by default?" yes if [[ $resp == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi ask_yn "Start ntpd(8) by default?" no if [[ $resp == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local ask "NTP server? (hostname or 'default')" default if [[ $resp != default ]]; then set -- $resp sed -e "s/^servers /#&/;/#server /a\\ server $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf fi fi if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" if [[ $resp == y ]]; then sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi fi [[ -n $CDEV ]] || return _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" [[ $resp == n ]] && return ask_which "speed" "should $_d use" "9600 19200 38400 57600 115200" \ $CSPEED [[ $resp == done ]] && return sed -e "/^$CTTY/s/std.9600/std.${resp}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /mnt/etc/ttys >/tmp/ttys [[ -n $CPROM ]] && \ echo "stty $CPROM $resp\nset tty $CPROM" >>/mnt/etc/boot.conf } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi echo -n "Making all device nodes..." cd /mnt/dev sh MAKEDEV all for _dev in $DKDEVS $CDDEVS $MTDEVS; do sh MAKEDEV $_dev done echo "done." cd / md_installboot $ROOTDISK populateusrlocal [ -x /mnt/$MODE.site ] && /mnt/usr/sbin/chroot /mnt /$MODE.site cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter halt at the command prompt. Once the system has halted, reset the machine and boot from the disk. __EOT md_congrats } ROOTDISK= ROOTDEV= VERSION=44 VNAME="$(( $VERSION / 10 )).$(( $VERSION % 10 ))" SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" FTPOPTS="-V" OBSD="OpenBSD/$ARCH $VNAME" SERVERLIST=/tmp/serverlist for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -ne '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot DKDEVS=$(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") CDDEVS=$(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") IFDEVS=$(get_ifdevs) CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed) md_consoleinfo THESETS="bsd bsd.rd bsd.mp $MDSETS" DEFAULTSETS="bsd bsd.rd" for _set in base etc misc comp man game xbase xetc xshare xfont xserv site ; do [[ $MODE == upgrade && ( $_set == etc || $_set == xetc ) ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xetc xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done SANESETS="bsd base${VERSION}.tgz etc${VERSION}.tgz" : ${EDITOR:=ed} [[ -x /usr/bin/vi ]] && EDITOR=vi export EDITOR [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat <<__EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b dumb|80-column dumb tty:\ :am:\ :co#80:\ :bl=^G:cr=^M:do=^J:sf=^J: vt100|vt100-am|dec vt100 (w/advanced video):\ :am:bs:ms:xn:xo:\ :co#80:it#8:li#24:vt#3:\ :@8=\EOM:DO=\E[%dB:K1=\EOq:K2=\EOr:K3=\EOs:K4=\EOp:K5=\EOn:\ :LE=\E[%dD:RA=\E[?7l:RI=\E[%dC:SA=\E[?7h:UP=\E[%dA:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=^O:as=^N:bl=^G:cb=\E[1K:cd=\E[J:ce=\E[K:cl=\E[H\E[J:\ :cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:ct=\E[3g:do=^J:\ :eA=\E(B\E)0:ho=\E[H:k0=\EOy:k1=\EOP:k2=\EOQ:k3=\EOR:\ :k4=\EOS:k5=\EOt:k6=\EOu:k7=\EOv:k8=\EOl:k9=\EOw:k;=\EOx:\ :kb=^H:kd=\EOB:ke=\E[?1l\E>:kl=\EOD:kr=\EOC:ks=\E[?1h\E=:\ :ku=\EOA:le=^H:mb=\E[5m:md=\E[1m:me=\E[m\017:mr=\E[7m:\ :nd=\E[C:rc=\E8:rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t\016%e\017%;:\ :sc=\E7:se=\E[m:sf=^J:so=\E[7m:sr=\EM:st=\EH:ta=^I:ue=\E[m:\ :up=\E[A:us=\E[4m: vt220|vt200|DEC VT220 in vt100 emulation mode:\ :am:bs:mi:pt:xn:xo:\ :co#80:li#24:vt#3:\ :@7=\E[4~:RA=\E[?7l:SA=\E[?7h:\ :ac=``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~:\ :ae=\E(B:al=\E[L:as=\E(0:bl=^G:cd=\E[J:ce=\E[K:\ :cl=\E[H\E[2J:cm=\E[%i%d;%dH:cr=^M:cs=\E[%i%d;%dr:\ :dc=\E[P:dl=\E[M:do=\E[B:ei=\E[4l:ho=\E[H:\ :if=/usr/share/tabset/vt100:im=\E[4h:\ :is=\E[1;24r\E[24;1H:k1=\EOP:k2=\EOQ:k3=\EOR:k4=\EOS:\ :k5=\E[17~:k6=\E[18~:k7=\E[19~:k8=\E[20~:k9=\E[21~:\ :k;=\E[29~:kD=\E[3~:kI=\E[2~:kN=\E[6~:kP=\E[5~:kb=\177:\ :kd=\E[B:kh=\E[1~:kl=\E[D:kr=\E[C:ku=\E[A:le=^H:mb=\E[5m:\ :md=\E[1m:me=\E[m:mr=\E[7m:nd=\E[C:nl=^J:rc=\E8:\ :rf=/usr/share/tabset/vt100:\ :rs=\E>\E[?3l\E[?4l\E[?5l\E[?7h\E[?8h:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t\E(0%e\E(B%;:\ :sc=\E7:se=\E[27m:sf=20\ED:so=\E[7m:sr=14\EM:ta=^I:\ :ue=\E[24m:up=\E[A:us=\E[4m:ve=\E[?25h:vi=\E[?25l: sun|sun1|sun2|Sun Microsystems Inc. workstation console:\ :am:km:ms:\ :co#80:li#34:\ :%7=\E[194z:&5=\E[193z:&8=\E[195z:@7=\E[220z:AL=\E[%dL:\ :DC=\E[%dP:DL=\E[%dM:F1=\E[234z:F2=\E[235z:IC=\E[%d@:\ :K2=\E[218z:al=\E[L:bl=^G:cd=\E[J:ce=\E[K:cl=^L:\ :cm=\E[%i%d;%dH:cr=^M:dc=\E[P:dl=\E[M:do=^J:ei=:ic=\E[@:im=:\ :k1=\E[224z:k2=\E[225z:k3=\E[226z:k4=\E[227z:k5=\E[228z:\ :k6=\E[229z:k7=\E[230z:k8=\E[231z:k9=\E[232z:k;=\E[233z:\ :kD=\177:kN=\E[222z:kP=\E[216z:kb=^H:kd=\E[B:kh=\E[214z:\ :kl=\E[D:kr=\E[C:ku=\E[A:le=^H:me=\E[m:mr=\E[7m:nd=\E[C:\ :rs=\E[s:\ :..sa=\E[0%?%p6%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;m:\ :se=\E[m:sf=^J:so=\E[7m:ta=^I:u8=\E[1t:u9=\E[11t:up=\E[A: h 8`@#`0"" $@``T@-#0b@ɒ"@H*/+-/"b<  0  " h-" t *-" l!`-" p@-h? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1?(@"1?㿘 #@(1(@x#1㿘@ " ܒ㿘 @+㿘-#` @e- "`/ #d@ # $#㿘-c ? "c-@c`Ё㿐%-@Ѐ?40 '@(@%#@ Ѐ 2'/(0a@#8(10#-cP @ b 2/ @'(b@#X '@b / /#d 2 /!㿘/` 2/-"#"`"`"`"` "`"`" @`  "cd? / d ?/ 㿘  ; < 㿘 - @1@<   @1"&  ?  㿘- h`/@|/b<  $  /- c0"8/""DJJ`  -2*@/"D@ (*`J@ @ *`  -c@/""8J  *@J` )*@b< /`""D``*J@ -& @// *:  c` d a "@J@ s "@J@  "@$"@#bL @ #"@J@  @㿘@ - h`  @Wc $` $`%//"< `( $ /b8€  "`b$` $`$@ (8@#028@ǐ $`&` 2!//-` @!X} (8@Ӑ#0!X-`x @-` @ - "` h-` Ԑ $$ 㿘#/b<`   ``*  `b<   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @+ /"< `( ( @0@ 㿘   2  @ $ ?.`$ *㿘/"<` `0`4 㿘/"<` `?`8 ? 㿘  ,`(@#?@ `?㿘 ,m`€s㿐/< ` "<    "<O!- h#?  `$ *<`P h`/`$*O O /O㿘㿐/"< `      O ? X/O O /O㿐/" 29?-a/?"a6 \"&#`a#@b#\ @    / H"cd''@( ?@I ?#'@ ? ?㿘`&"@  &@  㿘 &   ? @&@ ~.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( )#(@     2` * @h *`  * +` **` +   h  (@ g@ k@ `-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ .``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ &  㷐^  [ @4 U  @P2 *@    @ ,`  ( 6h" 1  '"@@''   b 4  @   " 'w@ T@B< 22&     ":?"   ? @ : ` :?  $"`"`"` :`8   㿘N  ,  ". /.".+."&  "!".. 0  ? 0 @͠L} *L0w 0t 0pؒ  @ ( 8 'p@ t    $ #`a#\b` @  ? / H "cd؀`/@   "#d?㽠P  x@   'P $` $` $`  $$` ($` ,$`$` 8 @ st$`     h #`ab`$#\ @ ? /#d x 0  &,& &&& D& &(&$@ A㺈 ` ($ a b????#\#`  @ ? /#d `  dh@ d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H/"#d?@T@۔0 )#0@ / H"cd?㿘@ -/ "cd!/"!6 &x 2?/ch"ch0 "!"0" ?㷈/#h#h` )@ ͐#X N  m `/2N N /" N a  0 ] @N x  <$N O  N  /  .ؔ A.0 0h" 2;h $+  (@I;@EO`/ h@5 x@1 x  @* x N  h&`  @ x@ x㿘  "& @  x&  㿘' #/!/%)@    ? cd2  "L @ x  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  -0Ȅ( 4 "`8"` <"`@"`D :`8 㿐\@?<6   '?'?@ ?0` '?` '?`@"`"?'?Đ #`#` #`#`#\ #``$ !\@? /` @``2)"@#/ H"cd?㿘!/$#d@O 0 `@ 2?`2 ?`)` $#d#@n ??"@?20d/( 2  2 2 *?0 d # d d/("# d" " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !/#d@j?)@#ؐ H$#d8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8U8UH8UT8U`8Ul8Ux8U㿘`_1#*` €1)0#1*- 1** 1*' 01*$ @1*! X1* h1* 1* 1* 1* 1* 1* !1* !(1.* @@ @ ..@**@"㿘#..!."a$a"P'P'T'X@W$!a! *`2*&; *@*!XJ?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 ``4 `4 #\ @ .@U *@!p? 02` `2  ` @ 0- ? @ -??"b $`㿘- @k 5㿐@/!"#d  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` -"    0`'"'ܐ@Kܖ@ژ( @?*!@:x@ް yހ( (  s?@n?2l?2` 2g? 2c?2``<`]@l 2Y? &U?``  2M?` &@ǐ  4 & ` 2>?` "6`` %*@!0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\0   )/ <+*`%#d(?@ @a@,`4 2 #d   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘.!!,@  .   0,@& "  0,@  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` +` ??㿘菒  @,   -b@%  "` ?` ?7.-( :  0 *@ `  *@`*@`.*!(" @ ` ?  2  㿘.a@'H'L'P'T 'X @"a@@H*@"k㿘*"㿘0"  , @` @ , 㿘S@n㿘@ 㿘 D " ? 2  H1/ L&#d@e  $ #d `$ D?$ @ L$ ?$  @`$㿘אԐ* А* ̐?. ?$`@㿘-"  , @     & &"   & T`?& & S`?   2?  ?B& @     `* ??w?2? o  e  "  D Z   D  ?& @㿘@h?7`5@ X.!D. `%"   >`P>@>`>`>`>` >`(>`0>`8>`@>`H*?@ @ `@ &`L&@Z&`H0 @ ΐ`@ X@ɐ?㿘 / "cd?0" . @ .. !D @  L@@ X@㿘.!D.   @?? ?2%  ?% @%   T "<   8 @a    "@"% %% %  "  @* 4 /#d`% D " %   &   B @ B = = % DW  D  L!/$#d@ % #d % D L%@ '% @  P@ " % P  P ?% @ @   @  = =   @  % P @ 2   D 2   2x T  P@ "  % P&㾘 / 0" - @.@8!D-  `T @?2*$`(&$`" ` /o l/k @ F`2.``)  @ ?V @`L  <`P<@<`<`<`<` <`(<`0<`8<`@<`H*?@Ԗ @$@$`L$`H`4 `5`@1`@ f )`' a !ɒ: @/  ad 4 `0 a"cd??-⠔⠖ ? * `:```? -b "b"    -⠐?"  ⠀@ @   @ *0   @ *`㿘0. " @  @  / $"cd2  " @      @ $/"#d`/ "#d?㿘0. " @ @  / "  /  a :@B: a"cd? ?   ` 㿐0"  @  `  ` / D"cd$@$`$` 'v 8/@`` / "`J -`)$@&$`  ̨@  /!X € ` ` ̦ `" ` @/"#d$@?㿐0. " @@  / ,"cd" @% * 2`      / "cd B< ' / "cd&?8t@8u8uL8v8v8v8v8v8v8v8t88v8v8u8u8v8v8u8v8u8v8v8u㿘'H'L'P'T'X!X@ H㿘!X@ N@`N@`%` N@``#(*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @N N@ @E N@ @< N@ 0 x   ?*"0(  @ 0,  ?L?hN@@ `N@ % X lT㿈*"몒 @,C  ?L?㿘-"` .!T* b0J@ #!T儐  (-# @ -"@  'h@@B`@ `   *$ "8ƒ  .א 7Ɛ(  , 4 , 4  ~4   44  4  4  4 h`4 j4 h!$$@#\ .? hl'l*"` ` `4`  4`  $ 4`㿘-2(㿐H/-"#d(2*?@ 2&?`(2"?`&2?`  @??-# -*@ *`@ `V  ??㿘@ /`(+`&'` # `:   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`8888888888888(88p88H8p888 880888888h8 ?$2"0    888 0 "L"""" " "(","0"8"<"l"P "? $  `4? <   ?(  8 * " <" 8 㿘 N 12:?@ 5?2 (1? $  0$ ($ 0 , 2 ( P$ , (  0 0 `?$ $"` >` "` 8 ,"`$"`4?€ 0$ $㿘 *,xbx  " X" L" T" P㿘 $ 4 2 ( $ *@ (  0 $ 4>  ( 2   $ * $ ($ 0$ ,  (&@@    4)"@  ($ 0%$ , 0" @8 4  "@@   4"@ ($ 0$ , 0 ( $ 0$ 0 , (@@$ , 㿈 ɺ $ Ŧ  "? 2  2? 2  $   8< `"ܓ*` € ` $"&  @?*``` * 4 e  y,  u,4 $  m * $  @! $& 8  $ ¢ "k&  @?*``` ?c4 4 *` , $& 8   $   & & & &$<$8  @ $& 8 $`";&   `$@4 $"0&  @?*``` $4      ,4 $  $ $# &  $4[ `$@` 4 "&  @?*```?c4  ,$@   $@ Ā88 ܒ @%"@$@@%'@"&  @?*```  a$`4  $d4  $\4a򀢠 $$hh\@," p"&  @?*``` h *@*`3 $h4\ hp0lT,"(*`0  $h $T$L$l @   ,c# ,# &  $ $$h`dh :pT * ?L * @@7`񀢀7  "N&  @?*``T*?L * @@7`񀢀7  @   ".&  @?*`@ ` $@4h*`3`i$h !  @   "&  @?*`@ ` $@4h` *   45 @   "&  @?*`@ ` $@4  4h @   "&  @?*`@ ` $@4  4h`d Q?? ph?*`2`?$h`dh *QT "0 $L$T$ll` pT@ ,` l*``p$P$Xd  @X y, $T * ?L * @@7`񀢀7  "t&  @?*``T*?L * @@7`񀢀7 - + 7*@* 7 2` "H&  @?*`` 2 L* @@7`7$@4$@4$@   z$ @ u$2,  $H$H @   "&  @?*`@ ` * @? @$@4 $@  $X * ?P * @@7`񀢀7  "&  @?*``X*?P * @@7`񀢀7 ` , 7*@* 7 2` "&  @?*`` 2 P* @@7`7$@4$@`@4 $D `$H$H @   "&  @?*`@ ` * D? @$D4 $@ ,D"@i $u&D"0 4($ ""@@ @&@8"$@% @?.@``@ 2 $H  C.@$` 6`8  ":&  @?*``` &@B > $@Β&@$& 8?c4 4 *` , ,# &  b$   $ ?M?& & && $8$<(   8   ђ  $3?  '  B& @B > >   $ @z"@$& 8 <@ " & 4`"?㿘 ? $` ,2`40 `" ,€ 0 ,  0€ $$ $㿘 ";? $ "7?  ` .?`   @. @+  ?[   $? ( @ 4"@  ( $ , 4 "$ , $   " ? $ " ? "?" "`0  @  @0#   ( @#@㿐 P?`$ 2`0J 2 < D?   h <  8 " * % <%% 8  ;*  8  <2`?% 8 % <  % h@```@ @B  " %`%@=` h?` `3  =`=`  % "? $ 2 ?   <`?㿘 `"h?`$ "d?`("`?`, 2`0Z? 0  2 4Q?   $ * `( `0 2 @`0`,€?0=@' >`> `> `0> ` > `(> (`0> 0`8> 8 L%0@ ,@zА" ?%0@$`L PzВ"@ e0@ $`P l:А" ?%0@$`l $ * 4$`4& $ 㿘?4`c @@c@@ ? @ ? ` " ?@@`?c@? @c* @! F?"P  ![@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ ϲ`㺒#㶒#񀦀ðL(7@@`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ β`" !?@@`!?k#g#. @@'X'D'H'P'T /```0 TH) @ ( 6T  ?, "?8 2P @ // 70 0P&@00P T:     + "  *   /`.  b``(/`  D X 2?7   ``0@`  DH) @ (@(0@X6 0  HD ,X ',,X㖲!}'-?' P( D'      ?e ° ? 'X) '@ /67/. @/7 `/7, , /`7 @(3`0,626  ( 5@FX*`H(@ X" '@ @ + ,(& *.``@ . & 4`D, @eE P- (P(P#8z0 @//+` '7  P  /7 (3.0626 ߀P  T&@-%- X     "@(  .X ( 00? # - 0-㿘-#`1.!X㿘`-_ #`G8.!X@6  * `@@  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * `6 @  * 6  ` .!X@6  * `@ 8`  `2`` 㿘  $ 㾘;;n # '  x*`"``*ߒܐ`ɐ.6 > ʐ`.6 > ޒ 2@ : :*:   㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@߭ߩdvma_mapindvma_mapoutboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenode %x property %s length %d > %d Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.2>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x read header: %s ELFunknown executable format %d+%d+[%d+%d]=0x%x boot: short read read phdr: %s Can't find entry point. %s%lu+read text: %s +%luseek to section headers: %s read section headers: %d %s%ld [lseek symbols: %s read symbols: %s ] bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.2.30123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %s`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     error inflate 1.2.3 Copyright 1995-2005 Mark Adler  #+3;CScs !1Aa  0@`@@ 8286 8687d87l878?8D8D 8E8E8F<8L(8Nx8N8O\8Od8O8x8 L8$8 8,8p88$8 8,808(8 8888   8@` 0123456789abcdef/8 8h8h88888888$)8068@C8<N8W8 b8Pq8v8p88@8D888888@8088x88 X8!88"48"8%\8#"8#X/8#l>8%HR8#f8#v8#8$8$@8$8$8$48$p8$d8$8$8$8$8$8%$8%8%<8'8&<"8%/8%>8'R8&,f8& v8&X8'8&8&8&8&8&8&8' 8'x8'T8'H8'l8'8'8'8*X8("8(T/8(h>8*DR8(f8(v8(8)8)<8)8) 8)08)l8)`8)8)8)8)8)8* 8*8*88,8+P"8*/8+>8,R8+@f8+ v8+l8,,8+8+8+8+8,8+8, 8,8,h8,\8,8,8,8,8-8-8.X8/ 818989H8=8=#8>8Fl8F8G,8G:8HG8IT8J8PDa8Rm8Q\8Uu88V}8V8888V8X8X@8X88_8a8a88(8c<8c<8c8@8c8d088dh8e8e`8D8m88n8oD8p8p8r88s 8T8wX8w8x8y$ 8}h,8}98D8D8D8K8[8d8s8X}88D8D8(D88 X888*`8, 8h88@8E88m 8D 8s 8& 8. 8:8QG8P8UY 8g8V@p8Q88Fl8b8P<8V8 8H8F<8? 8d8 8oD8_8F8~ 8\8#8.8'489H>8NxH8pO8tW 8^8ne8lj8r8E~8' 88a8Fd 8`8w8"8 88` 88; 8v 8 8888"8+88 8L>8L8r8R8kdX8 ]8 e8k86 u8p}88h 8h88 8< 8 8<8}H8L(8 8 8N8O\(8 L78PD@8H8P8dPW8]a8si8\r8|88 8c8K8 `8p 8888O8{8F|8h 88x8  8x8 89(8428< 8D87lM8V 8 \8cb 8`q8Xy8{T8c<8%p8<8d 8X868wX88z 828 8_8Od 8 8Z 8D 8 #8" *8d0 28 =8<\ O8 Z8 h 8 v8$ 8%p 8*` 8d 8=4 8 8D 8  8 8P 8@ 88 8Ft 8a 8 8 8s 8c #8" ( 8$ -87d 78` E8 K8 [8 `8w j87 s8( |84 8 8 X 8g8 8bX 8! 8( 8h 8< 8 8 8 8|@ 8 8h4  8D 8 + 8 08 >8 G8Rh Y8n ^gcc2_compiled.open_countnetif_promfilestore.30bootstore.31prom0_fakesaveechopv_putcharsun4_idprom.86dtabstringbuf.96promdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.109elf_execaout_execelf_seekLstdLmul_shortwayLgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9read_inodeblock_mapbuf_read_filesearch_directorypnmatchdirmatchnfs_getrootfhnfs_lookupfhnfs_readlinknfs_readdatarpc_getportrecvrpcebuf.24sputcharsbufsbuf_endsbuf_lenrarpsendrarprecvbuf.39numberdigitsetherbuf.30paniced.24gz_magicget_bytegetLongcheck_headersstoppos.36arpsendarprecvfixedtablesupdatewindowsyncsearchLetextcrc_table_emptyfirst.24make_crc_tablecrc_tablegf2_matrix_timesgf2_matrix_squareputchardvma_allocprom0_iclose_remprom_ioctldomainnameinflateCopyloadfilecd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenrpc_fromaddrrpc_portstrerrorrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openerrno.mulocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seek.udivrootipsendethercd9660_readdirrpc_xidtwiddle.divgetsecsndevsip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodeinflateGetHeaderfile_system_cd9660promvecssymxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvnfs_readnfs_writeprom0_strategyrpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbootfile__ashrdi3crc32nfs_statinflatePrimenoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_uremxdr_inaddr_encodeinflateSyncfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpcd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypecrc32_combinedomainnamelenprom_open.urem.remrpc_pmap_numxdr_inaddr_decodeobp_recvdvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysin_cksumgetpropprom0_xmitkdoprntexit_divesymufs_writegetpropstringstartfile_system_nfsbceaarpwhohasufs_stat__muldi3netif_closeinflateSetDictionarystrlenopenreadether.umulhdr__data_startinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freecloseprom_bootfileget_crc_tablefbufinflate_tablefreelistrpc_pmap_putcachefree444444 4 44 4|4d4t 44 4"4(40 4@4tL4Y 4_4d4 j4xr4py 444 44,444D4444 44444 448$40 4=4E4$J4P4p]4c4o4y4 44<4gcc2_compiled.filestore.30bootstore.31prom0_fakesaveechopv_putcharpromdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.68Lgot_resultLnot_really_bigLnot_too_bigLdo_single_divLend_regular_divideLend_single_divloopLsingle_divloopLdivloopL.1.16L.2.17L.3.19L.4.23L.4.21L.3.17L.4.19L.4.17L.2.15L.3.15L.4.15L.4.13L.3.13L.4.11L.4.9toppaniced.24pos.36putchar__maindvma_allocprom0_icloseprom_ioctlprognameallocprintfprom_sinetif_debug_udivpgshiftmemcpynbpgdevopen.udivtwiddlendevskprintnprom_bootdevicedvma_mapoutobp_strategydebug_rttbzeropgofsetcputyppromvecloadbootblock_countioprom0_strategyvprintfdvma_initdonottwiddlecloseallprom_initpanic_uremmemsetmainblock_tableprom_open.uremblock_sizedvma_mapinprom0_closeprom_boothowkdoprntexitstart__data_startdevswprom0_iopenobp_closedvma_freeprom_bootfilefreelistfreep<4 `@# ` !" $@` `T@  H a@"@H*/+  "a  0  "#p "#| * "#t!` "#x@㿐@#  a"a @ "  "@c@  @ p  !@@㿐 c@    "(@ɒc# @ D ?#c' / - + ,`2 @@〒   # #X@〒@ɐ#@`bp@@?@2 @a aa @`#@Ȳ@  p? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @\"1?㿘 #@(1 @M"1㿘@ " ܒ㿘 @0  㿘 #p` @ ! `  "  `X "!J  *@J` )*@㿘@Ґ  #p` @ ! `  €a  $€a 2$   ! @"0 p  $  $`$` 㿘# a`   ``*  `a   '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 !  @@ 0(@  㿘  @ $ ? `$ s*㿐 !/  0T@㿘  㿘 !`t€㿘) !t ?N  @  "!!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @U"+  " * @7 $`0 "$`4 " @$` @ 2!t&  %!t  @+" 㿘# at  @ 4 "$at & 4$at㿘 #t*`@   #@ْ 4   #         # @’` ` #|@  #t8 <?*  8 آ&@  `  #x8@㿘?( ,h1 \&! H L` T ` X P d l$ p  t @  p.@` * @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  << ? * `:```?  `@ "`@"     <?"  <㿘 ax'H'L'P'T 'X w"ax@/H @#@㿘 #H4L44X44444444D4444444 44444㿘 'H'L'P'T'X#`@ H㿘 #`@ N@`N@`%` N@`` !4*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @N N@ @E N@ @< N@ 0 x   ? #P0(  @ 0,  ?L?hN@@ `N@ % X lT㿈 #P @,(  ?L?㿘  D`  !|  chJ@ #!| @ @   @ *0   @ *` (%s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx44,44444444   44p4pH4H44444H 4X-4 D84pA4L4tZ4 He4r44484h4 4 4 4 4 |4 4 l4 4 4 4 4 d&4 @-4 444 X;4 B4 I4 P4 W4 ^4 e4 l4 Hs4 <z4 `44T4 444D4$4p404&4-444;4 B4I4$P4W4l^4`e4l4s4z444@44x44|4d44`4  miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#96:\ :ts=3500:\ :pa#12288:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#12288:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#4:nc#500:\ :pa#4000:oa#0:ta=4.2BSD:ba#8192:fa#1024:\ :pc#4000:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N 쀢  , ,b , , 8" '?''Ė '''''bȔ @4?' @1 @ @ ''' @5c @6X@6d @51 㿈/ / * @*`"* "@*` @/i '<   ?" "? 0" ````` `(`0`8`@8@8`8`8`8` 8`(8`08`88`@`H8`H`P8`P `0!`0" `0     !'@4'`X?ֈ!㿘"`@Z#   V  X 2 $  ?6 6 && & & & & & D& H 0" 0"` 0` ` @4Z!㿘@A  " `  ` "@` 2`[ $㿘w@&!H㿘!0 0c $@$$     @4"!`X!P@%# ""8 '  5     m   _ 4 d W 0^ ` j  0v   "z'k k s 0m h k y 0R  e l   l a a f 07 ^ 5 7 0"$ g  d 6b'O $0"+1'!\!r 0''@4#耢 ?8 '  @4耢 |?z  (  $ !n l!'^'     'U'  'O'ܐ         $?ؐؒ  @2 ? @>?  =?.    ?'ؒ  @1 ?*?@%%@ ^:!   0?'ؒ  @1Ӛ ?0X?  " ؔ @1Ú ??㿘 @N  `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*2J@ "J`  2J@ 㿘 ` @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   + #@3% $ $`   -, "P %  ?"% " #"?  @`?` @ `  ?ʠ?` @ `  ?` @ `  ??` &@㿘'L'P'T'X@L㿘`@%㿘@Ö㿘@ѐ 㿘@Ӓ`㿘'P'T'X@Ph"'< @ c ##( #ߖ#` : )#` @@2̢P@((  (6'$@@@:̖X@  & 6$@` 2` 2`"P&``h@u & 6$@` "`@2p@a & 6$@`   :,@` ,@`*` B$-+:  %!`%N m`%@ @@.h cx@' & 6?& N %   , , ?$, ?*` ő: ,@ & 6@` $@'$c '''' @1U `  `` @@a@@ʖ ?`7@E@O@] @@ ?`7?` #   >@s $@$c ''''А@1 @`@y&`" #㿘?"& |?&&  "'2   @1ה ?3& @1Ô ?-b  )  ? j ?/???????????/c7@ h@0 j? 9&& b 3#ȁ㿘 2&& "&   &㿘?&& &  `"`㿘 @0o V`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8``8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8`8VW\WX8VX[XX`8`8`8Y`8V`8`8Z(ZHZ[([]^d^_`8`8`8`8`8`8WWWXHXh`8[W`8YY(YHYY`8Y`8Z8Zh[ [\]^D^p^_t㿐@8'"@@ "`2*? *H"'Lp`%fL`z`U ,*` €Y``#ؓ*` | "H@yG``#ؓ*` ` "H@i7`` #ؓ*` 0 "H@Y'`` #ؓ*` "H@J`'l  @O`x   ' ` bP@ ` bX@"``bP@`   " bP@Ͱ` bp@ݖİ`bX@Ֆ`  " bX@–`bP@` bP@"x@Ô`   |@{"w"@bP@t`@'`'` '`'`'`'`'` '`$'`('@<0'ؠ @V@OF "@vD` `?@."bP@P7` " b@E,&@.ڒ i `'l`` +!M?H! 2m!A!=: d 2n!4!0-! 2mn!&"! !m!! d !n!! ! !m!n &? $?&   4` -` - 5-:  V g bP@ '   @՚"``` " @.:  @.5 bP@}`b@ul`p`t '` '@fd' '`'l  @Q`'l  @H`( @r@` D` ` @ @c9` 5`$`6" "В@Q@-Β <@-˒ <* ,  <, Db@# `  . L   "㿀#b' @@ b Ր"@ `@  (*@  㿘 d d@-i d@-e d@-a dޒ d  `d ?`   ` "bP  & bP㿐@-  ?&㿐 !А"@'"@* "@*`@*`'@,  !"'''" ` ` @,T!`#`? "77''''@*" #"㿘!!@o !㿘 1  㿘`    `*. "A  0.  ` -. 㿘#@ޒ   \, @@b@  "`?@S@  " " @.㿐 $  c#\#`ܰ ""㿐c  #\#`bx   㿘? ?  ""  @& 㿘?2 ="    6    ?@ .@ 2`@:`+  * @    @ ` @ 4@ 2  : + @ *` Ҁ6 ?6 ?@ ؒ@ i iixiiiiiiiiiiiiiiiiiiiijiiiiiiiijiiiiiiij㻐"' "?N @ / @w@,t 2 @*#8 2#@@*#p #xJ B  ?* : `(3Y#*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@?2 L 2 L ? p# 띒 ?, Z$?#\   @*p N?2???#@ @$  && Đ?J       (+  2 " 2+J " ?J@   J@J`  !"'P'T'X'`#`ذ ''" ` ` @)!?"77''''@UP*" ϐ!`㿘   `  `  @Z  ` 㿘'L'P'T'X@$LtTtptxuuuwlwtwtwtwtwtwtwtwtwtxzhzhx~4px|xzhzhzhxxx<xH|~8xdxltxtLLLLLLLLLLL$LLLLLLLdLL8((8((((((d8(8(8(((((((((((((((|(((((((l((p((((((((((((( (<p((p(ĝ㿘` @ &`&`&`  "'''"`` ` @(Ɣ!` ` `,`$7''7'''''@ @ɐ 2? @`  @4`  !p8!"'H'@Q''`0   `"` a ?"a` ` 2 ` @ "` ? "   HW` p'ؔ ('''''@(W ' 't(@آ   %'ؘ?'؀ YԐ#" S$$@ ' 'C <pԔ'Ԁ`,ظ '''Ь?/K 'ؒ`Z/[!*` €O߀ ؐ / آ L?Ѐ  33  ̖`/@ *,`: @*`" @ Т L?Ѐ  L $  ('H@`-`@'д'Ц '؀`-`@`'Ѐ Ӕ '  +/J*I'ئ L ?Ѐ  33  ̖`/@ *,`: @*`" @Т L?Ѐ  L $  ('H@`-`@ '؀`-`@`&O?NؐЀ  33  ̔`/@ u,`* "@ oТKИ  '؀$!3- 33  ̔`/ @ X,`* "@ RТJؐВ` '؀$2' ('H@] J h2 @'(J l2 ' "$`ȑ-`@ `, `-`@[``''S `-`@J``''B "`1-`5$` @` -`@ `*`:`(:``* !: (` -`@ `*`:`:``* : `-`@` :``:  6J  -/ߠ`D g  G "  `2-` `"-`@` ?`''ش?@Y "  -/!w @^ !o  !@ #`#\@ޚ'gG?@$ gg E e ef'@ ' @ 耢`   @   `4  $    -/߀ `J-`J@ `4-`4@ @ `-`@`2( `-`@`x*" `-`@`j"$ `-`@`]"`-`@`ԑ:`M:`-`@`B" `-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  `  `-`@`  ` !'   x`-`@`!  @ 1/"@%" #)/߸ `-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  ` f !!'`-`@O``''G `-`@>``''6 "`2&-`)$` @ `-`@  ( `-`@ ` `"-`@`  `   2 /߀'?$ S "  7F!Ȩ  4`,  `4 0 , 806 03,  @ `0, [  ` `0, , 4`  ` 4  ,@$  %/Ƞ /ߨ ''O߀ `' '4O" `.`3`( $$` ' 'ʒ äp``($$@ ' ' pO߀  ߔ $$`  0/h/ih $$` ' ' p4" `.`/8 $$` ' 'r kp`4$8$$@ ' '\ Up"`-`/8 $$` ' 'B ;p`4$8$$@ ' ', %p! e$$@ F BV! $$` ' ' p耢@  $$` ' ' p?``/8 $$` ' 'Ғ ˤp`4$8$$@^ ``! $$` ' ' p$$` ' ' p `-`/8 $$` ' ' {p`4$8$$@ ' 'l ep$$耢@R$$ @ ' 'O Hp"@`-`/8 $$` ' '4 -p`4$8$$@ ' ' p ! $$` $ @ ' ' p ! $$` ' ' p$" $" @ t 耢 4 R   ./h/ih $$` ' ' p B$?$ .@ ?`4`/8 $$` ' ' p`4$8$$@$$` ' 's lp$$ @ ' '_ Xp 1" `,`3`( $$` ' 'B ;p`4$`($$`'`'- 2'`  &'Ԑ#А"  '  2` 'p   2` '` @ ?' "?'`@o (1 ' 봐!P" '''/*` *@*`**` * *`@  Ħ  -t@ݖ Ā % ?   N `Zx[#x*` €N ?Ѐ 33  ̘`/ œ*L@@ *`# Ж `L@?Ѐ  L@ $'7N*? N ?Ѐ 33  ̘`/ *L@@ *`# Ж `L@?Ѐ  L@ $ @4 *@`@4 *@ Ѐ NЀ  33  ̔`/ ]+  * " W?И NЀ  $vq oN h2k@ hN l2d a _]@K4ʐ  @;4  @.4  @ 4   @4  @4 @ @4w  @4i @ߒ4^  @ђ4P @ƒ4E  @47  @4* @ @4  @4  @4  @s4 @h4  @X4א  @K4ʐ  @=4   @04  @"4 @ @4 @4 @4z @4n  @ߒ4^  @Ғ4Q  @Ē4C   @46  @4( @ @4  @4  @4 *@v tt* &#\   @??&Y? L `=[# *` €`+ @''`-`+ @''`$`+ @''`: `+ @''`: `+  " `+ @''`Ț ;@  ? "  '" 菐"㿐@@* @6@@z@ #\   @?&@@e#\   @??2?@w@@& @  @b$@ &@㿈\ f   e E  #\@  g G f' fJ 02 @?"( B  '@@?"( B3'@   0`*@@ '`" "@ X"'`, -,   +,  쀦`   0.@ ` `0..    0. `0. & ǐ"0””¬°ܝ㿘@0","  " *H",``&: 2` ! *`"H@A*`$ $ @$ $ 㿘  !@" b*@ "&@"@ 㿘   *`` " 㿘*` *  *` * `2&@ 㿘? ?* & & 㿘? #   @4`4  *  $ 2  , p  * @ې , " & 㿘 @Ȑ  *` Q  "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘ؐ  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c @   4`4 444 4  $@? # 4 44 @   4 $@  $'  "' 㿘`  L*  >``2%耤` '!@l"]"q$"@g$@' 2@]@ R$@$@T`" >`FA>``2@㿘>`@ *   `` "? * ` " * " 2@ ` " " ?& `(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  :  4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐 ?. . 6  `''`'ِ   " *@ $ 2 '$   $   $  $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?`  " * " *#??āh@'H @  `?  ' ?  ` 2L - + '2LL` `0 *  L`0 `\* : (     -`*   ?4* *  ?ЦL `/`9뀤 :@E =L`0ϦL`0 π 6`e  (   ?  -`*  4* *   -`*    * *    LЀ Ӛ`e `EI 2  2"L`+ `-І LЀ .`0ϦL`0"π !ЦL *  L?Ѐ`/`9*$ "" 2     H &@  '`#PB?` b@* @'&'D#PBD? ? @ 2;$`"pH'`  "@.` &'D?aH"@ $$b@*@&@ &.`' B@?"#F?IH "@*` &'?;H$@T "@* &'D?4:" "" X ?H  + @&'D?: ?, '+ @(&' B? $ #'?'_ 'YV  "@* &'?F:/  c + &'D?: + c @"#H#H? J#"F? H?J  ? " "H8@?0' '*'u  $0o@# @@"?  ''0W?@  ?   2'?'0C @#H? F 0/ #X! *#`&4' ?@  x#`#h#`#p#pB'#pB&'??@?؀ ȉB) @@)?,?А '?Ƞ  ' @cȅD?   #'?'0E '0@#` #pBB?Z?Љ @ȅD? @@ "F"'  ?@#x # 0#   * @ | `     쀢 @ &  ?3 6"  @  4`$ $@ &  `mh`*  m % N   ?@6420.H 2"䀢 #㿘 t -    `ں `1?#  K @G4`4    "@ @2 @:`"44 3`: ('  "' ܐ 0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' h?'P  'T '@ * ''@  T#"@̀ ?\# \# # B T "\#   ;Ȼ2g Ⱥ| ?* &' d2`   @Ȑ"̒*2   ̐"*@' #B?{͔ ? '?#'c#ș DHFBL ' B# '"@, $ȇ%)'#?    '@% ' 8    "'h!(. €?'? 'P'PP 'PP' 'P``' ϐ   Ⱥ  '  b@* @<"  #Ƞ #  ?Ȁ " /`@ &' B<  `ȅ!?Ȳ`b@* @>`$Ȁ %B?"  /`@ $ȇ%B?ȡ<  `耢 c 9' 쀢 c艡 B ?'ȀF#?0D'@'&#'и '$% ?ȅ) )P?䀢 Ib@* @ $% ȑȍB'`0.ȍ…&' W?#Ɓ) 0 @6V?ȕ$%#ȑ DDB?ȅ'`0,Ȥ…&' 5?ȅƁ)} 0`@4?Ȑ* b@@ $% B#Ȁ@B'`0,Ȥ? D-Y 0ȉ&' 9?ȤL 0"Ⱥ`D??Ȧ  ZX"@, "P # ' c Bȁ  1. Ȁ@̍B'`0 L,Ȥ ?ȉ"#B  ?ȅ$%L` 0L 92.  ,#艡 B?#D`'Ԁ  'Ѐ ؀d3 6" &$' % , @'Ю` `@4%@%&@䀢 ` 'Р  `̀2'?2 ' @ `''   *` ` '@``` "```@@`耢    `В  '쀥䀦  ߔ   1Pɦ8  1. Ħ`O'Ѐ 'R` 'Е*@ < '   Ѐ 2     ' ' 'В  'к`7Ԣ 0Wm  KA`  ̀ `9* 4`e,& ```̀` % 4`2N,`"K,``:  9E, `9` 9,,;,,@  < `ؒ 0,@  4 `L  1L 9   ,. L 0"ʐЀ  Ԁ`@ 2, 0.  ,T"\2"+dd0(#d$ l       $((()(*(+ (,!(-"(.#(/"dh p" "` "`"h;`` (` `?# *`?;```0  ?2 `2 #0 ?(@ 㿘` ` ` 2 @@ "@? "`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. @ ` ``&@$`$`$@$`` "`*@@ `@"@$`$@.@` @@@@l$@ 2` `` `,` $u` ` @ܔ`@"@$`$@`" $&`b   `  ` @ "@  `@ ` `@ @ @@@@$@ +0@ `,` 0   @`@"@$`$@2`@   `" $&` ` ? @4` 㿘"`2 ێ 2  $ "  0`  @@" 0@   0" &   ?6 &  6   2  " @b?@   &  &   &  㿐  C & & '&@%@   P  C  & 6 & &@#`& & & @ZV  2` 6 (T  &&}  &< А`?`&$&@(&@ $ L( (y"@"$㿐@ ?`W%b  @{      @  9⸀ 2$ #\   @??( 2$  $ $ $ $  $ |$ $"| *@ *`$ ` $  "`"`@\  " ⸀ @/㿘  㿈@ |`R ` 6"  .,`*  `# "' 2?' ' '@   $ @  @??< 2  ? % b􀤠" %bΒ%b㿐@J`Db  @"   #\   @K?? $  G|$ $` $"|@   $ $ $ @  @㿈 $` $   '?   @  ? $? $`!"'@8"@  ސ!p㿘 `@㿘 2 w@8!H  @ ? "㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘# ? T` "??`X2"  `  ?2  㿐@H 'T x T 0.?T2 7耦(7耢 2: " 4`444`4`4`ؑ45 'ē45 5 5  `A'? 7' `B`n`*  8d`*  .Z`*  $T` MT :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', Ð 'W. 2, @ ( ?#   ?#/@..  ?:'$$66`% @"6``4@  *. ?  @26`@4@Ā2T`#@  " . @?* 2@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 0 2 + ( 2X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@`    ?"J@ @"J@@ 㿘 㿐#\#`    㿘T դ  P > B< P ?Đ*@4 㿘 ! V  t  ?Ē* 6 V ܔ㿘T   a?  2  ?Đ*@4   4 < P㿘=V 㿘  ?Xw   "@Ӳ @ 9 0Lh $@\xp"P!'Р!x@  `''@  ''@ '@ ''a ''А @ 7 ` @`p aА 耢`"P'@ Ԑ `'Ԑ @ '''@ ʐ'@ ''a '' @  㿘c  5` @  !`""` X"@ %@"@& X @ <7- *  \`(*  ǒ "k$ &"$%"* @, д "X"$"@%   n! "# `? `؀ @ y `Ԁ @  $?$ X& X   2 XD! X@=!㿐#@ X4  #\   @ ??l`h"`@q ` * -`  *  \ ` Ԁ @ V ؀ @  %$`$ X8` ܒ`"* @@ 5  ؀`@  "@$ X"% X#\   @ ??`"` X`@!㿘!@"!㿘!!/!a @ $!H"'Җ +  "@  ?  ,@   2z@ސ" "ojLđ* : `>Yy#*` €`* !U"`!R"``2 M"`J"  F"`C"  ?"`<" 8"`5"  1"`."  *"`'"  #"` "  "`"  "`"  "` %`  %`! "0$ $ L  i`  "`!"" & & &  #\   @?& "P&  `"` @ @O8&(&  Ӂ"h㿐 #@*` *` #\   @??O  @"  @n  :+  *@ 2*`*" 2@ @*`" @  * @ *$@ `"  *   Ο*` C"x   * "@%  &  &  & &  㿐  2! #\   @#??  @ "    "& `T`T  & @ T$  "@" 㿘  *  6`] # 6`*`.`" 2  @  @ *  *  * *#@  @"` ?$ 㿘( 8@Đ"?@ 6`*`.`" 2 @  @* * @ `22 *㿘 ?"   &@ & >` .`"    "   .`2* *"2` @ * @*@@# "`㿘V?c 0 `X #  6 6   : 6 * 2 #4@6 6 & @ 6 55 2@*6 6 6 6 &  ` `.`  ?2 * #@ `" 6  2*  (   #& "㿘 ( `   6`` >```*``} 2 a ߐ"  Z"` Ӑ"` `  "    , ;`Ґ  ?",    `:?2 @2`4&`*` 4`@$$@?`ܐ": * ` , `  `@z`㿘` @w"  (?.  2"0m2*   2 #0a( #   ` 4  *    `2( `"@ "   : `" @ "  * $1"*#0O )"@&"  2" `2   Ԁ`2  @  []㿘U `?#"  #? @ %,Ւ? ,  ,/  @"`" @J ǐ#@ @ "  ܀`$@ @  ` $ @" ?`$ @ 0 ,`   @ 㿘( 2 "(#PВ""`@΢ "㿘"`@ ,c`"  b @ 쀢`U#pz  &"! А  $  0 I а$ b  @   쀢`0#pU "H !@ t X"@ t "@ t "@ t "0 ´ <% 0 H Ű%@0 d%H0 Ǡ $%P0 ɨ T%X 0 4'`sparc'p ڴ 'x   ˬ H ʌ ɌTTT  | ˬ H ʌ ɌTTT @ LTTTTTT `  Ƅx T t  ̸TT @  Ƅ T t  ̸ (T @  4 Ą TTTTT TT D  H Řx T t  ̸ ( x  ǘ T t  ̸ (T ϔ  P P T t  ̸ (T @ ,04@,04@,04@,04,04,04 ,h04,`05p,X06,H06T ,006T ,06T,06T+06T+06+06+05+05+04+05$+05+05+03----p-h-h-`-h-h-H-@-0-,-h-h-h -ht,0 -ޭޭK %%%%Fh P d0 <   $ L \ d 0<\11x1p1h1`  , 8 D0  |2$TP @2 *PP2 *P(25tM2 2 @ ,` ,6P6X 2( 3 28IJ 4X 4L H` J( It OXMP P( Px a a [l ]H \ a u v$ q qxP { {D q qxPX  4 q qxPRRRRRxRhRXRHR8R(RRQQQQ< $ , 0 8  ` Dh  ( K H t 8 H 8   | L  2 Hx 8T 8@x > 8HH E| Ex\ GD G M M e e( w x4 T7@ 0 D x  , X h x  ,h ¸ D  ǘ d2d P Ҹ ++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>?? ' ` ~ ^ "' ,AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uyHְָXPH@80( Boldface.iso1 0Fwfllllllll||| 0 `F8ll8vv0 000000 0 0f<0p000x6 0>p00p>p|`08l 8llF`0| 0|``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp0Fh0T /, 0 -0 -Th 6 7| 8,| 3` 4  < =( x 9 9H ? A( t = >h` E( G$ H B B O Q R L( L@ ] ^ _ Z [$1+$A'* + +  c g< ` ` jX k l4| h` h8 rp s t@| o p$P   } } 4 t x P   p9100_romfont  0 @  P ( L < | 0 tx P  ((  | 0 @ ͤ( )  `8    D @ @ D E RL r mX n  mX n   0   nnnnnnnnnnnnnnn Op K RL L L4 Q8nn {nnnnnnnnnnnn |  P nnnnnnnnnn h  D  , 0    $ 7nnnnnnnnnnnnnnnnnnnn    & % %DLhp $ p nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnPtl8nnnnnnnnnXHnn p dn\nnnnnnnnnnnnnnnnnnnnnnn z znnnnnnnnnnn Op K P Q Lnnnnnnnnnnnnnnnn 9x < =$ =| = At 8LnnnnnnnnnnnnnnnnnnnnnntnHn(n |   nn   # $ $nn < dnn nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnܔnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn h    nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn   d  &nnnnnnnnnnnnnnnnnnnnnnn $  @ pnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn t T <   D , Јn n nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnh@hi(km nw|nxhDnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn?@@ CEnBnBtnnnnnnnnnnnnnnnnnnnnnnnnnnnnn 8 @nn Hnnnnnnnnnnn~  | Ϭ 000@0x 0))((((((((p(`(P%%%%%(@(0( (('''''''''p'`'P'@%%'0' %%''&&&%%%%%%%%%%%%%%%&%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&x&h&X&H&0& &&%%%%%%%%%%%%%%%%%%%%%%%%%%%%%ޭx+0.shstrtab.text.rodata.data.bss @X l-h y00fn(0f$