lighttpd-1.4.55-bp151.4.6.1<>,^1!M@eee&lfGR7^;7U ]GdX(PW`8(y<|C=mtNûxB^ ݑ)᪳NCuf-#< j>(oɴT;G, )Z7+MZ 'mK4g& nd:5HG=LIGu !SCJ}=yڽOM^xr"gμvfb<x='atu.fd >I4?$d   V!*7 Pt KPjDj j j j .j /0j0j2j55j7P7%8$%:%(;'8;0%9;%:>%=Б>Й?С@ЩFбGjHtjIjXԈYԜ\j]րj^bpcd޾eflujv,wjx`jycz Clighttpd1.4.55bp151.4.6.1A Secure, Fast, Compliant, and Very Flexible Web ServerLighttpd is a secure, fast, compliant, and very flexible Web server that has been optimized for high-performance environments. It has a very low memory footprint compared to other Web servers and takes care of CPU load. Its advanced feature set (FastCGI, CGI, Auth, Output-Compression, URL-Rewriting, and more) makes lighttpd the perfect Web server software for every server that is suffering load problems.^1obs-power8-020SUSE Linux Enterprise 15openSUSEBSD-3-Clausehttp://bugs.opensuse.orgProductivity/Networking/Web/Servershttps://www.lighttpd.net/linuxppc64le/usr/sbin/groupadd -r lighttpd >/dev/null 2>&1 ||: /usr/sbin/useradd -g lighttpd -s /bin/false -r -c "user for lighttpd" -d /var/lib/lighttpd lighttpd >/dev/null 2>&1 ||: test -n "$FIRST_ARG" || FIRST_ARG="$1" # disable migration if initial install under systemd [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$FIRST_ARG" -eq 1 ]; then for service in lighttpd.service ; do sysv_service="${service%.*}" touch "/var/lib/systemd/migrated/$sysv_service" || : done else for service in lighttpd.service ; do # The tag file might have been left by a preceding # update (see 1059627) rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -e "/usr/lib/systemd/system/$service" ]; then touch "/run/rpm-lighttpd-update-$service-new-in-upgrade" fi done for service in lighttpd.service ; do sysv_service="${service%.*}" if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --save $sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" [ -d /var/lib/systemd/migrated ] || mkdir -p /var/lib/systemd/migrated || : if [ "$YAST_IS_RUNNING" != "instsys" -a -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi if [ "$FIRST_ARG" -eq 1 ]; then if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl preset lighttpd.service || : fi elif [ "$FIRST_ARG" -gt 1 ]; then for service in lighttpd.service ; do if [ ! -e "/run/rpm-lighttpd-update-$service-new-in-upgrade" ]; then continue fi rm -f "/run/rpm-lighttpd-update-$service-new-in-upgrade" if [ ! -x /usr/bin/systemctl ]; then continue fi /usr/bin/systemctl preset "$service" || : done for service in lighttpd.service ; do sysv_service=${service%.*} if [ -e /var/lib/systemd/migrated/$sysv_service ]; then continue fi if [ ! -x /usr/sbin/systemd-sysv-convert ]; then continue fi /usr/sbin/systemd-sysv-convert --apply $sysv_service || : touch /var/lib/systemd/migrated/$sysv_service || : done fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -eq 0 -a -x /usr/bin/systemctl ]; then # Package removal, not upgrade /usr/bin/systemctl --no-reload disable lighttpd.service || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_STOP_ON_REMOVAL" && . /etc/sysconfig/services test "$DISABLE_STOP_ON_REMOVAL" = yes -o \ "$DISABLE_STOP_ON_REMOVAL" = 1 && exit 0 /usr/bin/systemctl stop lighttpd.service ) || : fi test -n "$FIRST_ARG" || FIRST_ARG="$1" if [ "$FIRST_ARG" -ge 1 ]; then # Package upgrade, not uninstall if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : ( test "$YAST_IS_RUNNING" = instsys && exit 0 test -f /etc/sysconfig/services -a \ -z "$DISABLE_RESTART_ON_UPDATE" && . /etc/sysconfig/services test "$DISABLE_RESTART_ON_UPDATE" = yes -o \ "$DISABLE_RESTART_ON_UPDATE" = 1 && exit 0 /usr/bin/systemctl try-restart lighttpd.service ) || : fi else # package uninstall for service in lighttpd.service ; do sysv_service="${service%.*}" rm -f "/var/lib/systemd/migrated/$sysv_service" || : done if [ -x /usr/bin/systemctl ]; then /usr/bin/systemctl daemon-reload || : fi fi5w@iUfF</P{}O&#'&""h"`RP!88@X-8h% z 5_.JzL &P K~.VQ Np&nAA聠A聠AA큤AAAAA^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^%^&^&^&^/^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^4%^&^&^&^&^&^&^&^&f45d09334766ce774c9dc90f00a1a645fa64de14e222e647a464c4307a4976d9aec61660e6a34dba4079420341e09353746888da8dcda0c1e5f8b0f57488d8c86ab9a143eeb02c106754b8c5e38685ef29adb774483e1dcfb8a482d65e8cba005615542e73a99e25cecf6da6db128046476907d046319bf35441e8ea67c7df5e44e10f874c6aa9717af0be89eec4dbfd3747e92fa2572d42b18cb17ca35c48f9e67fa1c23d311c01d678c65dc971e4ef6988a8dc6379c30846a69a20f4448c31395adfcd8c07307816fb6a0541a11091e2f1b599d61192a1e4ae0354d5cc4dfb3eb9f7bd00fa03269ee834f1fe22c0f9a16b06a64745baa74ed521dcae7df7cd74b3906e82498ada1ffc02d5d2b145f502aaf191ba9189fe13c014dcc61f5f7509d6405336b5881a03ab9408ca17e57697ba10ac9638704774ac1b6ad32e89271d50c95afdc2ce1bd53e2817a2edab374ab73ba0011f769994da167cd6e6db7122ce54a7a4cf8b8e52ce06a5b485a0e444e67865ad044f68e8262d9708e6cfd25caf0df87385952b4800edb4ed7113bae33a668b27945ec9335ee80edf6949db7dae00d74566f9ac7713a4e251d789191bc662003bcee7e5ff568a2b135ee0163865c44af5f71df24e05171a6a70b1d8daa0e0c2c379d508d4bc36ac7c36f1de3cf5ac7ed07301a8affc51bc3bedb623f49c2f561bc0796766a7cfad6a7a46ac0a481920acb16c6baeb564d9e1c17b2ac84bb79ecbfc06227cffb6f9bbcde7f0e4b410a368c42aa45556d8987870f112bbe7539fa8e0cb5285a7b34ba43e3b92d1a07df97e931e98a76f2c18e51f69197c0744d24b555cd474c4f9b04e008d9a764f9f1735e6d3e8acb3b5d9ed5facf6120dc18ef6aae512e964f4444c3761e4c41e60fbb6c36fb48146882dd278a9a3f158d7aee074190e4eaacd0ac0f455322037d1bd92c0451d4c9c10a8aaa08d48d99081befb74cf6dc71c9106de825f1435ea2859925d3e5afae2332cebcb7951531d65602c8411839bd015495285b98df322028ee9b4db6f837f0d9769b3fe7985716a120fd10e0bff77582fd66e859df064cf46d1f646532b0f34f88460da6925d4319de348cc67be3b016bd2ea456db767c471bda5297dbefcf92b134651523365235249985012e7680980608b290c0011a78133c7e129640a836e90a86fa898eaee21b725a11d9e1d69d4256a4f804db41cad710395a130ac2eb89927c55e1c938e8449266209401c96e6f6431b0d8af883bdec36df9f54d058e9b0e79e7e8c2c40856a88e1b63a4ec2a2cbdb6ad41e3836eff564ee0299917d9a51921d77cec28a544b071c50538fc66476e43ff93a20e80c108581bb18ac1ac98bb4e9204e6c2cac1f57bb347ae6fadbb968fbfeb679b6d7e9c146fa499542e3783b8521fbe424544b2d7afa17ed5438e19290581e8be0e10c18c884b295fc33760c0c998d6ec75960f5e48a764857f8367201464ad332dc8301cd073a683f4b708e3ae72ae3942819f09cc977551d7f8e166acc8f652fb257176d31e3fa13ec95c2afc906b17c2262f77193817eca55fcf76a96755950d59f8e8bf15ac27da1526233f84513e0ef6fc4b5a092abb4d440849c756f664132b03871adaa935a02977e7e6b4115d3b8eb6602eb8e0d7ab807dca6510e26e6c9103132c9f7cbe9855daf324e9d1f4393bc6e5b1d590de1f73840d039e5315eece6b98cb1d818fe80e5a1ad3ba5ff5249198e0e6b6cdc352adc40ccc000a7a3052ec456a32e1fefc7b366f347fe3242738e52cf05c29e0446673e2b77ed22bf332cca469eb8296ec99ba2076909cbd8e24b3e7cb2617e3fef85e6df78d0402b5b8ca82ee9105308dc0ac08ae8d13c62b2c92e77997e839edaf71a5677ade31b827a6e7301cfaf706151bb429d9542244f38e9a2703d8d460c198dc197b81eeaf69a98e01a7d7f7fcfb9e7fcec3e854eea200184fdb0904fdafa66aec66921fc88a4f7d66ac18225b0a1d8ff6a3ec6f1fa5ca6d94292c5f49ee181393065f9b6296e5924af7d364c51a3d4a86d83db9ad463825c5685e6e75cde4407f896af98a1ca2cfd65a6003577673aed740cb9f37dda3e34ee59966097234629855303819228be287ace406423a86784bbe5e5bc1e40f1d6e4e86493b843f583610795b935b84f8dd941d4230e01d7e8ea0fd4b603f87833f317cdcc0ed7433453a01e50435b2d8f5653673211d5e0f256ab975f7ffdc9e0fb37ae3a4d545d4b173910f643302858657a6abf42a271d2311142ccc80bc81285a1b5a67fb2f134c8e7f6569bf9c0b6354ace85c16471315cd9ff59062ee71d8843fa6d183f99258a603993aa216a1d8e7564e5f234d1725ade66b299f5365cb1d43767adbd66feeac3424475670b449ebfb53c2d24eaa2668dfda3954d8c6ea9638c0d7628c230b8b0e047c747b84d76cd83d77dea1f155f5481be8175de5c225d7c6241f44248b70960b53319bb15740afd7dbbb4d633d28ccf4e599378c1a9b3c72370eb57ba4fcf42eb9c7c8c2df55334a226a68852dc7d7face947e16a81715319e588678ef1c94affbd0b604111db4aa816d027c3743a53c6c48c51d3358f0f4cd82f948af1b262ed75c83d32dcc08d46a89a749f3d247b409d49d1775e926fd6ba5fda12c9a6e51ffd71e347bd2ee9cb72bf4258638f00b275107db09501f2aa0594975591762568e47db2e54b6e636544f054239984eabf9269311f0eee78cb0e39198aea24ac61a4dc4d05d70eaee89a94d12d4b7d868ec0a22273ab5462a906d229962cf55ae4d7eb2bc6e611f009667e2dd0cca3398c3979cbd5ae54d3d193afc07e164c1056b9221db1bf4c10a41402bb0a9453f814360f6a67863c195dacb44785b1f387e664325e981ce1db887cddee41b99915fbb47e7ae430ffef1c30c88218478e51b4c826e58c18a48cffa96e5a510e2bd05000d2cb076fa3322b0f5645fc2e46dde49bb7f3b1ff4aecb6ce388c610f25618c410b3313050fd5ca11a8c7f7dc0d8784f48ca50de8fdd7cc384d50204523f7aa541ab4480ea5154e71b2b6c2e974139fc1a5d4e9225e11e47764329a402a0051373a50e23216c5f3fb49c4cbcd1c0b5c3ef283fca9ada4d69aa83309c5139377b76e0abdc30e78ecf531c18d3177564a071a51c69df1bff4c34ef6115be29ddfac2335a3b53c8d318e532784b3e8ca86f118f333b49c07a1748e8812b2d1499c30904ad40c57b6ecfd36cb8cfb621054db8c5bc6e36ef10f23a1ec6d0667bc2032f7bab5d7101322041ef85a0256f0da59b3b32172841f272c6cdbda9223450827b0bf97a4d642870f4313cb2fafa12b4b6ec12972305b30546c9ea5c759411bd869885e5fe1dd216bf228dd1ae25299868c24f3baf8ce1172f29487724fd7f257d7e5540a2df25b52d32dafa7b02119e00cab53851facfef4d2681ef49ec0cc388c2448f84411e5e21badac7ab6dc1ab5926f4c0df9d1c7a8c4fe685feb4e15911b0b646fd40a29ec2afb7c818853631fbede70454c3d9e0e97a3e4491e80fcc3b00cc853d2726d940328e30967474c29f243fd140d51fdc5361c75e56059d03a520030d171558366263815a658ae3db848a8feac19b9e4b264a64be0b5e1b7e7ba58398ab0567c4ba317d7dbb1e4742323773f34caea9f1baa28b34192589434685887ad18efde3a5cd89a3342eb2ac783e253ac404c6d8b6b435e1422bdf0bbe3a4992ff25610181f7e3fa22d540f1940729bc6721839dc9d364b8d4c9629e472b09d9f42b8f1aa99e17e2f48a756a0d9732306b4d13dc563a1e08aecfb5063b0fbb18a0f85e7d5d9250a180a93ee36bb70637a7b0e74d7d8b14ae8a475d98e28cf8f1f127cc3e3ecfb1c8b4ddc32bc6f987ca9f4bec792d4835b4457a70b3679ba18748ffbd0a38c62bd082261305a4f7b1ae9d61246c2b21680adfd675eb5ff3730db086f33c5cb14e558422ca504e4e8899575bc02a4bef009aee00fbf47f1ecd1dfcadd993b5194ddbef469649bb8df455751b644432cd79a5810fe03b94bcc227fb23a98c7c545c5d696d600e332ccaaa5831371be437031332b716d8f45fde44137e5ae30c2f1fe59171f49be53bb2c412a430f9d5e253b65594fefb5367ca7bc974ecb7e877463d40a459d97035861604381019b1ec47d5163ecfb56f406f4592182cdc53f2477d2192f09e73cdd947ec8ad37328afcaa4ff2e5315ce014c8ef8a87934589ec7123293a191566ddfa4a575f142d2e26db998622d95d5badd886e4c63a0f0c73e397servicerootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdlighttpdrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlighttpdlighttpdlighttpdlighttpdlighttpdlighttpd-1.4.55-bp151.4.6.1.src.rpmconfig(lighttpd)http_daemonhttpdlighttpdlighttpd(ppc-64) @@@@@@@@@@@@@@@@@@    /bin/sh/bin/sh/bin/sh/bin/shconfig(lighttpd)coreutilsdiffutilsfillupgreplibattr.so.1()(64bit)libattr.so.1(ATTR_1.0)(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.25)(64bit)libcrypt.so.1()(64bit)libcrypt.so.1(GLIBC_2.17)(64bit)libcrypto.so.1.1()(64bit)libcrypto.so.1.1(OPENSSL_1_1_0)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.17)(64bit)libev.so.4()(64bit)libfam.so.0()(64bit)libpcre.so.1()(64bit)libssl.so.1.1()(64bit)libssl.so.1.1(OPENSSL_1_1_0)(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)shadowspawn-fcgisystemdsystemdsystemdsystemd1.4.55-bp151.4.6.13.0.4-14.6.0-14.0-15.2-14.14.1^b;@^6]]@Z@Zb@Za@Za@Zx@Z@Z7Y+@Y@Y@XCX|XzXzXs{@X^c@X2@X2@XkW@W!VU@U@UȒ@UU@UUTTTT\@T_W@Vítězslav Čížek Andreas Stieger Andreas Stieger Dominique Leuenberger dimstar@opensuse.orgi@marguerite.sumikhail.kasimov@gmail.commikhail.kasimov@gmail.comjenkins@lighttpd.netrbrown@suse.comstbuehler@web.destbuehler@web.destbuehler@web.demrueckert@suse.demrueckert@suse.debwiedemann@suse.comstbuehler@web.dejenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.dejenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netjenkins@lighttpd.netdimstar@opensuse.orgjenkins@lighttpd.netmrueckert@suse.dejenkins@lighttpd.netjenkins@lighttpd.netstbuehler@web.detchvatal@suse.comtchvatal@suse.comtchvatal@suse.comtchvatal@suse.comLed - Remove deprecated GeoIP support (bsc#1156198) * drop mod_geoip subpackage- update to 1.4.55: * a multitude of bug fixes- update to 1.4.54 (boo#1111733): * behavior change: strict URL parsing and normalization (configurable) * performance enhancements * bug fixes - includes changes from 1.4.53: * TLS-ALPN-01 * systemd socket activation * bug fixes - includes changes from 1.4.52: * performance enhancements * bug fixes - includes changes from 1.4.51: * new module: mod_authn_pam * multiple security fixes + process headers after combining folded headers + mod_userdir security: skip username "." and ".." - includes changes from 1.4.50: * CVE-2018-19052: path traversal in mod_alias (boo#1115016) * security: use-after-free after invalid Range request * multiple bug fixes - Fix build with PostgreSQL 11 in Tumbleweed (boo#1153722) - Switch to unmodified upstream tarball, add upstream signing keys and verify source signature- BuildRequire pkgconfig(systemd) instead of systemd: allow OBS to shortcut the build queues by allowing usage of systemd-mini- Revert that pgsql workaround for tumbleweed: pampering over issues like this is just hiding problems. A real fix was submitted to the postgresql package instead.- workaround for tumbleweed * update-alternatives not expanded in the build VM due to unknown reasons, thus /usr/bin/pg_config is meaningless- Updated 10-ssl.conf (TLSv1.2 only) for lighttpd.conf in lighttpd_1.4.49-1.1.debian.tar.xz- Updated 'SSL Support' section in lighttpd.conf: TLSv1.2 only bsc#1087369- update to 1.4.49 + - next is 1.4.49 + [core] adjust offset if response header blank line + [mod_accesslog] %{canonical,local,remote}p (fixes #2840) + [core] support POLLRDHUP, where available (#2743) + [mod_proxy] basic support for HTTP CONNECT method (#2060) + [mod_deflate] fix deflate of file > 2MB w/o mmap + [core] fix segfault if tempdirs fill up (fixes #2843) + [mod_compress,mod_deflate] try mmap MAP_PRIVATE + [core] discard from socket using recv MSG_TRUNC + [core] report to stderr if errorlog path ENOENT (fixes #2847) + [core] fix base64 decode when char is unsigned (fixes #2848) + [mod_authn_ldap] fix mem leak when ldap auth fails (fixes #2849) + [core] warn if mod_indexfile after dynamic handler + [core] do not reparse request if async cb + [core] non-blocking write() to piped loggers + [mod_openssl] minor code cleanup; reduce var scope + [mod_openssl] elliptic curve auto selection (fixes #2833) + [core] check for path-info forward down path + [mod_authn_ldap] auth with ldap referrals (fixes #2846) + [core] code cleanup: separate physical path sub + [core] merge redirect/rewrite pattern substitution + [core] fix POST with chunked request body (fixes #2854) + [core] remove unused func + [doc] minor update to *outdated* doc + [mod_wstunnel] fix for frames larger than 64k (fixes #2858) + [core] fix 32-bit compile POST w/ chunked request body (#2854) + [core] add include sys/poll.h on Solaris (fixes #2859) + [core] fix path-info calculation in git master (fixes #2861) + [core] pass array_get_element_klen() const array * + [core] increase stat_cache abstraction + [core] open additional fds O_CLOEXEC + [core] fix CONNECT w strict header parsing enabled + [mod_extforward] CIDR support for trusted proxies (fixes #2860) + [core] re-enable overloaded backends w/ multi wkrs + [autoconf] reduce minimum automake version to 1.13 + [mod_auth] constant time compare plain passwords + [mod_auth] check that digest realm matches config + [core] fix incorrect hash algorithm impl + [doc] NEWS- Replace references to /var/adm/fillup-templates with new %_fillupdir macro (boo#1069468)- new upstream release 1.4.48 + requires automake 1.14 + new mod_authn_sasl module - remove autoreconf call; was required for mod_geoip patch, which is now upstream - add cyrus-sasl-devel, package mod_authn_sasl- update to 1.4.47 + [core] stricter validation of request-URI begin + [core] fix 1.4.46 regression in config match + [core] normalize config addrs for != match + [core] normalize config addrs for eq and ne + [core] fix 1.4.46 regression in Last-Modified- new upstream release 1.4.46 - drop lighttpd-1.4.x_out_of_bounds_read.patch (fixed upstream) - use systemd, drop init script - drop support for suse_version <= 1210 - add some new modules and packages - drop __DATE__/__TIME__ sed hack (usage disabled upstream by default)- use php7 for TW (boo#1058101)- added lighttpd-1.4.x_out_of_bounds_read.patch: fix out of bounds read in mod_scgi (debian#857255)- make lighttpd user own /var/log/lighttpd/ to be able to write logs there- fix some rpmlint messages + update FSF address for lighttpd.init + install example scripts without +x to avoid pulling shell dependencies + W:file-contains-current-date /usr/sbin/lighttpd is a false positive; it only happens when the last-source-modified date is the same as the build date + I: binary-or-shlib-calls-gethostbyname has been forwarded upstream- update to 1.4.45 + - next is 1.4.45 + [mod_cgi] skip local-redir handling if to self (fixes #2779, #2108) + [mod_webdav] fix crash when plugin_ctx cleaned up (fixes #2780) + [mod_fastcgi] detect child exit, restart proactively + [mod_scgi] detect child exit, restart proactively + [TLS] ssl.read-ahead = "disable" for low mem (fixes #2778) + [doc] NEWS + [tests] update test skip count for !fcgi-responder + [tests] FCGI_Finish() final request before exit + [tests] give time for periodic jobs to detect exit + [mod_cgi] check cgi fd for num bytes ready to read- lighttpd-1.4.13_geoip.patch is long gone; it was replaced with mod_geoip-for-1.4.39.patch but is now included upstream- update to 1.4.44 + - next is 1.4.44 + [mod_scgi] fix segfault (fixes #2762) + [mod_authn_gssapi] fix memory leak + [config] warn if mod_authn_ldap,mysql not listed + [mod_magnet] fix magnet_cgi_set() set of env vars (fixes #2763) + [mod_cgi] FreeBSD 9.3/MacOSX does not have pipe2() (fixes #2765) + [mod_extforward] fix crash on invalid IP (fixes #2766) + [mod_fastcgi] fix segfault if all backends down (fixes #2768) + [mod_cgi] fix out of sockets error for POST to CGI (fixes #2771) + [mod_auth] compile fix for Mac OS X XCode (fixes #2772) + [mod_authn_gssapi] better resource cleanup + [core] compile fix for Mac OS X 10.6 (old) (fixes #2773) + fix race in dynamic handler configs (reentrancy) (fixes #2774) + [mod_authn_mysql] close mysql_conn in cleanup + [mod_webdav] compile fix when locking not enabled + load mod_auth & mod_authn_file in sample/test.conf + comment out auth.backend.ldap.* in tests/*.conf + [mod_fastcgi,mod_scgi] warn if invalid "bin-path" + RAND_pseudo_bytes() is deprecated in openssl 1.1.0 + openssl 1.1.0 init and cleanup + [mod_cgi] remove direct calls to network_backend* + [build] build network_*.c into lighttpd executable + suggest inclusion of mod_geoip... before mod_ssi. + set systemd settings similar to lighttpd2 + [doc] remove reference to Linux rt-signals + [mod_authn_gssapi] fix missing error ret, coverity + [core] rename li_rand() to li_rand_pseudo_bytes() + remove #include "stream.h" where not used + [mod_cml] include lua headers before base.h + [core] combine duplicated connection reset code + [mod_ssi] produce content in subrequest hook + [core] remove srv->entropy[] + [core] defer li_rand_init() until first use + [core] permit connection-level state in modules + [mod_dirlisting] render dirlisting as HTML (fixes #2767) + [mod_proxy] replace HTTP Host sent to backend (fixes #2770) + [mod_ssi] basic recursive SSI include virtual (fixes #536) + [mod_ssi] implement, ignore + [core] consolidate duplicated read-to-close code + [core] fix segfault when parsing a bad config file + [core] support Transfer-Encoding: chunked req body (fixes #2156) + [autobuild] set NO_RDYNAMIC=yes for midipix + [mod_proxy] proxy.balance = "sticky" option (fixes #2117) + [mod_secdownload] warn if SHA used w/o SSL crypto + [build] compile fixes for AIX + [build] check for pipe2() at configure time + [mod_evhost] fix an incorrect error trace + [tests] mark tests/docroot/www/*.pl scripts a+x + [mod_proxy] proxy.replace-http-host enable/disable + [mod_cgi] fall back to pipe() if pipe2() fails + fix SCons fullstatic build with glibc pthreads + [TLS] openssl 1.1.0 makes SSL_OP_NO_SSLv2 no-op + [doc] NEWS- update to 1.4.43 + - next is 1.4.43 + [autobuild] remove mod_authn_gssapi dep on resolv + [mod_deflate] ignore '*' in deflate.mimetypes + minor: make packdist.sh more convenient for me + [autobuild] omit module stubs when missing deps + [autobuild] rm module stub code for missing deps + [TLS] openssl 1.1.0 hides struct bignum_st + [autobuild] move http_cgi_ssl_env() for Mac OS X (fixes #2757) + [core] use paccept() on NetBSD (replace accept4()) + [TLS] remote IP conditions are valid for TLS SNI (fixes #2272) + [doc] lighttpd-angel.8 (fixes #2254) + [cmake] build fcgi-auth, fcgi-responder for tests + [mod_accesslog] %{ratio}n logs compression ratio (fixes #2133) + [mod_deflate] skip deflate if loadavg too high (fixes #1505) + [mod_expire] expire by mimetype (fixes #423) + [mod_evhost] partial matching patterns (fixes #1194) + [mod_evhost] mod-evhost.t tests (#1194) + build: use CC_FOR_BUILD for lemon when cross-compiling + [lemon] standalone; remove #include "first.h" + [mod_dirlisting] config header and readme files + [config] warn if mod_authn_ldap,mysql not listed + fix FastCGI, SCGI, proxy reconnect on failure + [core] network_open_file_chunk() temp file opt + [mod_rewrite] add more info in error log msg + [core] fix fd leak when using libev (fixes #2761) + [core] fix potential streaming tempfile corruption (fixes #2760) + minor: coverity comments + [mod_scgi] fix prefix matching to always match url + move script to doc/scripts/ax_prog_cc_for_build.m4 + [autobuild] adjust Makefile.am for FreeBSD + [core] check fcntl O_APPEND succeeds w/ mkstemp() + [doc] NEWS + [autobuild] add lemon.c to src/Makefile.am + [autobuild] build fix for lemon.c + [autobuild] put ax_prog_cc_for_build.m4 in top directory + [scons] workaround FreeBSD11 fullstatic link error + [scons] only apply FreeBSD11 workaround on FreeBSD + [mod_cgi] FreeBSD 9.3 does not have pipe2() + [build] move some build scripts to scripts/ + [autotools] fix configure.ac for opensuse 13.2 + [build] fix warning for (potentially) unused func- package new modules - remove mod_geoip_for_1.4.40.patch- update to 1.4.42 + - next is 1.4.42 + [TLS] SSL_shutdown() only if handshake finished + [mod_proxy,mod_scgi] shutdown remote only if local (#2743) + [core] check if client half-closed TCP if POLLHUP (#2743) + [core] enforce wait for POLLWR after EINPROGRESS (fixes #2744) + [core] do not enter handler twice after read body + [core] proxy,scgi omit shutdown() to backend (fixes #2743) + [mod_dirlisting] dirlist does not handle POST + [mod_dirlisting] js column sort for dirlist table (fixes #613, fixes #2315) + [mod_auth] Digest auth fails after rewrite (fixes #2745) + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] refactor out auth backend code + [mod_auth] extensible interface for auth backends + [mod_auth] extensible interface for auth backends + [core] better DragonFlyBSD support (fixes #2746) + [mod_auth] include base.h for USE_OPENSSL def + [mod_auth] support CRYPT-MD5-NTLM algorithm (fixes #1743) + [mod_auth] terminate salt for CRYPT-MD5-NTLM + [core] fix crash if ready events on abandoned fd (fixes #2748) + fix mis-cast in unused code + [mod_auth] http_auth_md5_hex2bin() + [mod_auth] remove empty mod_auth.h + [mod_auth] mod_authn_mysql.c MySQL auth backend (fixes #752, fixes #1845) + [mod_cgi] permit CGI exec of unreadable files (fixes #2374) + [mod_uploadprogress] add to default build + [mod_geoip] add to default build (fixes #2705, fixes #2101, fixes #2092, fixes #2025, fixes #1962, fixes #1938) + [mod_fastcgi] Authorizer support with Responder (fixes #321, fixes #322) + [tests] test coverage for issues (#321, #322) + dynamic handlers store debug flag in handler_ctx + [mod_fastcgi] allow authorizer, responder for same path/ext (#321) + backport mod_deflate to lighttpd 1.4 (fixes #1824, fixes #2753) + [autobuild] test_configfile might need vector.c (fixes #2752) + remove unused sys-mmap.h from stat_cache.c + [mod_deflate] fix longjmp clobber compiler warning + remove unused array type TYPE_COUNT data_count + [mod_auth] structured data, register auth schemes + [mod_auth] mod_authn_gssapi Kerberos auth backend (fixes #1899) + silence warnings from clang ccc-analyzer + [autobuild] skip two new tests if no fcgi-auth + [SCons] define with_krb5 for SCons build + [SCons] fix syntax error in SConstruct + [SCons] define with_geoip for SCons build + [CMake] fix clang -Wcast-align warnings in lemon.c + remove excess initializers (fix compiler warnings) + fix errors detected by Coverity Scan + performance: use Linux extended syscalls and flags + [mod_scgi] add uwsgi protocol support + [mod_auth] refactor LDAP code into smaller funcs + [mod_auth] HTTP Basic auth backends also do authz (#1817) + [mod_auth] ldap filter subst user for multiple '$' (fixes #1508) + [mod_auth] permit specifying ldap DN; skip search (fixes #1248) + [autobuild] update module/feature report + [cmake] build mod_authn_gssapi if WITH_KRB5 + DragonFlyBSD defines __DragonFly__ (#2746) + [mod_auth] fix printing of IP in error trace + quiet coverity warning + [mod_mysql_vhost] support multiple '?' replacement (fixes #2163) + [core] make server.max-request-size scopeable (#1901) + [core] server.max-request-field-size (fixes #2130) + [core] optional condition in config "else" clause (fixes #1268) + [core] restrict where config "else" clauses occur (#1268) + silence warnings from clang ccc-analyzer + consistent, shared code to create CGI env + [TLS] replace env entries in https_add_ssl_entries + [TLS] set SSL_CLIENT_M_SERIAL w/ client cert SN (fixes #2268) + [TLS] set SSL_CLIENT_VERIFY w/ client cert (#1288, #2693) + [TLS] set SSL_PROTOCOL, SSL_CIPHER* (fixes #2511) + [core] rand.[ch] to use better RNGs when available + [mod_cgi] fix pipe_cloexec() when no O_CLOEXEC + ignore return value from fcntl() FD_CLOEXEC + silence warnings from clang ccc-analyzer + fix SCons build + build w/o compiler warnings if no zlib or bz2lib + parallelize dist package build (packdist.sh) + [doc] NEWS + quiet coverity warning + add random() to list of rand() fallbacks- update to 1.4.41 + - next is 1.4.41 + remove long-deprecated, non-functional config opts + [config] inherit server.use-ipv6 and server.set-v6only (fixes #678) + [build] allow AUTHOR, KEYID overrides to packdist + [mod_auth] fix Digest auth to be better than Basic (fixes #1844) + [doc] update memcache references to memcached + [mod_ssi] fix #config sizefmt="bytes" + fix some warnings reported by cppcheck + workaround clang compiler warning + [autobuild] move inet_pton detection later + [core] #include for FIONREAD (fixes #2726) + [autobuild] clock_gettime() -lrt with glibc < 2.17 + minor: spelling changes in some comments/messages + [security] do not emit HTTP_PROXY to CGI env + [build_cmake] clock_gettime() -lrt w/ glibc < 2.17 (fixes #2737) + [core] avoid spurious trace and error abort + [core] stay in CON_STATE_CLOSE until done with req + [core] $HTTP["remoteip"] must handle IPv6 w/o [] + [mod_status] show keep-alive status w/ text output (fixes #2740) + do not set REDIRECT_URI in mod_magnet, mod_rewrite (#2738) + revert 1.4.40 swap of REQUEST_URI, REDIRECT_URI (fixes #2738) + [core] permit IPv6 address scope identifier + [core] consolidate duplicated response_end code + [TLS] better handling of SSL_ERROR_WANT_READ/WRITE + [TLS] read all available records from SSL_read() + [core] try AF_INET after AF_INET6 if use-ipv6 + [core] fix result copy from getaddrinfo() + [core] set chunkqueue tempdirs at startup + [core] check if EAI_ADDRFAMILY is defined + [core] set chunkqueue tempdirs at startup /var/tmp + [security] ensure gid != 0 if server.username set (fixes #2725) + [security] disable stat_cache if !follow-symlink (fixes #2724) + [core] fix buffer_copy_string_hex() assert (fixes #2742) + fix buffer.c comments to match encoded_chars_* + [security] encode quoting chars in HTML and XML + [cmake] always define _GNU_SOURCE + [cmake] enable warnings for GCC and Clang + [cmake] set cmake_minimum_required to 2.8.2 + [doc] NEWS- update to 1.4.40 + - next is 1.4.40 + [mod_ssi] enhance support for ssi vars + add handling for lua 5.2 and 5.3 (fixes #2674) + use libmemcached instead of deprecated libmemcache + add force_assert for more allocation results + cleanup dead keyvalue code + [autobuild] fix lua configure error handling + [mod_cgi] use MAP_PRIVATE to mmap temporary file instead of MAP_SHARED (fixes #2715) + [core] do not send SIGHUP to process group unless server.max-workers is used (fixes #2711) + [mod_cgi] edge case chdir "/" when docroot "/" (fixes #2460) + fix links to online docs in template config files + [mod_cgi] issue trace and exit if execve() fails (closes #2302) + [configparser] don't continue after parse error (fixes #2717) + [core] never evaluate else branches until the previous branches are aready (fixes #2598) + [core] fix conditional cache handling + [core] improve conditional enabling (thx Gwenlliana, #2598) + [buffer] use explicit integer promotion to make the code more readable + [config] extend duplicate-array-key error (fixes #2704) + [mod_compress] case-insensitive content-codings (fixes #2645) + [plugins] don't include dlfcn.h if not needed (fixes #2548) + [mod_fastcgi] 404 for X-Sendfile file not found (fixes #2474) + [mod_cgi] send 500 if CGI ends and there is no response (fixes #2542) + [mod_cgi] consolidate CGI cleanup code + [mod_cgi] simplify mod_cgi_handle_subrequest() + [mod_cgi] kill CGI if fail to write request body + [mod_proxy] use case-insensitive comparision to filter headers, send Connection: Close to backend (fixes #421) + [mod_dirlisting] dir-listing.hide-dotfiles = "enabled" by default (fixes #1081) + [mod_rewrite] fix return type of process_rewrite_rules + [mod_secdownload] fix buffer overflow in secdl_verify_mac (reported by Fortify Open Review Project) + [mod_fastcgi,mod_scgi] fix leaking file-descriptor when backend spawning failed (reported by Fortify Open Review Project) + [core] improve array API to prevent theoretical memory leaks + [core] rename variable in array.c + [core] refactor array search; raise array size limit to SSIZE_MAX + [core] fix memory leak in configparser_merge_data + [core] provide array_extract_element and use it + [core] configparser: error on duplicate keys in array merge (fixes #2685) + [core] more careful parse of $SERVER["socket"] config str (prepare #2204) + [core] accept $SERVER["socket"] without port, use server.port as fallback (fixes #2204) + [mod_magnet] define lua_pushglobaltable (for lua5.1) and use it (fixes #2719) + [ssl] support disabling ssl.verifyclient.activate in SNI callback (fixes #2531) + restart (some) syscalls after SIGCHLD interrupted them; should fix LDAP problems (fixes #2464) + [core] log remote address on request timeouts (fixes #652) + [autobuild] use AC_CANONICAL_HOST instead of AC_CANONICAL_TARGET (fixes #1866) + [core] fix request_start in keep-alive requests to mark time when received first byte (fixes #2412) + [core] truncate pidfile on exit (fixes #2695) + consistent inclusion of config.h at top of files (fixes #2073) + [autobuild] include first.h in make dist + [core] add generic vector implementation + [core] replace array weakref with vector + [base64] fix crash due to broken force_assert + [unittests] add test_buffer and test_base64 unit tests + [base64] fix another crash due to broken force_assert conditions + [buffer] refactor buffer_path_simplify (fixes #2560) + [http_auth/mod_fastcgi] check get_http_*_name() for NULL return (#2583) + validate return values from strtol, strtoul (fixes #2564) + add NEWS entry for previous commit + [mod_ssi] Add SSI vars SCRIPT_{URI,URL} and REQUEST_SCHEME (fixes #2721) + [config] warn if server.upload-dirs has non-existent dirs (fixes #2508) + [mod_proxy] accept LF delimited headers, not just CRLF (fixes #2594) + [core] wait for grandchild to be ready when daemonizing (fixes #2712, thx pasdVn) + [core] respond 411 Length Required if request has Transfer-Encoding: chunked (fixes #631) + [core] fixed the loading for default modules if they are specified explicitly + [core] lighttpd -tt performs preflight startup checks (fixes #411) + [stat] mimetype.xattr-name global config option (fixes #2631) + [configparser] fix small leak on config failure + [mod_webdav] allow Depth: Infinity lock on file (fixes #2296) + [mod_status] use snprintf() instead of sprintf() + pass buf size to li_tohex() + use li_[iu]tostrn() instead of li_[iu]tostr() + [stream] fstat() after open() to obtain file size + [core] clean up srv before exiting for lighttpd -[vVh] + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (fixes #319) + [mod_cgi] always set QUERY_STRING (fixes #1339) + [mod_auth] send charset="UTF-8" in WWW-Authenticate (fixes #1468) + [mod_magnet] rename var for clarity (fixes #1483) + [mod_extforward] reset cond_cache for scheme (fixes #1499) + [mod_webdav] readdir POSIX compat (fixes #1826) + [mod_expire] reset caching response headers for error docs (fixes #1919) + [mod_status] page refresh option (fixes #2170) + [mod_status] table w/ count of con states (fixes #2427) + [mod_dirlisting] class for dir (fixes #2304) + skip spawning backends for preflight tests (#2642) + [core] define __STDC_WANT_LIB_EXT1__ (fixes #2722) + [core] setrlimit max-fds <= rlim_max for non-root (fixes #2723) + [mod_ssi] config ssi.conditional-requests + [mod_ssi] config ssi.exec (fixes #2051) + [mod_redirect,mod-rewrite] short-circuit if blank replacement (fixes #2085) + [mod_indexfile] save physical path to env (fixes #448, #892) + [core] open fd when appending file to cq (fixes #2655) + [config] server.listen-backlog option (fixes #1825, #2116) + [core] retry tempdirs on partial write, ENOSPC (fixes #2588) + untangle overly complex control flow logic + defer reading request body until handle subrequest (fixes #2541) + mv funcs from connections.c to connections-glue.c + defer reading request body until handle subrequest + always poll for client POLLHUP/POLLERR events (fixes #399) + remove handle_joblist hook + handlers can read response before sending req body (fixes #131, #2566) + [mod_cgi] asynchronous send of request body to CGI + improve dynamic handler control flow logic + [doc] add mimetype.use-xattr to conf.d/mime.conf + [doc] enhance error msg for backend server config + [doc] add ref to RFC 7232 for conditional requests + make (compile and link) cleanly under cygwin + [core] compile with upcoming openssl 1.1.0 release (fixes #2727) + fix some warnings reported by static analysis tool + [core] set REDIRECT_STATUS to error_handler_saved_status (fixes #1828) + remove unused con->error_handler member + [core] server.error-handler new directive for error pages (fixes #2702) + set REDIRECT_URI in mod_rewrite, mod_magnet + [doc] add server.error-handler + server.error-handler new directive for error pages + [core] support IPv6 in $HTTP["remote-ip"] CIDR cond match (fixes #2706) + [doc] NEWS + [core] http_response_send_file() shared code (#2017) + [mod_fastcgi] use http_response_xsendfile() (fixes #799, fixes #851, fixes #2017, fixes #2076) + [mod_scgi] X-Sendfile feature (fixes #2253) + [mod_cgi] X-Sendfile feature (fixes #2313) + [mod_cgi,mod_fastcgi,mod_scgi] X-Sendfile features + [mod_webdav] lseek,read if fs can not mmap (#2666, fixes #962) + [mod_compress] use mmap and trap SIGBUS (#2666, fixes #1879) + fallback to lseek()/read() if mmap() fails (#fixes 2666) + [mod_auth] skip blank lines and comment lines (fixes #2327) + [core] fallback to write if sendfile not supported (fixes #471, #987) + minor: add missing #include + [core] preserve PATH_INFO case on case-insensitive fs (fixes #406) + [doc] add mimetype.use-xattr to create-mime.conf.pl + [doc] NEWS + [mod_ssi, mod_cml] set DOCUMENT_ROOT to basedir (fixes #2383) + [core] cmd line opt to shutdown after idle time limit (fixes #2696) + [network] separate addr trans from socket creation + [core] lighttpd -1 handles single request on stdin socket (fixes #1584) + lighttpd run modes for idle timeout, one-shot + [mod_fastcgi,mod_scgi] IPv6 support (fixes #2372) + [mod_status] add JSON output option (fixed #2432) + [mod_webdav] map COPY/MOVE Destination to aliases (fixes #1787) + [mod_webdav] improve PROPFIND,PROPPATCH (#1818, #1953) + [mod_webdav] improve PROPFIND,PROPPATCH; map COPY/MOVE Destination + [doc] NEWS + reset response headers, write_queue for error docs + fix typo in new cgi.x-sendfile directives + clean up oneshot_fd resource upon startup error + minor: fix compiler warning for extra ';' + build with libressl + [core] fix IPv6 address + port parsing (#2204) + static build instructions using SCons or make + [core] fix config merge of array lists + [core] simplify config merge of array lists + [core] add default modules while processing server config + [mod_auth] preserve WWW-Authenticate for error docs (fixes #2730) + check close() return code after writing to file + [doc] NEWS + adjustments for openssl 1.1.0 pre-release + [config] support include file glob (fixes #1221) + [mod_evasive] 302 redirect option if limit reached (fixes #2199) + [build] enhancements for cross-compiling (fixes #2276) + [mod_accesslog] report aborted con state with %X (fixes #1890) + [mod_ssi] fix SSI statement parser + [mod_ssi] include relative to alias,userdir (fixes #222) + [mod_ssi] add PCRE_* options to constrain regex + [mod_ssi] more flexible quoting (fixes #1768) + [core] wrap IPv6 literal in "[]" in redirect URL + [mod_ssi] fix parse of tag across buf boundary (fixes #2732) + [mod_cgi,mod_scgi] X-Sendfile sets file_started (fixes #2733) + [mod_fastcgi] no chunked response w/ X-Sendfile (fixes #2733) + [config] opts for http header parsing strictness (fixes #551, fixes #1086, fixes #1184, fixes #2143, #2258, #2281, fixes #946, fixes #1330, fixes #602, #1016) + [config] normalize IP strings in lighttpd.conf + [build_cmake] use MODULE on Mac OS X (fixes #1761) + minor: quiet some compiler warnings + use buffer_string_set_length() to truncate strings + use buffer_string_set_length() to truncate strings + [config] server.bsd-accept-filter option + [mod_webdav] create file w/ LOCK request if ENOENT + [doc] NEWS + [mod_webdav] getetag and lockdiscovery live props + [mod_webdav] create file w/ LOCK request if ENOENT + [core] buffer large responses to tempfiles (fixes #758, fixes #760, fixes #933, fixes #1387, #1283, fixes #2083) + [core] stream response to client (#949) + [TLS] release openssl buffers as used (fixes #1265, fixes #1283, #881) + [config] config options to stream request/response (#949, #376) + [core] option to stream request body to backend (fixes #376) + separate routines for reading output from backends + [core] option to stream response body to client (fixes #949, #760, #1283, #1387) + drain backend socket/pipe bufs upon FDEVENT_HUP + http_response_backend_error() + remove excess calls to joblist_append() + defer choosing "Transfer-Encoding: chunked" + asynchronous, bidirectional streaming options + fix errors detected by Coverity Scan + [build] update Makefile.am EXTRA_DIST w/ new files + chunkqueue_append_chunkqueue() + fix errors detected by Coverity Scan + [cygwin] fix mod_proxy and mod_fastcgi ioctl use + use con->conf.server_tag in modules + [mod_webdav] remove excess SQL param to UNLOCK + [doc] NEWS + graceful shutdown without unnecessary 1 sec delay + fix error handling for portability (NetBSD) + [core] disable Nagle algorithm (TCP_NODELAY) + [core] add declarations to fdevent.h (#2373) + [build] add $(ATTR_LIB) to liblightcomp_la_LIBADD + [cygwin] minor: fix compiler warning + [tests] remove dependency on CGI.pm + [core] fix s6_addr type-punned compiler warning + [TLS] fix return value checks during cert init + [core] fix server.max-request-size to be precise (fixes #2131) + [mod_webdav] fix proppatch mem leak, other fixes (#fixes 1334, #fixes 2000) + [autobuild] CMake check for struct tm tm_gmtoff (fixes #2014) + [core] remove assert in fdevent_unregister() + [mod_uploadprogress] fix mem leak (#1858) + [core] make server.max-request-size scopeable (fixes #1901) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + [mod_fastcgi,mod_scgi] check for spawning on same unix socket (#319) + fix gcc 6.1.1 compiler warn misleading-indentation + [mod_accesslog] %a %A %C %D %k %{}t %{}T (fixes #1145, fixes #1415, fixes #2081) + [mod_access] new directive url.access-allow (fixes #1421) + [core] fdevent_libev: update use of ev_timer + [core] fdevent_libev: workaround compiler warning + [tests] remove some tests duplicated in mod-cgi.t + [mod_cgi] handle local redirect response (fixes #2108) + update lighttpd -h + [doc] add self to AUTHORS (discussed w/ stbuehler) + [doc] NEWS- update to 1.4.39 + -next is 1.4.38 + fix packdist.sh output links + [stat-cache] fix handling of collisions, might have returned wrong data (fixes #2669) + [core] allocate at least 4k buffer for incoming data + [core] fix search for header end if split across chunks (fixes #2670) + [core] check configparserAlloc() result with force_assert + [mod_auth] implement and use safe_memclear, using memset_s or explicit_bzero if available + [core] don't buffer request bodies smaller than 64k on disk + add force_assert for many allocations and function results + [mod_secdownload] use a hopefully constant time comparison to check hash (fixes #2679) + [config] check config option scope; warn if server option is given in conditional + [core] revert increase of temp file size back to 1MB, provide a configure option "server.upload-temp-file-size" instead (fixes #2680) + [core] add '~' to safe characters in ENCODING_REL_URI/ENCODING_REL_URI_PART encoding + [core] encode path with ENCODING_REL_URI in redirect to directory (fixes #2661, thx gstrauss) + [core] refactor base64 functions into separate file + [mod_secdownload] add required algorithm option; old behaviour available as "md5", new options "hmac-sha1" and "hmac-sha256" + [autobuild] fix missing header in tar ball + mod-auth.t: no crypt md5 for darwin + [tests] test apr-md5 in mod-auth.t + [tests] do not half-close socket before having received the response (fixes #2688) + [mod_fastcgi/mod_scgi] zero sockaddr structs before use (fixes #2691) + [network] add darwin-sendfile backend (fixes #2687) + [core] show correct crypt support result (fixes #2690) + - next ist 1.4.39 + [core] fix memset_s call (fixes #2698) + [chunk] fix use after free / double free (fixes #2700) + [scons] fix fullstatic build- Add perl(CGI) BuildRequires in order to be able to pass the test suite.- update to 1.4.37 + - next is 1.4.37 + [mod_proxy] remove debug log line from error log (fixes #2659) + [mod_dirlisting] fix dir-listing.set-footer not showing + fix out-of-filedescriptors when uploading "large" files (fixes #2660, thx rmilecki) + increase upload temporary chunk file size from 1MB to 16MB + fix undefined integer shift + rewrite network (write) backends + [cmake] lowercase commands, whitespace cleanup, remove clutter in else(...), endif(...), endforeach(...) + [cmake] cleanup cache variables if features get deactivated + fix some unchecked return value warnings + maintain cq->bytes_in in chunk API; keep bytes_out/bytes_in synced + [cmake] don't put date into config.h (not used anyway), only unset local vars for disabled features instead of clearing cache + [cmake] fix FreeBSD linker bug + [tests] search for perl in PATH instead of /usr/bin; whitespace + test config cleanups + [kqueue] fix kevent call + [tests] fix warning about newline in filename + [autoconf] define HAVE_CRYPT when crypt() is present + [bsd xattr] fix compile break with BSD extended attributes in stat_cache + [mod_dirlisting] remove sys/syslimits.h; base.h already includes limits.h + small README for FreeBSD build setup + [build] put --as-needed into linker flags instead of cflags + [mod_cgi] rewrite mmap and generic (post body) send error handling + [mmap] fix mmap alignment + [plugins] when modules are linked statically still only load the modules given in the config + [scons] various improvements + [mmap] handle SIGBUS in network; those get triggered if the file gets smaller during reading + [scons] fix crypt() detection, other improvements + [scons] fix build + fix some warnings found by coverity ("leak" in setup phase, not catching too long unix socket paths in mod_proxy) + packdist.sh: use fakeroot for make dist to have root owned files in tar- do not use the full url as we are reusing the debian tarball.- update to 1.4.36 + [configfile] fix reading uninitialized variable (found by Willian B.) + [dist] add dist-xz, remove dist-bzip2, allow ~rc appendix in packdist.sh- update to 1.4.36~rc1 + - next is 1.4.36 + use keep-alive timeout while waiting for HTTP headers; use always the read timeout while waiting for the HTTP body + fix bad shift in conditional netmask ".../0" handling + add more mime types and a script to generate mime.conf (fxies #2579) + fix typo in NEWS entry for #2579 + add support for (Free)BSD extended attributes + [build] use fortify flags with "extra-warnings" + [mod_dirlisting,mod_redirect,mod_rewrite] abort config parsing if pcre-compile fails or isn't available + [ssl] disable SSL3.0 by default + Fixed typo found by openSUSE user (boo# 907709) + add NEWS entry for previous commit + [network] fix compile break in calculation of sockaddr_un size if SUN_LEN is not defined (fixes #2609) + [connections] fix bug in connection state handling + print backtrace in assert logging with libunwind + fix buffer, chunk and http_chunk API + Remove chunkqueue_get_{append,prepend}* API + Remove buffer_prepare_copy() and buffer_prepare_append() + [tests] improve valgrind and strace TRACEME, disable condition logging in normal configs + Use buffer API to read and modify "used" member + rename buffer_append_long_hex to buffer_append_uint_hex + [buffer] constify some parameters + [bitset] unused -> remove + remove unused stuff from server.h + [crc32] fix method signature (const pointer) + [tests] fix undefined index warning in sendfile.php + [mod_auth] use crypt_r instead of crypt if available + fix error message for T_CONFIG_ARRAY config values if an entry value is not a string + fix segfaults in many plugins if they failed configuration + escape all strings for logging (fixes #2646 log file injection, reported by Jaanus Kääp) + add some until now missing files to dist tarball + minor spelling fixes + fix hex escape in accesslog (fixes #2559) + show extforward re-run warning only with debug.log-request-handling (fixes #2561) + parse If-None-Match for ETag validation (fixes #2578) + check pointer before usage in new etag compare + fix memory leak in mod_status when no counters are set (found by coverity) + #ifdef all parts belonging to the connection-state debugging + [mod_magnet] fix segfault when accessing not existing lighty.req_env[] entry (found by coverity) + fix segfault when temp file for upload couldn't be created (found by coverity) + check fcgi_env_add return value (found by coverity) + mime.conf: add some new mime types, remove .dat, .sha1, .md5, update .vcf + [mod_proxy] add unix domain socket support (fixes #2653)- define and use pkg_name, pkg_version, tarball_version - use debian orig tarball - fix download url- Deb .orig.tar.bz2 -> regular tar, hopefully it shall work.- Spec-cleanify and remove sle9 support fun - Fix rpmlint warnings - Use tarball fetchable from upstream - Remove all obsolete conditions- Remove the debian changelog also from the .spec file SOURCES- Remove debian changelog as it collides with factory checkers- fix bashisms in pre script/bin/sh/bin/sh/bin/sh/bin/shobs-power8-02 1585643313  !"#$%&'()*+,-./0123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk1.4.55-bp151.4.6.11.4.55-bp151.4.6.11.4.55-bp151.4.6.1 lighttpdconf.daccess_log.confauth.confcgi.confcompress.confdebug.confdirlisting.confevhost.confexpire.conffastcgi.confmime.confmod.templateproxy.confscgi.confsecdownload.confsimple_vhost.confssi.confstatus.confuserdir.conflighttpd.confmodules.confvhosts.dvhosts.templatelighttpdlighttpdlighttpd-ssllighttpd.servicelighttpdmod_access.somod_accesslog.somod_alias.somod_auth.somod_authn_file.somod_cgi.somod_compress.somod_deflate.somod_dirlisting.somod_evasive.somod_evhost.somod_expire.somod_extforward.somod_fastcgi.somod_flv_streaming.somod_indexfile.somod_openssl.somod_proxy.somod_redirect.somod_rewrite.somod_scgi.somod_secdownload.somod_setenv.somod_simple_vhost.somod_sockproxy.somod_ssi.somod_staticfile.somod_status.somod_uploadprogress.somod_userdir.somod_usertrack.somod_vhostdb.somod_wstunnel.solighttpdlighttpd-angelrclighttpdlighttpdAUTHORSNEWSREADMEaccess.txtaccesslog.txtalias.txtauthentication.txtcgi.txtcompress.txtconfiguration.txtexpire.txtfastcgi-state.txtfastcgi.txtfeatures.txtperformance.txtplugins.txtproxy.txtredirect.txtrewrite.txtscgi.txtsecdownload.txtsecurity.txtsetenv.txtsimple-vhost.txtskeleton.txtspawn-php.shssi.txtssl.txtstate.txtstatus.txttraffic-shaping.txtuserdir.txtsysconfig.lighttpdlighttpd-angel.8.gzlighttpd.8.gzlighttpdcompresslighttpdsocketslighttpd/etc//etc/lighttpd//etc/lighttpd/conf.d//etc/lighttpd/vhosts.d//etc/logrotate.d//etc/sysconfig/SuSEfirewall2.d/services//usr/lib/systemd/system//usr/lib64//usr/lib64/lighttpd//usr/sbin//usr/share/doc/packages//usr/share/doc/packages/lighttpd//usr/share/fillup-templates//usr/share/man/man8//var/cache//var/cache/lighttpd//var/lib//var/lib/lighttpd//var/log/-fmessage-length=0 -grecord-gcc-switches -O2 -Wall -D_FORTIFY_SOURCE=2 -fstack-protector-strong -funwind-tables -fasynchronous-unwind-tables -fstack-clash-protectionobs://build.opensuse.org/openSUSE:Maintenance:12219/openSUSE_Backports_SLE-15-SP1_Update/ce75ac59626a8db83bbf99ea019e86c1-lighttpd.openSUSE_Backports_SLE-15-SP1_Updatedrpmxz5ppc64le-suse-linux  !"#$%&''()*++directoryASCII textC source, ASCII textELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=a73862d7c2c7c2cb91652eeacadc82c1c3437689, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=ee180176d81315e4c16aa59e25210cc23e383d42, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=be26fa465793b5d7f772f108c203af93acb0fc2d, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=1263df80ed7053e29bb08011b9e1ed8031a292e8, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=edf4edb4b4cc40ca1b80aee9ab32daf36c8ae0f6, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=79fa1790642321b66e498806d5ca7e4b7a7ea776, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=d04818c31fe47478eb1f254a1fd1c8c3aa4efbd1, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=1fbee012667cb29ee39ad9f65d17301cc177ed5c, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=c56fc4478d3bd4ac4ea5981fde84396d8225a6f7, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=7ba68f7fa6b6b803feb2d04f63b73018e7712d3f, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=948caa883feaae56134b59c9b3a62e4d128bfdaa, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=01ac505b5b6ab8c1da47f87232e9323c1a55851c, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=0b547a74eefa2cd27ef8a38d04b8d357a3edf0ba, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=6e10d46ba690c2b4cd80e2b4775e8655ed425429, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=5bfe2d2cc48b14d6195d2330f02d6d5cab7b3531, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=b1817a6353f58b601f3e977d2048097e901cc699, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=e6d36a8c56c61e91bc70baf7ae77168131860aa9, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=7d88ef41939b535505a6dbc751c37b520e1d92dc, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=3c17be267c99fb87acb9bd3b98d5b763fe21a1f8, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=52a85423afbe5f4044c92f22a147f66b6884f105, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=e708fbe307bef672f5b47b8fabace18ee327065f, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=086c010a1c17c106639274ae0490dc9adf13eb46, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=9153a96363996111f71db427c12ddc49d2783094, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=26e572b103530c22ebbf02c14885b238f58757f9, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=ded94a5493cf7c53a2dc51ac491300897cea27b7, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=2e180dbda8152b51a7e1f484834509db47998a45, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=37cf2f9b266d466f53b30731c1d83b829012133e, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=68a9544ce8add88d97af67783953ee782ca38f57, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=b65f64667acf8899eddb79b194f594c08b16356a, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=5cdfcf5a14a77fa3cffb8da88f119dfcf86a26db, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=f0443b41259afa5f4d3b3150e9144ffdbba95da4, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=eb778cac1c4b6fe1024e7af47b31ec88cacd0df7, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, BuildID[sha1]=835cc66b93da0d1edd26622c400ae1e1d5608caa, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/l, BuildID[sha1]=75c3becf12276c6802c4db88ce741a0d2b143c18, for GNU/Linux 3.10.0, not strippedELF 64-bit LSB shared object, 64-bit PowerPC or cisco 7500, version 1 (SYSV), dynamically linked, interpreter /lib64/l, BuildID[sha1]=dc5d68fee48ee67ff51b3cfc56a2bc1ab7420179, for GNU/Linux 3.10.0, not strippedUTF-8 Unicode textHTML document, ASCII textBourne-Again shell script, ASCII text executableexported SGML document, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, max compression, from Unix) !#%')+13579=?ACEGIKMOQUa R R R R R R RR RR RR RRRR R R R RR R R RR R R RR R R R R R R R R R R R R R R R RRRRR R R R R R R R R RR RR R R R R R R R R R R R R R R R R R R R R RR RR R RRRR RRR RRRR R R 1$'NvO+Jlighttpd-mod_openssllogrotate1.4.55utf-8d0abe2b6a82bf18dc539f6a99a22ce5b7bd6d3cdb9b261d185e18cb66d056de8?p7zXZ !t/]"k%{U}g桙Ⲹ9+ځm#ȴIcvA GTjUM,[c{w.ʽ팉.PX//۪kSsemN /0CV_oc;`ȑG ,]nl^`x[9'j* ;~?f}2"86dmS=Gtrz5lRz*4tw>`~`9ôdꤦAC,>D6ɽڧydCbz#4]w߃LCe #<s!I; > Z2w׵eL&+~Vo*)fqC@Yۨ_He&XIhC m'Ԝ /+Jq9Y>\Z+YfPޏ|̼7wIUm f&xlZKeAi9p@D-w"_8iZb2X+G;JΡ.5XAӯ0{v՚?񘙹i J9pe' kڢ&UmdsDwX*GC%\UyWP(lB{k]9=,,;* R^OWHl[ 5rO"?6aYxɘoo’h?+_jVgpCIB\s2Ԭ7կVUr7X&><)c2$@(:@cAWdڴ^"~pD(9^r}4J5t"{_'l`04ĺE]g~r[Gݪ!GU6{8۪߷#_NX;K}hݮ)ODn=MΞX%c X *Qٓݭ3~ >$Qrm@e7Z:tL]ю=tI@3Rೋ*q{Y ![۟/r0{Nx$.x4 vC{q[ Qߥ{%߿J'Nݏ__|XlT*V+MZ/^EџRg]byb$^C q#EJ-Ҹ-$rfy녕5!k1[s-L`ecU#X޸{C_}"FEZX]Lylz/"$jQqg}JC7+ڴ=쇶g@Gݨ߭Dǿm||Cg&ψ/ =:?$cUk5#.+)T?47F+yVJJ:z 5P]oya]zC[/9FL~ۂwkw55 Ύ#p`4kW{7m?5NUA ӾJ،GTBA#4o--W_;[m?5灱Cy&eD5y:CWU+yo; l56KGA-g+Lφ` pwo@Q)M$ns@49]شN`/b"6)_Dmլ:!-5uЭ4c璱ՂKZŰ IBgh-hT, WR87BK![m{gMSźPxYupJ a̍6-򯾪Wؠ'e}G9L;w8vLZun=ޣtw}j2)gs$$cO<8Eɰ|ʙ7Y>P9@(uSOoT>Q [tR'XLO:fݒ^\DHIثGvE%>׬8fnjB2.ƿ!a.ぷa+ -!e=I\C| &sDViղrPFq6<\P$#f?ݖ¼ZkgJ<S'Y[ H.&v,h6=pn`+k/4T@[Bil- eD"'efm>̝eb++i*JԻB(wK0JQ@,g=j-dR}ۢˎNJ+cq(!ݯLIC?]%FQ4]D$-;iJ8NM174`*|~y"0l2*dɬd^N>Z#`e̥$8^l#?r<(c@qr ($dۜkpd#7t"wOD6?EjNs>9`Cm "o5َ(+"M @die=|](zv2UN. ҚY0Ӕ^rvbFw Z$DE~Ί-#nqXwBrot љ﯂s8&PfoF_J-\ܛ(vMC L v'@A[T}&v^*LP~L."H)O/x<ygKFOb g)M .&u}>73_S=9vgC].YNHqymXvy3wC$9ƇŽС;b(/q=JYj)r~C; Bg9̻% SeՋQU"5c#/Ϻ QĽq?l@] @?K<=x]Ou0(“XcMlKݱ*N=;`6HjmԨ 8K6D\dhZ֍q{Ĉ_(J>WL0j)8RJ&y$U_c(-e'0NzVL>bzN_/Rq r"g^P~a2nu^gBƌbۦSZهt 0_c¼WkE2'ʋ GGkXGa<8WNG@%3 6W3ga(gf cf$9rM8D+FꗄDVQYErtD'J{ K˔/5m%Ω`;z (0|5cPʏzrpMǔyZ 'O;YsRNlD^İi< GJ///_Sp Xn0*%< 5F0c+^BF %" WaHu-x|,w;|=?R/ǩAM > 7IѹlqZI"D:xbԉ1i>;Ob$sVQsc7O>$Wy,>t6UtQ=j$viyHO!МK e{U,moE=A00 ot@$VD֩$wSfZtJL9{!gj+UMd2Bs8Zg z U`4՝ap ݴASp'+Ɠvw8M&jN$W9Ti&8fP 6 8ST֓h4D!g&Je峷^)Ȼd)^F^Kda)Ԝȍt^jZ t"U"-5l@nt!GA5K+LF8qR`b,4Up+0^K 54~#&"㲟63}GXA=X;zfRoVwj FrK67 ]\F wAU_rԑu2fwrVqKVA%hӍceB>AH>l k_Z,Tl0iOV^2l;BaԖB͞(42CE =ݝJ쁝$2ݡ4s;Si5[2]îWCmv|76]^/ KE6xWQJʾ\|,A]6"˅hk:\TAfo)kzTO_&+&S>7cSșK5YGYUqGrvT iɟرӦDyҎ@|;T+ڐ1W"vFڱE1#k_3 ^Rec!W^A|qEm<N0:|m.!3 9ա]1w #bwE>E7Mys|p 0HyywbEJ6ʏ!jޛ,QٱCvP-7ZX2Ԉ2ëM,_ʾY r]oSKBR-p_+DxЫ$igN+~XdI9g}_gxx[4p?~ewWfc3n׬޾qy7/X?oYڅIK V E}NlǮ,3%3]~487`EAeAW%(s'_Ǻ` בk!5:TYCsͅ3g]"7^lfrzMLp!1S/#3ݓ?!& sUpLj<$~kנPitxi>ّz`H=ũ$BwZRG]D(&9Dԣd/Rq^>À9܅7V|-ikVU|X sbЈ0YnW$c lzI:C?K@2JOϥVhm`U2q%b!#K;p>&]/D0 P,5c,ZgL%ݪUJfNȬxaYeS=ҕvkHŞ6 ƪbq u.xA?50[Srw8miS$܅Dݼ^).~TB_~s%`jx"{-Vf-wB$5^ϊ..Qd9Ia&, sn6K Omժ\c>#'<8YW~Gxmys$f<%]A ~`5ޗc/DtPfL)=[=*}('06fAlݝſoԕ!?Jq5 ?1N;?%y7椳fdG{F1" J"fJQӻz6t" _uEH¯ C c\ģJIF:}KI|tso$9#ecp*Ah޼ܻ^w ڗ{|[V ~04ep%)uFV#ƾ.W_8EѣTK-) 02  c^LCSY0tD6;حe\yaeb3 VIsr)ӳp e=vSr-oa%ٮMkNb#:AD4. LL+HSu#OwРohs>EYRuaЊ(V<jV>Џ[5 y}w#P"Q˩=Q5L/p޲f3W'i$q \(0crLtUU>~1ňô3p|wXӭ3wN4+ JXmP80ի x@M^~ ue<.-ҿ荁bGb˫AIK '`x 4hUN(>kE>ϖhWȒ-<8;NM?ǡ(+z/MQrMz?7yCu˸֤ PEUŬpP+c@3_FC\.ڜgfj|ru9KQP1Sy18 3|/ֳܼkJ覌5ۅJC?C*vySCOW?k+`oyθ/7Hx5dIwr|CR^ߙ4V'pѳ%kzR 9w̄SNY 4y`޽"'*dwںI[co4aBnnW;N6^ڴW<0|‏uֵG|)A}wȠ[c5U ZƳi;}:s˓WP_6T+LL2O窹s7L#Ͻ@ɶ᪽4==b70zFfcT7@ÔThXn7'I<#D7K*$H1DeR\foDl]s  笶 wuZtfJ5gM#Qڀ>86.a(Zw.T>wW"Arj\n#J^p*՛/f4 W\e6A}U)ys@XdWְQn.lY)$T$C|ތ nX>.+F B[.xH6ݷo}؆M^MnUK*>d7)qO 3EX%@$#P$yZۆDPR;{s y|d;wNYgiLc5!c uYڼHJp}aY_l/iCIvz/2qWțヶU^Ś'ЙbkR:4z*e`D4 1둁Ȏ8T[*ɜI&).ᓾ+"x%=?=dzy0{v(0\'w 5%3|f7y@ NH.aG 1}ۀM:S|l1C-*{wğ@Ϋ~DG@b%J`O>_~TtoI00lG`oQ؂-~!&۬*"VGsc)C[QAѕ_ExjHV;?rѣY$%Vl ecY~P٥BW-݊h39fȿ tg2rdYJ4Sj ǫ-g?*FU>3FlO9y9/VprqA(u74й;6Q,^#t1i?Gʗ.x.jYE){9w::ՍHbW?-gIqPVQ7T,ʴCqKFoxOK'J6G_d)L6Ee}MBve=gzZˑx3KI]fam4 -|vs-aHtTP#47[4 qpj_жx mI3Ss5of\}_Hv s?;7ÄA" .q;#eї~od1mϛyd.IfnڮB /y'ty\K{ mRjn:kIa]aά%GJV&I0Nl4?/_;׸wR&v;S}0Nj%_(_'jl|kh)j"#% nVJuBjyrRwEc=M wdF03{)W)~8 Rѯn?][ .G{nrPw% zꁗyG M)êdBUۨrPs—P؊u|fAL&NokXOTiD@)"+rtΒ-oaܤK}񼨸'n=$n;hXxxdILr: aRr'GaZ14lEՀ6;R.9YO-= s_v2ߔ .\voDVcs rpo>}Hu(ry|hzPJddV&t8 wIU ~׌I6 $ǃ]Nɳgg[v|⅂+@`HUzf,o-T8qX7:g\gSsϏ0a" s*N`ɱР&F]Gs̀Lra X/E~}{;>ůTYzکu?/w WspiBX8jͥԡ6EW1k6.1:k*AI8mB*IG2k,Br&4fi}]_0pE00*P +㞛x>w1OX6ry';+B8ٱYٜ~- + 񴁐B6ߟ{nG<k9? | dD?[_{y 1ю^z ǐSyy;p? $?8\0PsH G.q_v/1=19'ɍ/'~!%0@*/OC=ǀFxI2,) Yw C hh%NߌGN ÉWv+*%NJv@b)KA|plsӣ;n?]+[Fp<~W*hϞ.0H(R>|! .0@W iK- 6Jqcvk_pR<ғT"%$2;R~6/7dvM;= 7g-P?`8/2)l 'o7zJlȎyK/@ };`6"i߹KVzF\gIh R":gL(9m 1z4-ݓ^Ӄb,~@67Z>PM"Qm5z')cqeu!d2>>^)HP_T̾TF>4A0wzA`h9n1E|]L*SŽc{]~ y&.WV:],3:tz[̫{|NORJG 1A(91$m}o=lNFvx*VyҨ>ϑ6B.j&\~v6λ=)^[{S]BJdl5G($"r;eQ"(A %Ʈ?ݹ"CqMWE'o:Ƴ ^̢v|fJ\M_PԌ R=ڇ{mߜxLzG2d<-wΫf  *h0tkt! t=HOyU~UldgeI BUT$L<a3OK&p u421A q߈D&}Cx;\($L{Qp yЩ,YƔgLp7t ! *c[R7&cc2үD&\N\%'Zš!~aUaE ++yavbdMoO뗕t*(s^&>y2;)p/% rrh +)ǡdg:U" {5Չ6yj&hXqɲG`(j*jê9O +lF)&E6F;–Z̓R㜸 ?F'C7ԍ28h:Fhy& P扎FA}ܕR-yZ[&+I7E8W9~.S_Ԣaӕb!^_Jy:t$ppGFK5iFϴg Ԙ w6Gvp`f{xm<.Pz?oW=5oU*΍ix<9W s=c`{omITtg.' 3ĵ+r+4Z!{XNeL]^V)L\zG&jذ hr$5;pALf1 albrkpFq;Ǜ> *1@p=4=,5)s'W JStt*v;r^LDl@(E&s OTTtpG?Bkcp!$ mȧENw 44T}kpE"}%}t?5fJ5U=ejl%ZH[(O| K~qAEP&?;fEv)Ekkaai7(Eķ\A%bsͳY䑷p6cZtpcKIAO}C93ei{y1́M(O]zJK Z`h&tF^_d$}[<1Ȉ.\Hei\6A{iM`8]f˅+Xz\`j7Ty J<9XI Hm e" /VỎΔ1?X:H_S̊uTEWEQ{k&)6q.gd{ b\63'Ӷ$A 19 ybB3-_ )aM*X`f11ڈ &IHNx,:LXoT^,bDS nmUI'BK蛛tW;"O!{hP3ޱM;ҜS S^9j5Z hY%ǿ嵡̱UZܹ1pTx`wE5lg>5vYo 8Q28# Hlg|b'jC=ݟ]j,\*68u'>[P<jH]޲& _(n+u* l At/ qC8u2ؐ5Z,*| ą#nUIZS2-RcA+' /]q`\!KҌRNK1ipprrx$Mٮ]NaQZ])z"?6A9zY1ڠM H2|~m}:=Qb^Q0Z0_eWR"GAIysn< p](ǡCF'= ֹWEz#&&]G#m2r@'.XU09`9(}򈄔D]vG\WFT22  P 2~Aÿ7WU7CBKə+7>[,$˥MکрN<r;`l ӳcrGU9~ld^*5(ߑׁ67xĜ)%qV[}@3`CLL2jQb*( ' !xOϜWy} dx[;^سz͋=B^|?eJ67' oR*;WbbN J!E{$8%ۺ$Ŷ0kD$/glƍeܑ]VV^ j~S11&쇓ǯjT$uY̌yfl0]|sTYa*n[iY*Ozײ*Ѫ q,t+BۜG!ּq0,<:\!mÂ{g1 _8T{[ߙZg ?o|/Ϥ\&AzZ h{LP}JSe79!>LA ֒hdGh.~[l5~CQYn`@ aǴu+H#çr@U|$jV[MhHp?:?Y?O/!y(qbyК9pq룼d>-zbM%S:+gaK c% k )X{| n9Ed{'#?㎘95Uԉl,p0wS}F,x7]TpX1&IݥxC+rEkSua\pvCZ-m=Ko9mnGc7YZ5-h?h["Nf^$^tS+ÌY!?ӧ.h3EBxNAJFceȂ@u9ۿ#@) TfFAdc+l3y:+c Z؜j9$J_LP #tm14p[6uouNBU9Z.419+sNx xi#s$SZrz>nP+2cCd^\TĻ:r[%GdSѱc_5:-ڢW?rU"3yTm8R h| s07R֫s(6z 8>Ŏװ*Br] n™Zkbvצ"u^մ|5tnMZ"z=%v3wVJk,Ð_P?6LzkS -t`4W蜎:ӆW;xlL`-`#Ԋgط6:[2{͠~p;f} Q?`o23}:K:79VĨoXmYBɆ^u8ib mLѥjF_KymqY( as )NJ-)u~ň_]OD52h٠v-[\`a9FVQF ۻ # ?;]~0῁IU\NV/"֯-<1q/.O ",n<\6ݿBFN@#3' 1F ?X ^(4.nBHßCdǍp \!WL1<Ɲ( :lԍ5+?wj`tbIQ)EHZaroGG !Ibڡ#Q'Wbʒ~ܕ$tr's jB1up{ݴi~3%KcX'yUh"~r|KPQ(SdO㵁l|NTxKQ+}x\_L_|ᖺHI؜OP2Ha MKљY(luzaFvl2d`TC8V%ݞe}>dck[]c26)+ar6֚# -y7F,RBY @ o cUSหOY40ۊ'yO])cllm s)+ 8͍FF(8dJi@ ^8stK.~b^=yޟ R`\f/cIv5be6`BX}Tl;m?!s=h׊:{\)EGjSoN,/#do"UNTHVC$du$[8U-2>^א՟ VÕ Zeh.9r\Ew,9"uu@2ze,~<tX6OHDS]or D** V'<3+0,Yw 1ׄߜx`}x=zǻCM>Ӈ\7:׭'-m?r+Ӥ9s$`W"?;NIG2[MJO V-L#?u(qgZ/0M_!dĿv_zC]p2h8(@.(hE8&ݸNd4~.S(r`C7GpYgтKQeQUr%AyZNgwnjF}1|e]fft>x8%QD։ݗ Fl-@C&i.wƑil5Ό >(h[ʙXJA$C*ݒ92su_,["cP$wYߴ3g늻6 !c֌yoC"T*,eӗDg`\#VMP# H]-c˽!u+.l]-R.aPݸfkR[|HX ͼ{T/BqFo`*Tfݜ(1c$/ sI莏gaӧAO^ߛ"'I+ŒPUx=wT3;W*HyI^ 9-w^ShvfOaZw>-ȳTO%w.aJ51* )3yJm3 zpRe,Y7;!.}MHyU|SڪɟUPȹ )&mAE|Ԃjf{3Mm|/fD=IXCs#uHDj < ug|!"oMcIC`!+q[Lj֣d kWy*03߅J>LeJooq)Kڴ T'K@SK8vGXj_O X! b:{ XSv Wsid=!Úh@D1qA .2xU$l" LÔe T5]sP!~cU\#kǝRB8ϼš(ގy~I Nl#@^#e{'!u|ɤns0S +{zP zwbzÇNF7*̸ qDب8Kcs q;I Bߞ8zB\+3"Syc(6b/Nlc~3 ݁ψTzvGÐwt:cWJF6xNQ!I?3 a ZwJū1H0p܏MMx>s@pyTGhuՎvtVg v M(x2~Kz4G! %\(N d {>%``/G[sRo\"`2 d[i89}BNQ ' { Tvg9F2qC0g.:vfMNQ8,,ρ+b4Co ,[f*NL-Mu>RTM͟g }UA4oq]~U:a$i!7dz+Qzz{ vEΪ\.JcE)KHDvLc$>Pi0EOT`P'/I҂i:DHQ5ں`fomtD3_x@'֌geڤ֓.l2q62GuZKZJe  *J$+@[b=#{H^:^lB'wc%6t!."GK)-ir-eDT,v;s" /~9yln.ljw7Ia.!/yAbuO$=P@TC %X'0muJw?U[j-]9o`;)4ע1B9& cj1Ӆ?aC>a1H}= 6b`ֹҝ,n&~$L3$=)sE q}He FmnaR&Q b5 4 E60}ŰՋ7\mn Đ^K~9'/hl\ok P}+:}IgQ#"z 2e1ߑ|>~B!{/H |JC盹Kbf fQk՚6?i5y(AerI^RjV t',F3V£ćpqȋvYS3qW3q2lG=>. -ʷcY3fUz7mRBS}?x;jmђ'@($x8ͫ3#kX]]K\zlΞ`*ƚk_վռLYz]P Lc-gSwy1cG\#78WC8g<M V@::jF_H_(nR%6}~˦7-pZ5as3~{nBCX?kvy22}& %[POzb2i߭6Է(=b5C4xr>H,:ѓj'+x两1'cq?gڙfݢX*9P.@^<{X&߳P]XC|59Cj^_7OxJTmz $ƒ3E"o\;vjj,XI<`&=4<"ܧ˝y,aq] U x 6'Gns mGN)R\`NQ@e*=m+xtFwSZ%a>dv_&0vC7p|H'm>K/ጄڍK_˸gdi.R {ۢM5G\&IQ8PvI (UC1H{sHiQ/wE$We^Ĵl"!34VQV|O^qv4DN)|i*ݼ5Nj)t>;# .bd.$Lad1-#45 \':\uNY)Fru4Jq,3i)2CM :eq8aMݕw%v  x3 :2Gc=QM* (i&Eq j.EuЯdGa>ʉσ%Il[껎A.+Cq;9B ِ_ݧEprPNd*EkS]cQ迺΍2_k7vSm:>Ȭ~A" B~syɒ俦{^A(;0[g?w|μ<Юj|7_p$7V}joTUh$; @+PCeeey{Ǩ`s@`F: 휏hFWNXR9]-^tS噟%)PMV~B)XL[ٔ#bM06aFdkfI*#;lgr<\j3>Ѵ͵٘ਛBm"yʙlKٯkTM1;#/c +[/TWG tI~9i; z쿴yj3ui.xi7tN B "`ɥ8W»z΃W/=%(u`.:tN4c! qݥׁlVeƃnN mwbaf,ź mo 8ly٩݅o!16Es E$Ni(ܵQ3ZB7ӣr᠌?*-;_WrFͫB/`Qz<^C":&2gҠpe]Rc>(,(&ÂM<("f]pQWMw4X~}47\EBE2Nl4?Yfw.)%vDU)+1@m| LD5͘uįd rXE19-Yѽ\ĕi9<3q=}v2ʔ+1ꂅrjB~:ig$j}4> 6˪A<^?+k :ҊUa#@uRv\8u{ ;!.Xyt L^nW}E*N:&+ʢ!+LCfx厌Zb3m9ž2-c< WO~Ridkw}N9[77d̢ WY߀sI}|fj m{fw^z3_Cz3"?XW_t\{q~Rץ!3hGn]b DkDPHOinCP|\jg#]P) l.o j#·y1\VӀV+G\7<8,/O<$5]εܻx7xi=l`/O$q`q*crAV+Ũ1 T3>䖲qZ]Y{Ion09P_9jAMo#+)t5 = K4cmH;7I=E݄Hp=A.o+o,bgkyQr]"z4De -ΐc<47׈mڪu;Wv+i&\}1,?e /[3,tCm;OgfNN?s@4 |`@=҉b6"K>eeJyOVC#/_)qm=9E;Nj%Ӏ vLuCL]/Dr @C%*ⷅ?S o?0y. JYyA<ԫiwsG_avQ5 $%S IP&iV3[K% ^JHHU?}AH͕Ȼא9>cf8A%i^]Oj[i4:-13$<ΞYw<|~hȘ'VRu.I"2]3N]&ڑZ5AڱKkDcL%s p} p-.llEg-bYlщ4K>D9b+m&Dc8< ïJ'e4pb+ދ/Ppq=Tl7Apr)8:I7*>uFgGtghvSJT 3q%f6!Hء.~sr6?mO-{zaaH3^;GB$'A_]+ah-2u݌ؚ>ANy~ݡGf&e$Q%pa*ˑSB6'G#c{辍^dx+h 5ox2L^=}%^,e=ABMf"bh.,dx,KjSXھnacM#|[>"sP^gzp͟M>`7Cv8X*wp.ՎEk,CyoJg%flO\4HYpg9j9x'vnO5m!akr Mj$j>ȏu H mw3] hry$u9S/8;!w R]m=@Z3,'T] 1z>cϨa˧^%& ̳Ԅ6|K4lX$d{ %W)ϊ,b _0 3W4__v?52,ՎtGXLg6,bl  N[爬X DB#6ӳ'g:`mUz Xbgdiw"ŒѤK LԠh䪭Pr^`\=:B5 ZWjM4\Ju~q[.9ɹkÁ-e@id$<m쬺ќe|ۀ=ljY͠\&+ ׅ6(JjÕ6yRЏ& ^B3BكOr^Y`z-߃y?AT,:zܤبzOp= D 3#y$ gl( Ur Qs,^Q3{eȪL4<ʱJ9O5 Z_jd{9ƺƂqI&֯Ƕv\L 9G,mp͜s&#$l"3#^bNRDxSq] 8I'*'έr!ZXgĢqFE ڡjMdnӽ` %53S.5S-(87C̔PBݏ#ՙEP6rzVԴ{:pG84o%189ƫ9z; Hyc|DT+A+ 38͜S$<4 q9tΨA+t<1\"r'IEGdkWA䶾]>X+Sj"`!ʥ1fwZds1nԊ)8NrZKx%4 ]JMH(eE0P(C(\yH:ʺ=ߙM_wnke3U<ͩR Uc.8OaRb}^ȕ` 7HD<0zj *0HQoUo_>%}= U|p~wTdP]SNV=DVX~SD!OԀa[%3="'yϵRf13b~ 3|PB!`rQ SY \&4/:}զ^0G"4oKQ)<Ў9K"|I>);YFw-)| Qg_ /}Le0 nI]odqG/>Svj #ᐚjrEC1N,8 4" Vy?.mqlCٜ0"kne1{&U5vVyL e{?y,c@ Va&9X |ΧSt.!xGXKɽbZX N#\rmp!\S(G0[zW޾"lgԊ955'X@$vJT5L>sf࠯V< Ԫ?F/Ts*^ ͓rdo}sGЕV#!7iTKR>  ~<#a^w~N5i,"k‡@xێVD}O.d)_^I?9u˽9`$G/C[ ;2J@l5 ^[% f$wnwo/m qjC}S`k5+a\ˇ^TF#i1Hz|_@5Kn Zܸ҉ca[5[-Z\(V@B֠9^#P\knG. [u0| GqRzL1 w[z_%o(;Dmxcc- 0>g-=u8Giu w➰{= }2m_f.,y5"Sm , 4Q5qQ,@Fu?t_^k/Uf۝r ݘ|d k2 HMg'g|ByVO{8V`V,Cuiy+\u \~ڄ:gkźT&ĨXH8Jx cg~-×3=;[8ҳ*29w'H 7($kw1\M6 m΂(9WCO;eb;-̈'t>蟙AM?t+~>MW>?Fw?Ef_5e,@{5:}zGćt*}ݪS9) ўի2}tJ:5^/]S?ګAG곒fuAf#jѦbsF,E~qxG[6֜đ~HJIe euw(c{XϒңwT]\ZWZ_ZM$mY9k ՜Q$5^mjq4ؙRmV-{< p;`Rv9kG=pɳ.W$p);.)B%LA2[^/ZÖW*;ߡ[f޻ ˙\){z' qsF͖WL;:>YB>qor+]^dŝ~6vӖ)⺔Ƞ3s@=C_n=@yIsG_i4wǿ (DU'AwZJ&G)to<|<@[2f"j6cEy)b~7X:?Qsq)T Oto ]@ʋ؀ >  R`&7tP/0 he O~VdQe1G:AK2!ƔQUj9UFG9R\M_oA wiXŸ HeJm E+0 +#tDy:<͚Ҽg24QștV;lѼcsZd.Qp!x?2jUؕ n1uUk7Iķ0xk5?q}ه۞!2$B1q`ޔC-Yۇ]jBx \J%^&Fk=)WaRuN<oCcyK  Up%I܊[y*=7r_lh@x[B\|0Z8tG\\0bm%< 7󍯹2u(o\Y4j}0P;/*s5eg9k k97jrOEf>.WGWt Eҿ}E<.t K-k`JOj[64]S[B]Y# ]S~N=j HSMlLpG?Dzk;~RIǥXF >[]6ݓ3wz?_kdY Ms_//l6:)94@JNw>>0[tAVD9 q];Ե;#!4 :ڃ.ܶ y(OlM'/2؃ 2}+moy]%-X 0!7F iW*|5B';#%:p^fd_QVk;>*DJ=^Zܜ~S/yf|6ȫɥ*8r\'ڸ-#vY aJfQ%*_ ƾ)lJOO]<ӄR`ބ}3H ~MئA^,!#3*\ߣ$[Cu7#8eU0Дe;X h=Հ'u-34>h[=F*v/XCoRkj%Oq4 R$}b xJ#3 4FT#M0zWJ~`KdalYD2E?fV>|n1-M_9IbuU𻯲g+ˍ(/!CF:ưP#xamP{"dt#m~~0}mQlq[ d a\pS:R 0"O24)PvNޱ6X< iPtyh/2{"h}i.f༖I:/B}}HI+n-R@カKu;OFc6K#gy^&(4ɬHMHvR,אϵ:򊃷X\CLW>\M<;5%R.q7o/x83?K#{زW`dV`POΒ>nP LB&EzD:h*~s ^*z넛3rZW y SΨ a*wjǰ 9C&;!VHt  #{@! yNWbl@/h&5>>L{ GTq )Y`,oi0@C** 鲓 Sjӫkm_yI%迕IXZ{Ptw/mFy\9j@rMI :MN]b5]]Z7GU#NͮiT< ry=nKw>i J6e4◥}Q/J^]g"4Pk|Az{WϸI),u_Y/ uXB$je8 ]|J+{PYZ?@ʗ졦b&,9,gvPهh#42Vُ֙FV<~#}3ʕp+r5@(b)fjݦ  r)c7ꢛ43w&fG2[>Yq~3__Q=JA^ɠٹl* TLͯZ5fc[GXOKѻj*0;Yz e`Ak J~hW.{Ż˦;V\Rt-sDɿjAوkj?_}^*5ʭSR? 1ҏ9t^F|w.Chtqp,U#ny{=0{q-Dq~WȐD;R9whHEV!vQRBҋfhk7ɼck; Ҏt$Y  y[?~ hGx y"Z 폤f3rU?),mՃ:9aV?!?į@YҠX@Ȏlj"P0õN=Ti0B3L'EHq$93 !ٟ?54iJBN< "zyõXc`g _H0$(X [찪Z=,:q̝L1z,}݃~ Y Vre}K*ᆓ8,0к aڸu_Jx%,$eM8U2qXgȭc) D+0B_Ѥ nc ؝u^np ъ~f y!2S.qn*2kݼNo24{cjdb̎%PbNuuIQԶRdX(& @V';kqOId8+x;f~=IؕjQTOy+z6{t$ҋyl? Bw"1aJƾ߿ОB>Uu=haGz`R:`mm\L|(R @H>hƶFKiZȀievdp8h~|%`~#ܕq=[Љh{{oRɈ95hTD/U0_hl'mޚB=?ᇷb}i36XL\E|]ɟɤ$S5)ӤF `bzM5aG}d\`ؕ_ 9qNck=~[I loF_z*`>&鐚K fJ)o5jga#nؼ /!MiW5]{WT$ LVys0l8A J(A{Q%HibBgOa0X{8`opuw^l`niۍ1>d̸+{3JQ=y`tTyhES1ô|NpjO:54{Ԥ]`4]x!3,{N͇ޙfhF I KrOM@ыl4>s#xKB΢e+g@ ЪR:Iymߋ"M^0} ԵۜN?ɥk1^/k=|f2%ܧl(Tnc`E)6󻐘S&`ˊ\XPdc5%vĆ=5`g`BrYiǠ`lZHL7K3a #A4b+=$™"u3PR|`=$#ݠzr |l>)~`f(\G c~ Ap.%侬%euKhI{"nߋ3~(]$Ȯ&<(UZVbKE4\U44eSĨx. (߱lɮ2!OzVq%iapf4qrPT(fl_lՏșk +yR)<smt+p3REARy6-V޿k$Njc'`$X(`&yPSجpo>9P$f3e:~Ӝ&f"Ps]_<&G =Y!&9K2L1 * Zr"QߌC0bXTo/T1!\"suN5-,1Jsb_\ [[*ـ:꡶<!D*N-vuA4]ːM`yTj{$,+T¢FmKԅx jŸ^$k-/` 5vXqt;2䝟My,k޿?׼\&` V  +aoZ=8> Tޮ@و{ |R-CQ$N,K f?Ct/k'jsWD +3FP^*lsx!X8 L1,\dlgYn  6qVit%>o1ߓnhh=Ic:a(n!ؒ"N"'tWiTIt}' *Y3Ȯeޟ ݼTV1haݖ%0I):.2wN2 iS-Rrre'@ ɕ1%Q Z{\@+wMeXB6*PPuvr!X7_ņ %s[ȯk(Dbꟛŵ?Ld 5fQ1@R2P/xG2^Lxp5؍;gzҢ6wh^T\͜$4n7\z@[ٲ7rn/_|4Qxڭ{TS= ^$Dy<@aƌΆ*j⦞HK76B(ʂT3^KҺ) NEāBO)<;}^cl!聄Sy -dP4.).CM^jZm0c NuiM, JT|`nZWkX~jR4%ja2{s?@o䜏GJ*у"wm&ScxK,D3p Q/dY(ɢI70w! 4eT  c(A_QVEEo"kqmQ1\.F#2!_PgOqq9 YKHQnD2$DY-$+P`уC5$w2{6"v"ܧɾ} tفmZBh*l 5Tq*e H=EWi:hF7k)F\NG:QAeG9Vco3`c]d {'TCa%St>ˊ6c W,G\Jd0@9Q.{+PܤK4 /ƒ "@جԬX`}0.[%F1hV3g5REp^W&F.8RULoN'Fl ה7,BSӂB2d8H1Ĉ ҹ-Jd+C+TMib CD:XaL.)bBY V_YK;m2mcIѡԓ7o<ewlv!IeA{p]܃Clb4ѯVduRE{sa/)`rTQhc JOY+/=Nlx-BqDI~0`"!wP{7?75 3,dsrMvx)(t8Q;]OԿI}Vl@*8ȊmY2n?Tjy% EoȻE5&tMSL*&&y+W/a\Ka~G6'C:+jg3;#pҏBx YHH5Ŏ0=D(X&/˴<|A4%K@^ tTW:C6))0qb#yMRϒkTٳ/YK:G%כl|f F;ASkT8+v0/'+AZAk+$3bErE b M{ C1%k u-['xU)JCs>=Ʈ`E)42^>G?5˲ FnSsæB4` ̱El'@ }G[-y CJPAmmd#Dwh)ډF*HIT+"y"lT'}P4[D)zVC B>gYm['dž,LG^缪QgPfƀ#^ 傝Gߌ0f[/8A1mvXiBZ,Q$fMR"]1Maw9pxLwD|~K~{zoCc63 GӈSf@#;HrÀu,ZD. [Z qb)[MW;Z zk_z񓜺% YUBpI)cbNj @몢@zӜpUv[\=Rfqa0AJ_@Y[S5mIML`vԫKh됽;b}=[NB-:SPTCRmoڌʦf̋+l`g ls$ YEUyMAw~zY_QCn^<Ż<֧2w aۮWo]J'=UAOτDueW?n16s&w qEW*"ra5C~-u71ZݹLQ,Ewob8+e^R;!Fs:Jg L. ˽ Xss⪼yq֨$ -frI0r+bEm 7i5l.~R<]Kհ1 ]L.6fJ2[15T }3Y?(.U3UͶA5;22 op_l#cI\$BԪ6.45'eбB4bCKk09m Ҋ߳\$<>MH}2JX\=8$"'aEDٖ-[ #&g5Vwcu(z i[ܐ̒GϹVҗ2 {1;CU1s!6}"ذJ3;ZkF=kuIwg] SmnR1mxAn̏[z/-ŀf>E6G?ϾpmF$flǚGcWj:ܥk E$Tz-kLc+VKP`~3&sZők'v7t)dS;o1:nsR8L r{ LO7smIsCq#'꯼3 n+Y3Bs(wQV[ނαA juA+j_NZ/5 +Tέu@rӲu능ƖrvKF9RduI\fpY16HmM1Ƕ`EkAqgG%A(z:ӓ {Eo9J~,PYcBuӢ96}:SYl&Z,qO. mbaäY!\Nu0<~O;V n^Z{JݫYݺfP^dЊ[dz"OD;i⼻[Dxh?f[s4~]U+ q@8"xS/V`@/ԻDK/pDHo߁+HݫtȼZRGh#6`?Kxِv \ۀEmV_K+paupcV%ڰ{8!^se۵X'T꫗ĠɋfGl;bllH >X3O"d(T壑NlzLwk1[;G @ [$'5&_B޹ GAT#C =3zHXFyцM?G,vwkp,#[^Q<)Vf4kEbuq z*sqV#DӊdL9-=jfpTE.Hz$)fv,5zID5XW٨fWz8ص_ 1G0xI6m8!3ʫZJ_h\"Q*HS.j倢8&)P~&آ~ʹy=R3gpx0_N8swd&:[Ovq-عUFёF) -+*ķvg$"\et~xT25Y:&TsQzF&KQ.AlZVH82>$_ߨrӔIdFsңGzVr[cO!uuii*o8ZVh0 qQڼ+A{\7x..p\V5"]VjA3M`bIˮ0 o@M.Pփ-X|9Hs"`m^wtVwnW)3%*2(# q܍`ړ3lK9\;sLX)FVҔJri{ \Pܭ wP}/iAF((1Ctoog9 nJ*4|Hb<;";\/_\u5 ^vuO2?ôeRlKE+bޡ=i,M+й xMn};x9;N`U4 [Tz2Uv7z\Y[$H>ٺjec4T)`+Ѵ`7.k=<5&攔XGd~S|'~^AĦ; 6cSd(DbT?QeZmw&kGF9i퓗B١}>%ԇ3vmo0ZZY]L׃b,5W^/ZK*wAؐ,pymt[ Y<{ 1=t/w;R8( pJDыqFbcE)o 2S]G*7 $g7s[ M1I_/ypF97B`; 'u 2ުN\DX[; RF9HIDL>:ujDps7:L_3 NȚí6@_ |?eٵ>Ia$!IʈWʋ"Cpfg g ~0yȓ=%)t{uAt[&{ˍǛlnJ#7 ѐc C1.G@B{c+e:7Hk7C$ ˔'6Lhh%A&Se. Քe{cV4; ;5U (92 PN)̕L;:OJ%5Bc9EBj a\&x5O@N=^,#y]%3Werm/λxh"D+t[95Y{ZXk)J>NPx:ܻ X]=ɱn2kfӉoW4k}A|}6Ux4@j/vMݞ[9/X-rkKPe`M LI/e`~Vb*әhR9-wvG!1 JRw^ON%tߛ"X e{9R jXjMzYRuڣZo[IGctrQ<D>H":w7޴c-CFWZPu+,pUZt? J?.۽vZ0gDgF/ o]nv`MzK#KA+)\AT._\yq#B z+*E(w,+_rVtk`W1 %{$)(\еf'S)Unn &;;^_* ¯Ó~IG'rPz¹G^ϓ DPlR([+uNŢh6inp jm0%ocͤ7Zqtm;1 MZIbaJ.@X\rì%8pvZ\j)\n$9f& _ |-غGW\ t2.׾R56,ɛ68+yYϪJ+E\eᧄUCebb<4YD7ݠ$~KRЌ>x{̖f8Uu˂ZeD3_=w ZfkAKZfbT{%u{9\,s!ёY h!m}P jczbQIѶQBQnpBu &^D1x_/eMˍW:b{ƕ=褆U'X+KHPTQGr쪮`Zudb2]zӽzO),*E-VfGJ:ԖHny+/IfOiX0wSV?׍ еqBk]zjE#׎mגx}tA3;9@ZaxSX7WsJT29=JRXFtEkDiC@sWRCJkt Ɏ{I2NwP)Q #U;ܣ7m0|,]e۽U[jgZaߞ~? Q.=!1-VQkɛ?Ov )ę_sh5~дS9LzԸ#`VKiJ :IBieG0cC%A3 <1D <]1!mBˮÎsGJI6&Ф" (=읂b'Kً?¦ZK5yȌah Qe ř.: ci ۉ&n#!fv|xa#ZS7=ԪIFpBNaKR 1xXd|cH~KX,!UYDefj:kΆPk~YI0da/Yxϑ[p>`fp`b8}ҍP8$g muh_AbĦZMMѺrÚd;NNBg{Hk,t"y,|!x'&Y6uvR5Nd X\۬{kp={r{ ^2*Wٹp{SOs2쉂|env `C:6"C F=NB³u%-gN^YQupōݎˁoYP!~aIHI}f(+XtFuld z}t&w(^q7'h H̕`9s`U ִsonx CVF_߹I&_&6Ӟaìٚ8 /aeWuy:(yaYϰۅn/1pah7%aG'5p"'LXeX- q/!%L6Uŋ>24G_¨}ndOAuU?3)eZ(,M\H,M&5g%ҏ4&Ql_+E(j;]\\~FcB/<z型/j,:8$rrꐶ&6Fw;k*u@$]$'^&5&X2բzu~' {˛sS}v ;D8=ǞcЕնXeӋ2VT3J@sFtxwk6ȇQh(;s(u#+Vō l:bk4lOe?.<éߘ^^aq\(G5ptbW?;Ev~sK(AFܟb+sJHUT$v\:3E_Zdޠ~2Ԩϋ~7}bfTyL?+ȡ"m9td|R#r[2 ?M ;[M0˾ Q QIR&v M ۍU+XSvN$z5RPN4(E bGEI;BZ[ݛ00qxJXZmaj8"@@64G5m_!8zrÍ?’OC~lOi|䫙⿻SyYbٜӡ{0~z? fo?,!I'W![R20DVko@qb*0}}Sx>(TȠg <;6D- s t?9z‰P=8^ T%2&7A$TGͩ> I(R0a*Ҍxv̫qѰ SmMNI&>Ev+L w>3d~^K.xMz%1"e{-XyI.*㢜8菼 P]gauR-$ī埍0k+'l[' Ҽ;ًEÒ!ܥI;>e#CMa) fY3?5DZ-PZ(]aW`( mua&+_>3Š$}8\rEt8 $85%A^%A1"4:m~}[捷U?p:DZh~!=;'Mq{ P%i 7T{Y6ZС"UN}cOhm_nFWH?Uկ)dU þ5$ W.Ђ8~NW" ̾=/rQmeC C1:7Z.|gc!@ h.ӕ $f;stypDR[}4UQRKY*PQ Щ? ?|KơrhLavݗ,3zVnz6KNb*P&3>5X>yr-%'ǯ7[3-b0jiDFK}/U2 ~,a󒍜b;P5IDZPit:lBK[3C:7^<K{*a|b W9Eoj}NV- NWYQxXW/=JHsʄDy?@5 Yӷz6pΝ[0_ ^ÁmQgv(/r]I|u/`٣Etj!"MLAq.(?_k yRЋ>Т&%48d݀FQl#=;9v,9nՁXg _P=)C3, V|^,L`Nb>5,e›jiFC!KI#گB *-@>&DZPoaV71M|ueYM.y7>KVP WCwM/6 ]zHAD|Sz>),3HZ05[6P$ } bXILH ^(7"3׽T/~ܡbHpoRf)QN&8!G82/e!$7̏ FPL6|ER)VQ".U\C7OHqWLڪt)h,܆ (|nkEmJ?/6¼ClcJ*.{y*b֓wҵFHL xߝ37t TNK{4Q3KLr!'*\isq |R"hrZ";kXZ$Pʉ) '` -2AKAף2sM?Ġ;M1L90SVWDO0)d _t 5bUK幕zbm}͏VYX2~FZ: Nxx}Aŧz#}a5W{.R3Lr H}umJʋ>!WT~SDVﳣj\fU! ̫=@JC*N1~{r :1wFV>YHBHŖ6Ýk`T@&6`n\h~=2CEsUdIyRYwA١~B͔ٝrAT%}a\zSߍˤqlґ= !ϋ6o|ɡ&Gl^:ZgM1Qv_`msPt*3e%4 mkxzJa3ⱽ+^YzGom[#HxRcDNb4|P_M}roh/IS"v#\/r.1W#0 gjD[l<>oNN# 3m1TAX|!o^Kmި^nDղSҐ=jb 76) ST&  lP4zWXi[i 9KЅ]D 7)U:cmJX[-{Wܚ*S92OZv["@,] =iK^ž^Z :vMRte;R<sHŎ:egI%Jp^|հ!VCDKp Yd9ĿKzaQ%#u6I0ó?-T;_ A m3z`kISxW0N= ד4 |WCԔdjv&-q]OT?E}sb%߭>eh#@`vK-Tx!œ~SNO{V.6ɵ6Wq<'*N$CQ>*._BE׍s/sw@3m\U I"'.MPIڤZ26 i]٪nIRB%;D% TE &698 u$VԸQ?u>j<>}ܗGC3~0}} -ɿ볚H`%JV V9i,$gGH򘧕x`|m=$,P u)q`ތDԟ ]+iA6j˷ x#qT ƽpveC|GApmRE064rPLWOWU rFI٘`O$+g!99@ZEtY]Pl_ҲW3XTJ)QF?璔'[ς= *ڌ5BEAt|2xTX6‰[1Oq/GӦf'?zhŞ CӀSe<5SަGȱ,~BWoZ82HGHHw SyF8fؠ)>EvՍcj7miDC{4Q"lDe\Jw Y dκuΣ]i<䵢w/=BP!+A4'~%d&ω),h9Z0 m6-;bG (6 6(@w&;'lXPpx_eÉ6( Ķ7&~韙19OHߖA5-8V ;xzk@! ռuYZf) _i_{P$\VOjۍ;axYIR WVV"ǡ*CK\,]w݉;,]v쮼ԫd^"®Cv3/7DqjPOQ!w {F؆vYh:#+KX}"j.%?VlMD@'3qycs3Q $Jh< g >3{P6Io<me GRYzS0I_(܀Vד ^4gX,w-@ X;D2sJg\w6rĩ{ Դdjne#J?!g``ޜWLS(P>nAU8*p8\pPJ@NPxb<6v9_P\jT ?N@k<`Nsn~q![9t/^CzvpXqx&.bJ\dhc͌W BxEÇhׯ-a=[iX-ńCs#2*0L\|{>u6dg5p{[2$`qsѨec Nl2EBMV' 岨\uPZ"cD Uѝj(ڡP%$h;zs;XubNSP-#;zgMa;lJ.Ye* ݻZ9x.䃍Sae#^߳K^p[Ã}v܈ ZV{f)G֏c'oz۽&8.ŌL3k_jM0VJi֠L" 6NR<*LRʴ׽_%V{5+flًB-L27h߲0l:]nii 1s)1@?ZsBu:{O,W@|'^VC/uAaڇ:Ӆϓ. ޚ5Akei_j,*|`nHax6;&폡&׷#Yk|8qDp+D2r^l֥Ӆo3rNͅq @6I-1|4_jA8ͩYW=_Fe&Dj3;ZxUo@t"NoH>rQG9oȇ.3;֜laڥ0MeyV(y&eFo*mGry&)2?K]f[hڗ: ӬC/Zʒ/+$bA̜q1h7CI1#wwo%{0cu͋e   4ɅIu-Nw}[˺ u7%wħV&mA8C/μf.1y ~'ҚZhPL7/ߦr ][D'? 7?p`NG%3{H~lW@>.72SRt{U}Ql= LM;Lq Ԩa7A@|wf!pv=Y-$OCQNko2@>:1KT > abft\΢Xr\`sPKLJP@-|:9]_em2Z<㋊aЊ^=z`f|PX׳Т:T-5Sc.Pm-c+Gj8\aHq7:Tt"yCD񗟽 e>(<";Iwوr>ȭ yt).j:sF\j8ᆔցM؟uOu_o=3@D4] bɲ␠@U_iWo- +QCκ DZũZ|ͩl>Qf\o/#90==G激wFF5pmn</2qqI $ cwF/`E |#wO!z9 )b<{Y9JSÏrW]ass ?MAѨаiycx.{%3,KĀs1/6a{ 3eϝ{2:T\q@{qEH:zrrFEm۳0~!<c;Mmvn[gt `51,g:C_cN!iY\Deo*Hr&ِP'i61-vhp"zMVxosܥb]ÕH {# 䏃WTgt^PC9Z&+E|vg8?3) yǂS7I7Yɺ5MrQ/ymGb5ꒆl_f(ߦLnTsy\7%[X:0%?ħ;;PRMnn Gf $w⽀4jr)/$ÕB1.C6c~| ӅBT~S( sw/|b5 ><͕$do ^B[p˨]C@.m[ae$zHStO0\ cN -FK BΡc3`ħUpuα&[d>V~dVM﨨K04%t4,q4qIUXT0U b|E?o2C5T0; s\jvL , ٶ&[b#믴X9!}fP\[|Xs<6=^IHO2C^}u)kp$q2m^?y"&ZJAeL1Q1;z ˺~ #c,&?[H͋CG7ue)H >Pr RA2$]23&Jɰwy?x':41 k1xn=jFK8vvo8gAte)מNd 84/bXmroۓ33(~땙)E !sN'6#yn+#Jc/޺\-eJJ<RC+J M,zv4GͿ9 Ȣ`ܰ'(ܧ`ZxEګw ^`r ,ev}c1 F[F>P{VTų P` Aߚ 0aV a{- NvE^0c'l"=pw]\)c|̞@"ӼqK$̳Aʂs5*aA7 }& J{ڥ~Ÿre;[o/[0Ԇf Hڊ/QD‚z H:˛k|xKM=ƗMȵоqDtH ^$JvH' pq0ۤcZĠ }4yѱCz6R+)QPOv Ld($.YL1Nz"f 5y*>D܅gw8ҜlS7 %W,||I8죖Ib@kX{mIͰm< {gxa;v#w8☥Sߧ+ϟh:gت5Nhd$[>{F4Z+oY[zEȝdQ-[]k5.~VZ]JW1c()P/B@heLSR0R!%txX6a&Po]! VDJq;4ƸAsbq>`bj_OiKn[{d.#Nfp*VB,_*I3judwS:`ea] @mnH`_fk9@;YOH\iS"4`A:bwK:.^x'zM*ND ďmvi*OP\O'S-2i.!|wN<+$bG<|¢iη` qSshd.)"[0P4s|2P]goC[?K1NvoWZ +>!;p,cda.~+ ]1:)5.]&9#yny?T{l׿[8ĥ>QͦކF*V+8P`r;ʡ#Q!4c1XM1шgQ|O}ƼyjZAz褫*sY/y}th@W֮xgux5!w^@*&U:B2(Q*- χҩChGeCnVjϧIZ1awol!!cRJO F:KA۱F k:4:}VQI;Zz7[KG4At=Dy_~ N|pY#L# Byb&XQ $T0m*K̋XnH9?D'?ڡvT9I%sVrЏ0U5:^yu9줢:XEW)Qrq|jѝul/ӡczHԐ/7+0-ׄ˝%"(i/pQפj[t%?5&cCv֓6 B l7) pY( i =n O^{ rjI *3 6H f<% ak*a4u*? WƟ:c92>Uw݊vZBD_ڣPlv7Vm♉~eB3a1Up7 ⮰dg 4B|+[VQ ߇'g+Q[bd /?TJ{Om ;}$WyҴ{i;g0pujR$-Ql4Cx-ǶI=g:t㗲w7Cdq7qS:Ld#d#@/S[4%Gf pt wJr54,'CWEz[BI]zq!ȵ x,~5aőۦFmF3[چ3#.:"2YZJ%TT(뭯ؼ9m,p.ZLJl UVAm`* t MBM9ЩL8Z܄I*s8.WpbMTPq^GfVbozE`II}@8SO1WF ,C=(ӟ1veHpH,9Bzd]J7v9SC^It/X@̒\ak+Wky 14bC7T߂="0H #( cIe7)%0'y*ĩ݅d3M?1QoJaUc/ʬ.:ЎXZθv֤ T@G> Я-M56I5'M܅0"ky >.]+0 F2hV" dkrM2tW'{z$#1~ Ft$I> B2=euZ?˄:VAȴ^9:tYq[Ax#m%kSD:Hw`uVF,_2"J)m-\5YV8۝95)&F iAE4MGתAyleY_S\,4ӖUkw:>"$ Dc &(37¡`HXC2֪ IxjK߭ϲ%bC{]%1%#bb!ŶB޳C/I^ZM }@ӺQ{@]CGMy2^@/~`8&ŽW3 {ʺuPgGázhcl u牜A[vںX͈ neA\!M_uZ/r8]h#U? "1avz= K}eCG펫>3Ĕu$NCm4UW4ޟ뵵 N* iЙkub®qGCFP>5[UU2ZƥI 3Q,Q8g&Qf [6Lޖ4 օ+gp OyAZIkA [}]xt*NZQ!;1^\/gD;fNTFq$MPV4jKlQ^2]v.dSn,5ܑJ,1 SE'+q {*wKŠWEplqDEUn~X{ ߐ mCc,aAGc<{hA_l;qeeS}$ #:$dS:X=H'B3Prd*DAՇȾй F~qY b^PDUƄgs*]E ѧHΉ07N &efW`9xAoH9%zq/+:!8U79)fŌgk0݀%iN%Lri]qĶcm-)3Ce<ª2k@MFESR),fN_wWm7c h dqAf&RkK4}14 H ^nE1ώ j<LlÀG?Q5(Lb\CMiZn隒"'B~e 5;@y@IyY ,k >qLo-AOLr4tj='>sSӘ^g}`_}\ۇ -4Rz=dɧB'sE0,s5Jf~n:[tKC2RT+m޵pی!0jUAI{1GyAE l.a4]7c✠οf> [Ϳ|IG>yrrdT[dݶWkmD$EsWr\{\gmK3L˳߳%PBb킮pMkdc-p6y]ަ NJ5{m-i$SxiY^Q6I[X$ iާ1qT&u*nS)bAy'1w^:[3n@OEk]Q k^CmWhp`>b3iQypu%.D<dzֻ q?7f/ I _̏E[_aY_>E\ + W= Ϻ51?n( 'ZiiF>:A9⊼X#pq4Wj=^Lj_ `l!7'3Ɉ+jT2)'7]!\{fzLѠL#DDMK^$ קw[K}$бIWxOsz(bC`[)DVAnQxg1coTK!NYx )`Ap`" ۛZ8)Bciϣ^ip/)F}zV1u?g:~`ߞRJp>,fp?[k;Y PN/Vnw **Gьje [F(eO!aqIew7@vW[;H7> rd+[7o:*34QIjҒ ^wwݞU 7FjW5Kؕ-^Ž"&/ޘN1e^)p[& s_ßǶȻO|}fWs|T`ŗ#ONX,f (ytOỌ+\|\T78QڠH|ke^jʼujt쎬Äu {//=zm9(l+Ip߇ґ#M4;ud?gxঁZ9>S"Wxv`eA ? !f u¹ :⊧i_h[")*'_-dbB"oQF<+:2òjjG G%Х9mkr_d&%!O8;hS{%w'!qȡ$i­.,VߦiP~ ~@2Pt#9,g1<9Ԝ[Lt@ s$vVdM{jV"Іs` )\E3<}A 쿃4C:.pzz&>f6>AD"ym者z]^όX5tgv!uWc7Tq}PxA}n!%0iHmk;YMdЌ,i"ĘHCQN[[M=LYeK5Gٶmd߉1 hck![4Sv#Р뒥nN,rͬuGaؾ|Xt )'x^Pg٩vkNٌ٭Hz~RlS7!!@C&D4 p#7%m^NtUeYbWHQ_.3|V" X燿 ,aW=~YҀ{2+ln,Wꫣ'Oa̦ͭq^~V(&9RMF`y`~ ɣYő A\zpL"\ftV-A9(zs0S֬wzGߢfkG>GďSz'[1w :X7<Z6F.ۄFć'U󃫏Tgv-yi=yhv+ )v>c.*L;dZB Ftd.ʼn8,G3DEB~/ژmˋۧjBmoKLIR- kY d4쀗"G]O ?y$>Z`]4@?1vO dx*ˏ)* 6',|;(Yϙ&L/B9c-2<3y-㉫E@U\W&Nb/*<|n s" ; Ҥ15yNk'5=zU[Ē3|W<7K4Sg~ۢ\ *:R }%,%E픬$!K![@XaRep6 <^<ǟf#*+bD]Tw& ;h(;oвJ7@nm.+lU|⯃ܩ > CYv,mH+ 8FL3/a#JSJP\^N8ְΏeGULgz=E >u!! tZI77!JIyOzrS׭SCRXnXA"Hv-%4 LE8~@6R w}SbK6y=tHV SDuF%fm}@,}yHݛ9v>$³I:vh ,ꡍ}rtQwDc+"!C]Y#[@[) tF*ƨ\D:{ 6k-<$0Kc}4ݼ⥲oyO` ?^w˒G0^[**Q1͊Xdq 1L+.5?eovsJ$!_❋6s=Z<2V~B1`mKfw]IFMNm( 1tn'TG0dUoύ3/ k. z7 r^ ʙռ PoϢ}f\=VFK v2GibieG[3;QrP & { RR{l G_AA=W'b5a9j{KvE&7+9*p,ot>V+>$Cv!t[~wMCt3 _QКt'#"J3 T# `gPپ7v R[y6s}Bӏ);PŏpwX3aO$Z{[ŏ2nJO0~ ?ڿMt)T3LDI|SXl(h6*º*/<ќ̞X/SQ%A¼@U^x35l{O3,Rn]N gbPpwة5h=ª_&{{b컌3\n6]镾/eD0bc/tx[&_]W K\b݁TlSC$9[tC F,*T)ǽ> ɮZ+]귭s3ь$RȵCmtZ>V]%@I)`L_AaF. A=E1 O]aPT4ݝ55WiqX ŝ揶y2XW;&4s=Ξd:вͮ:&A(W~.|'aG,|!:L6OŪQDE0wyPFGI5Z˅(7GDڭzx~trvfDTmpB ~Wb #6}7rMlN$B'W#Z[i0ǼQy ZRIdT/j|ۇ(1?99龻Ml[Hlzb.!}_=fIZ"5yKj= ol4]}6|H?1St{d([\;n`_Q+kcQ*G8ɴt-sVW̒6@`gXM=]G!:̞`עTƋE,CZѪ{8̵{_ DJDRk |ʝ{v`{`"ո>wpvuS,*~`gZ,?XdW|7(^mU J qX.nRG޺_ǚ6"fEI%rsK`=!uɭKc4 EGi d.*8$11ʎ G@4Xg/wS c <{tIma]x)X?sUTC.!iI2 ;zјReg5y}Ј3^sS26Vne)(#+Sq/'&~T bϒFvȀa (4 !`ڛqU4éc]:,nbfYcvCjB(X/P1 ؊XLrފ몭 C$Ŷ+ĿV陛 O"əē#XV3xox;wY! <~0K.)F:n#?h\sWTxMࣼ ,l{ݐlB5ۛ2&~[%v¦B5z̖Rv_(avZKuBBz@֡uʡv83u=EIzjQO^pZ nYڨ)"HܴK1|]"%ƹj^fC;RC>6)H`_)@N4|V>vl[+3H cjH!M ,XXcw?] үT㘜TŮ{/["]dFk7A/=.Xɻzb&h~ $'iķQ<CnEWuݵG#E*'K=N ")]4, rQ՟eïH)s9ѾV!V@8Nj}Ĭz3w,{~U{(Ptɻr/=!D5J/2PP[6UtkբKH}P3On X ѻCx~>+0+,Yt~lA&z֫ATpg f_5̿Mz-,P$򥮄/>98_Rsm٘~,e>S7rb5rL!Y윝P NpW3a4Z;je﹧=-'sRǕPqg %=+ jПFG7{\" ժ@|z'ؿD3Df*.k-|L D.}5/nR^Cm֔aF悁/ 𕊈{{W Pym:i`+QݍBVԋg8˜ T /½*@JXZeU(v1U%Pǧїv'Bpљzoeޟja}Rc^B1䦍m_ T2 vQM PS$)F{C䬉 ogb7#pEpMSnv\0z΅!lq#]m.k@?!LsL}Nw@oCѿ؊270TvKBf_Fò};M^LJHdV&#~ǫ d2% 9-!13i#(5G]i!JV2hTLDGI4W>`z?! hT>G~'NGn lvA+3e Z$K}GM^Ivd |_A )Blߴ>~_DP+UMP ҿK}0!:Wc^))b}A_ o*j*mq9y4A/N"spZp↷Lfpsgܐl{fN9 T9QaǒToY.:( 3A.YX06s*%j 1qH—cc"%c9l's^")|ߥo*Ǚl*֡r"zqF8I*;>p2uzں_FֈF Kjرz6Q„TZʏLΡIo*wTxq oIAVlL s/@~w1!^~߰ʼÔ##6 9w:? HBQ6"/Eä2Tth7<=+˯ź}t ;j5Qs}_1U. dA:sTӓPL&K𒈑\CN!3ɟ}*@M^ݘcw؈M'|`b#ΞԯKڑx>q"J]sC {٥`rQxdjmwOez1 9y~аJsөm'];1x6"߁# YxCk8XN$4A8*z 9vUI$ D8ʚ VSOl +wI됊:"1šd-d f%8&Oˡ0ÙJE#3ώ."# kf,2l"|OYߑF3vhD3 u00\7=g~qv^ُkK\mm d`<1"s}GL庣vf¸DY &bv{g4CM<Ĥ89M1Icw4 }BWƳtgN .%d+ڿgm@0: v/ gPJVN4!KDTFN [LM !JIts1iT/IߗHxvũ:3M;ڤͬf[} Z$T !┧XΟr4 :d, 2r>YWZ T6^6%BBd<)BÆ !J3Zɣq6r+Te+e[(Gͩp8 NZ ѨlfA{| 5Fv 8C 'wd|$vf =OFx$]{W\Qhr)cMZ H̐h C+ "Vð>_toiB=I8k f Inx,ˣdi ]Mno?'98V؟%$i:UÓ "SGUD+d taxM+F3N JGذ@ID:Z[ڲ=iw5.| r=\N+C@=NM\ T3vx$:2õ|gV( g rcM|o5^P5*3!A)  mIӉPQ- lFe z-x7fgMÁlnb{[V=yZ=#4^Y0#b| 8q\\Rݨm0,"IV!U69rCʋB*kϓ }>HsV\\ng2xNgV3@kO$hETRq5h#G2:7ߕtMQ;ӟ:S=.e}SwKk&DGK+<8ֹx> O0hKȥ ~?9R\ w,1ǹr!E"bOe.7~ kP{05 ȓY\IdS9^nb! E)*#(eHzo$hE(4o:o:|x="*&+~tGAw=6d9v>ܦcC&9 1 jBάj?dcEsvE0.Mtm?h,~CL6%Cxf!)O*r-G^q&ϟZXU}5dXI a6]f@F"S:KC.(z׼ș gNI )t.9;B%)>dfPƣ0.'v85 fm7yi.w=0KR/Q[y! .^.sγ` 4.b*]pU{W‼51iu,WhA8#B6w6h5ckF ǡ0kxb֟w6`LU̽ϰ[eg~AmX M3m2L)]{Gϕ/nAlǓ9Awzf!=$: if!ExI ujX3$7"ͩXmƽSU/&.$}P[ڜ9Qz]Ysd1xAP9Jo!ZK_a'aXI0yMplIr1f䞉zVG1Mb @~^+08h^A k_^6uOiA>\*\ 2E!-ݽ@(t}9/>SRƆ&Tlwf0-32DFlj.k+^F3?Z^yfd 2N2@,Zʏ6 2?R텟rdlO"enh$`67;165W v$}_Ei/b!(mr1SO$s[b5mߖ#iO?۸'ccZT!jRe8,=v=v׳xGXxy$7%عqiOҷp3j'r"ıizҁ9 WF&)o~XB޺uw#V6}0i`$(=>膾)O܍?u3E8z/uxalp"Ga̠X_<50u',k""|s2tE$+*fS{qNAPޛݚzD+v=MX!:nZ-grdu gI Z]H,Z#b^/,>H-*{6}$vv*:#g'խiͣ͜Yj}6;M%o0}"p>ǢꍋcOGZ"P{n ,϶) WG`P%c-x3h\osni>_$?ȯ t(_K0- +2rq md-V$ϡz,Z-97^2+= ɖDf 椦gaUXW,UtLFpV;$Iˠs +ZJ+WMM7H}FQJsl,ҒU}q˪_>zt%aInx;tg{P'w=\AИTMϴ!{٬]uQl ~ǬsrYw=PujH2c@uV7 CԳE5U75ŏ)Ԩo 35#i2C\|)|@9g_wuO}G:.#MOoe|n3!S IنF<^>nA\x}^`ݣ٨V`K!ïz sV 'Y*n$6 ǒTElU*0--]$ 1K6> C\(`a*lRVi_L`%B&n0h9 w>mw6[| np0pYA@}4C.p6]Ng0YCnogkKK:I߻HGضCz }}rYe?'a7a)'Σogίq- ҃-\Q =)0td7 l2j\^9OĠ?l}K>+a'RZ7VD,@ŲZ*Y[]_ I+@@MY[W gͭ]#^Ef"P "(2->kaj9I(<+2iqX&vqYQ:O.CԌFΠDaF&H gY evia)DOrNOߝNuU?Os*Wo,b󁧌BL'$%):0ꍯZL}>ޠju]Z3|w?3 o]{qW*g]fJ8;E_zfOulDYG9Z8y@މ=68Z4Y׆SLs[㌈ IPJ  Oƅn@Յ5Y(4t[&I6bjKe;⥹T ěiIAF #F:njhxC`= $AiA,\A=1M,6,x{t=!C^vAQ;qG@هY)Wg, 4͹B|ċhɼ˄D,>iޢSaUl`;Ygٛ?+P@؀FONqi^*۰}#KG?l,x)Z8?dsL>+3W㈸]pk8.Tnn )(t-G NzJ)v(.OD%u޽D8kUAxcHihUJju7\EAš=wRKT \n -`_Е3W0Az7]u`rnG\X?@eYqC5_+Q+Ć3RTHK5Fxn+c: D5Q}jG{ r<J|toԫoGRi6N~_@]?JBUK(NI_lfmlDwX3kN&7 BOʊtj 0W9Ś {ΣͥyHbq`NHʿ>Ahێ_FgMIDJ*Lk1W$ڏW*+`y/^3M"F~6;,5$[ü̧22f"~{5=@5G2C*LaȚ9& @VjȄ')4sM}j9䌚xcbbdy ч(L5?v>la>{G&}o{El2U%CZ80C@1ARR$:E@&H)Sgr[>H8-u\ކru( >*5?ކz./N_3 3  J&kN*|#"zQNl~@ TjM]tE4ϠG"w}^Emݞ7FNz/Ecy3fΧ_$V쉽ϲ%K9"lMtS-aCw&O0w;s sTۄgzI 0cn7 QN,ѷE9CHTU6ޥȳŇ6/=nmo<(n9Hlg7/ ipl׺B,3V#ݲ˘#pa"L$%[rWuLM072Xu_2v;B91/Maq"ʾ31cg<-f*5.5M' _+0 ~fώZEM|,}'E{:d9TYRSV57aEdNWŚ Ag'ܕ`S&e0x1mvudCUgn1']x6jHҠguk_D&APS8cf _¡wtBEX"2Թjv4~HԳ=0/KMm*¹*T:p,5Gob!G'hiJL/ )jй.^OxҶMBEo#|p 7%fƀAQ X`S0QGtl71}lI"lwIpgxFQ ͦ([S89y, s;uYe^:$%c!=ʦFN v8ۜ0q0H;EM- |3!c$&r * ֖-UNG`Lv 5> }LX@kFfj)wϗE]z8 ʟ*GZD`V6Zz.gԯ8̚ M;0M@ q|4@.YS☑S do!_%\3EsQ(#59T+D&Vm6~(zp*=ٯ[1:>==z]bږL k2?l 쉁 \/"fNu#tٮOgI'͛ ABX2fiRuk,պ^ NxoJbE/@K~#Ōktj0NLNyp@?$|&JU\[uWt%뭤5ߒOcZFbiV\RYBdߤvi#`Z,C'o.ly? 'ԞI• -L~4&m{QH)0$ 끡ӓOl#jļlǥzTn;NI,=>,.紉'H , l*ڣ uC#&,Lg9`M-͆#~E?1E-srpo\C\)^6ks ^0Z.87Op<=/ڐrΫΎЈ~|_z|G>zDsѐˏ3芴2VJ9k0O=>ijby!x>{6+9V\EzL#ёY^zHx0Ou|R|=nYL<,&%ģ(߽{M ؝f4;=[j#w4] ; lΛ O3Wx 5Vy{Κq8o37ϭN෬l3Kgql{z&(Q $tjYk;Dqҧ堳lp#1ťEiuӭ|̼}*e4nlE}t9+,ٜ*/HU u㹪щ^bK$0UY0&TL k$oGK Rvw{V?RrR L:b i Nx3:A2`l ӵueP+1\A9wG3[qb5а5\0)9+l+~!jv_DV>*Gnu܌Pv.^ j3 ;8o =\"!{ /[8?0=Dȶ^-'MI)G;QFYr@hkuM؇2-eW\Jdc.QeP[K tbClQq>)aTK\mԥoXW̭u9E`w_"cɄx7]tTz nVM<z~ǫ0b7TyO.r?^}ܨ#4*a:{&/CfQv~8J3j%g>3oYMzqǦ;۸U[o%x'_rh GT 1y4, VsKd`{;ƧpI05D񐪸4=uU?xE8 2E^(HD;B Uc#uNNNT9ޠ(Gg=s[uؔ@PזlCPϘg6WhH\>6>s+䳬W?nbwj V@4R5hqV²2T $ZgL-'QZ[+ZjXq2`n2 6"x}|QE] פRِ'=&%|`fai~$i`$-W5XwLMH|OGx]{4Ū³I S @dk%h8_H/^%mEu|;dž6wq{}YfOlx7ߓ5]/i構'-Ġóy,Z`Š3 {4"m-]@xƸ!<?UJ79&{ǃp}]L<AQRw?7lrnB`cːם{<* ʣq:Kr'3/{t8|/ƀȋP]/1ֱTG$uu7l/Tk_#>T@i/NW M'W Lȍj X+Bҧv>]JgIVQO;_Y5~0MJ:FuuJlT"%_)mSVa#DVgHC K0UjU( څ#HNӎoE0ʵgͤNq ?T^#Jz7~)]Y6LH!Lb\'a\eq4m }hR4q]xnG,lƖHUUȳ>2ޡI%hAlq+tyᶸ0rYBi]&(hBf c+%~>݉Z Mti뒡X9R\p$d-WcFTi}o4S;Y➦NbKWUшhEw+&jobeDe;0ihq~1zA' y"%Y:J%Q!MAAg!}/wT(8gm[('U Ti%5f Ozx'"=k"|dgU 6w3Sߧi gn5!F31d8w6k$ ٬Z VIO[1w7SEM J< v7QPiIvb?[ e-q6Wo2oeX UD- K ijh(&<۹ ZtZ2r6.]#xV$J/ JjhʏW#q ]5q?9-$o~&sma*|;[T r2@`^&"S}HQ?4;|}ẅ$ r۬̆De&UowɍGHutO<<ڔ뾜:|1o2bhdGV=XG˶]"thz~nW_wm֥T(qZ|]7oFD^q. y/@#\ݺ|R8 d Pg"Jn$zU#v'G.?J,|`iȕƲb!-5̫P爄ȩr_YdiwM@UJt'>U ͈GB@[,$w}v[б+4ZibjM3g )_&۫8^TǤd m$%rC3Z9$We!×!9"bƪs#A3(B+(a ~߶cC'> \&CЭW+fmqpm[3ɘ,'iB+[fMU4Jk6VXx6sg,%6[1U-s <Յ«y9)ď@Tu~RM{C"l fWםmoY##C{Kݧ8CLiGF ` agFh[ ќNaeP~zr;or/WEc'AE U3Gf3@I{6ZLluDXOۓ!/v,l'GUH1bl`M^Ԍ=~E?h}׭ x9alfc6RF@?͖%cH/'ٌV0̳0yLgV_;G/lQ-Jج^Wt<-IʘoR:3߀hX2'XL/`E Q:,C w;;UFмM ]SGgx+#l詘}QvXY!KŦၺ4W̫f2ʫy0d$!=KǨ|-H2VDVFz\nM:X=Y rrctkG{Ә7)U xLg*MD#U9pJ䑼m3/W1{;WMI6x"3Qv;`,$~jbn(Z,={N)A.:ΦQIEDzb/%ɬ2t ͔*[@La@ ]x2_cZxZ[t\t{$C<)=hG m y+&YfH6' 4Y,gQ PRH "$PzҌC]rp:0=u)E+raxC0b)|;#Na.-WnL]X<2&jx0%H!`9[[<_s 4n 8F;u~1# ?Q8ldḖnI2dA"%4>O|-lOUVB=mn) fHTq=nK:=9>M@\z d'#D 2`F~A ;Eԡp5{J.[ni (%T5YlU;djR):5sQLApAW/(F2(2|C-CEZd͐~IYBd .ڑ9_ED"\kU7G Cxr:Dx3xp" La%Κg>SL:^ q,݇%X窳꿋G}Puܵs*hҹ}49Jh.?|}L }݌J)OԠ<(?NoxRH\fC#[ZTa0ۥA`5ojl287B}]:c^И JCT?齆`'uf1ĕiH4o)Txt]*oS5@SpuLBtX.#a~Kn(dx.v[VL̀ް⼐^vՆ0>gZmo"u5?+=\ DE] V+ϙʣx^Y }rfq|~l͢1bs#rw7J|4/"pOenq!RRBXIvEO~5 4X:'ҬQJnY<г/ p}c0tΕ@ƴD v )s]- &Q+ zeJz7w̒&sF6%]* L5*d `N'bjmY(wV]+-peϰ#@BL>I9GN csk,)un#[t` I]?]cۀī=3{9:(]nq=C>ڙ󍷇:Zֿ{7",m5?" iuMJDF.~:XZ,texԄFQ- J%"@RrOҭ+!#\,( j2Yޅ$%Ƌc#煂9@oPO]S wщ5ĈQܳT>l6y1X+I|}-~:m$DwXy L\U f] P7 iz _"dp(UqZ%׿Tz?Q`iT),+9SsP R= +;@ei$ne?#oK]a"+÷E5fMa-|2B,`4ygjhPBJrA&DmX(}L76rr wbMCtע\0(T6g#_$%@p/.BQ[Cߝ".*"CANQGX)㉟|V []a3|D*t|pI,0Fߊ6>MDF=5Pzo1(rmuLmIVo|^&i.ǿ [b BW~8_VkOFcn o!TWwK17c8bS^ ī ⯸;C* -zd1'_;!J'56Yuf +Ӳ1an+w5.@ahSF{je򖧔xN]"l 3͐RˣDgV;|1p%ɢ/фk慘@ A.8*D8Xn64ڭ I%}H"@G"le>۞A?-Az;b,^rIYDcBܓNFm7V[}vK[3 U/߾Q+k,3 (71OgoY7[2<`f4*E!xI*!Nav4;P\h7;rJXdٙ4_2u/fpFLmq2 L1&a8HzF 3vv-cPc|a9. ~[_'h{4`)~&'Rb1{Nra:AU`QȂ,4 YƖgs¡ X؂SWPS[ؔ@(U5T/;]?ėFۑb:QcGl߃ډCo\YQ(GFM[!ekN;"pR?|DX|دݍ B8 # cNʈ0g 3^N^ ˅~#[%Σ"!Q-Ve,r-w  A(*s+%\O@;r> >1ۍ|=98D O=*wAylX;7fBuJ/`<)P NHy}0n7V:B^R {  qCrK1 }3*LL*c_Rs'dIu& wl% >D_d:{YnB^ BW E-KEKنHN}VJ;I]l&B+ѝImWar+VVp%;Mzule7Z)eZ 5ǴqyCRx Ii>@BD.6TK3՝NV}½oꄖju$Q1SG h=XÍ<ԐkS%X )i!ѯ-}SP}beGo#ϿC0<XlF{7BG2\O5pn=WCb!=Sr1lHRO4{4xxJh$nN^\o}K5cۄiΥm9on]"3Ac,D3Yl j]XKXYi?|-#ؕOwV M >P{qgS>D1L bP#I 0_-Av tn8Y6'#iBVr:ۊh窾t > OKYzyg%  'CTT{ 5&g79X frԆcY]V7|!" E5҈*Kt8V@Rއ`DlP͞8@H5z}H9huY鏿Ι?.j!+w/4`@٪)tf5NWgLc5(S</%)†l xX!A#ơ\i"8swfc+֌SGgmg7D13xΥl;b3 /M  63vzWg*(gz0e,G2E->NU8~J$hڻ6;)7pf0_Np;(_<2QQK79e۪Lviu͔”l*rmG#!PP=3A rs$b 6 Lcopg֨+?7_@- &Bm9X:'XĜv(:\~Moݪ,V2&hӇb}afxҚKaH\E+rF#p!}8ՙ2zwz6!/b8IKé7$HgLFV,n3T_9[ +wU $E.N7_QVo&X~m$Q T:VG/W Gj޶i,E Lx=mQS(-|{iz>/4ݺ"fr]7aK}NX!0.veUqQWkUԴ*BAX{;]M#is2?Ġ V<1O&n[#Z[c 䝫SԪfgG폝&\) ^2v4$s`}MFƮI1uhduUtP7?b4$B*OYcRp<:~,ѭ4lL*UP_'X:/1vy 4{o{:;ؗz[ZOhK @&չ2Õ<,aq-B=E C[m`bW#8Ib ϝB2y`>ĴNy9k= ٥a~|GM쩡,_~j5fGM(8yMFMDuZ8G*?puhF D=ؒ^.$, 25Az7Zž`cAM',|Z}囊ykL !:fV5QhWԆnW4tbK4R߷򽃭9٤wS)IKQAX3l^pbm]5h:5 sap79`iYzhno(45m]y[LIN! !bÌӉBhj[?,<<2>HepvCGF˄w3s2aii7*]eQi4[yHY-سB)(25&cnw`c}l6\ˇgJj݇qM,(r"0%r%hC+ઋYit#n][ Rs@T\a{ix#ˏ@,#HmG d&7Sm:Y ka(vIǕLØs(@o !}.f$9k2(%1v@"aR>Bx\ZPlJ s:a !Մ^-{a5u6Ab=m\@A`oC)>l%twiRϻ\=q9L r<"?Dܮ߃niHK8nL:⌙*h,ETƔ'uS/x.|QJ< IjQLܴ_%(A[õ3;lcfjXm:@?q!ޙ?GtFtAFc&jȊsbeh=YHB"ϧ#BOi0 @ĉ&pDQ K;bB8]ݡwz9%yY7씎0ԯk |ahS~¹c6ߠBvfxϳ˸I4T]u^^zQ:q7tSբ!?QGܙLRQr6*ͥ1v@Lphm5sPY&P2Ԇzgu;R(3c3(*zi@`` &h[9 :4~ +2~c,V@*e~Yłփ(6YD_7{jJM@|y߮gw6 p|J'Se?K>2{X>)I4Xbn;i, ˼hP<~T)%G0rk=@7. AVvQɮ,j*i=@u@2|/3kF2A[QZ}oͥ4&Ԑl(1gcP-[ -16} 4cDŏUgojCjɴB!L.Ԟz1D;ɲ"P T])뙂|{|+ n%pI7HX sxBB2vW>)oPɒX2lL/VM~cM $uKoF^4n\Lql?U ^a$iN)[vA[#7EJ .1-~f+'db?~?P=|P޽ ?">"Kx2HSUHמL OjwӆS _;uJi)u7ft & Sz,aTP;A{XRʵpA=>}ki (i-Pm|L; 3;3xj 7ٱA]=e8 {bUUΠg-d;]`al80Dp,4-]HI D$U >P>;ڌn}_\>H~ׂ=g:[6So܏9|]8?Z+›2senfu'XdZ1" o[5xfPrK1\>@>)Dǎ*G+r`p{^eƤI߂=ZO!k#13i×%oH&{?;]:orFe 53a RF& Xz4P(Esܾ7n-xWM]!Ս+'ڸbgbI|Q|FM ^$<k\S&CN7߁)>UӯSQͷF۹%&&8*,ij=À(a ڂ֗  U{LuTˌ[5n:oY$%d#m@pi:UwN)X\ o׍&ZpmF:63d@Ie>Xŷz"l? `(SP_`8ݭ}&Ьn]AENE_p4**d]-L~Y-RtIHX֑(;8?ZA<: OMw]]cwH}v&c<|(9UF\5"\±q~?h0̎wA R@!WsD^o~[@sp?n80 }уT{pB8DWf1jqk(/k. Bm`!8`3πdHLU<ݵu]2G,D9?q:0\7>4TKi^ujW߳d L`')KggZ\1lƢ0c*ɇm@a,)B*eT8ZB YrTɌ:\4w@thHB yz:j<km-#"p'|\Ccg6C?ڃŸ9:0:2 ^VZ"1%W %8 Eg2L {!ݼA< GF-Q]k9} ıf֎&GU`&ęmKE,=%1Ԑ_ׁK/M}BȽ4ޜM$-[YRbԂi- ȾCvyGH2d2WG]5uPJ0"9E˳pN~"DKؤӾѤı4غh|Fx}U0sqP|LI -n~ɘMb2\N=_#f&^OKP0I.(g9jIfh:'mu5Q?71RvLJwT'ݙ7#T8}h`8r箥3zĤ}]zɚ <5E?WGGveu&DaD_$-s*l-w% kJ9ݵ|뢆k/LOHhmQgܾT|V s?uQO$t<&oi4i<2}|K޽W[#NR \=]_]o>/NA_YT7(-Վ L&MI; 0F-.5seΣ8ϰJ7rP{ hĮ-^XUZ3Qлͦdj rvBј0m÷]׽9 b:Z5` S`  P6&t<}@ԛS_)7K;Qě'J'\mϊvBZ$5$h)s M |D CXZd&lYX W7vKGLv>O;VY͊k0.c3Z9W}kL q,$b;M/VXp[^3/Oa$s-h'H]986  q]E]vB᭜g\8Ys}B?v`%`U,=2j)~TqEbT2YL0gy+5Uf6P=1A!?DۊwGH ^HbVD uymC 0넟(JG 3VكԬqyg}Bc(Cmyf7$ OYUƖbka]b? :{L4aG6{ԽN 11"d'2(̔;wseVyC3rt1S:GXG5V aAu)f]i[Al_B gDn2e&~եxQ3|8ò7IxTvw8PĹ2GU#ji@0 53$YnAED$ &n;cm ng.5y]Iwuqc.QhH1QOp3H-A;5R\o UEäcr1(VE T > IRm_:Vˊ?ǖzKf0x!|'P[~Ug7j8{Y@2a/ݖ } L{J8=TxvA RI #EhΘ]~s>`1+47ғDfs>УDeFWE 0R>P_WD}tCl r!gFQgqNh ڦ| {}J= L v2_*`U@yaFIb|?.kpxem FKAe92Vd8ć/-oUojgt2(  A?A \ByAX}QLdG}TD$BjHD<`0)ݸ<q6t6ރxve׭nd9^̱}"| PuE~8 %7.C{ӥ^*zgo賆fCzJ.?w|` l "J z[RʥjҁK %:LDJo:0|(25Wfp^[Өxhb9m!UWBX[۔S"ڔ+wE1XYtt=5KƞPK&@qMVO٠iʀS_chO.-!ï €8}oFo55ՇT~NtZ|MM`ۃ]/|cVz,[eRg n[yxy?\Rt r9{J!d~$~6Hw^SqW~0n^>5I!H3ɾȑ!ۚ@kwnrKvB}f=J>萟qQi6۩Ӂ@+ \@0m@86Q-tQzXp,GNDҵg6_v6X'"l@ L6sAж}↟)gz0(+ScL R}Z~ܡRY>uRfI 4,;- Ndc24S^8`R! sjwV FBoӃ-9z b q[/>40MR7굳MHS3Scfa\<KfX=5y9c=,;2Ec*cւf =z^hF$pUTA}X[4j5(p)}ڹs#ܝ >{߄Ly/bI} Y % `* =݇v]2u Ek"!د)]/.'춎Uzc$:M!pXUrX6?x3[lߚDiben Zg FH٤Bv߈~*a|`gGqPr(ƹ|/OVe 3dXxt$/ORsPŸOs,n%G4&&O9sz2`C0j"LLs@ScѠj%S;n 1GcJĹvD1TfaI2s+ڭI}Ea~TKjoW27$}t{@U'ӎjEMK!YĿ/mBqЩC,8:sqm|n։}\Xӭ5}Sޙ;e+ǜ/e$Z1yi8&:o i/ G_gC#n?CARZO*)CbFu9` b/62aֻ= wA𻵥Z[j6K+0 "XF:mLYCzz¯: -j x1+x=+::]hT,D.T./uʹe>80g50u VVf$5p\_aYxpbtBnח݆iꭵřopJM ݽ7v=F1I趐P$sWq{bgх [ɴ.͵<-qu` Mw-%Եa?)İ7fhdbB+:;px{J(_9g˓3h@_4d:\Kϔ퓗H4ved6\liO B5!ΝCThvF_V9g$Sj@w67]F7tztF# KJ_bSFVpHű$g]]þzy(7OЖ}1OzՠKs̰MZ<4/Cs2sSv ݎ'`9Övx(\GH3 jm^O=qpSXW8vgqmAs BA3TEW:0 Y3ES2#w6AG3v.Օ. _ih(0 !aX9rJ| `\2'AAݒcW/>(1g,E 5Q@Cc䥉]H_{[6pi ƈN<`rЭ>0]!NMh3y* Ѹ7G**!L,% XVnru2MxwS6XW8!Ar<_YFs}w)r6$Ж$G#t183Y,M1Em<DFJs&KvC7EO)!R7qdz}G(2WO b/n[:1,r#!)Tbv-~=t7֊zTuQWI~q.ؚgju򵇽VMS8A3ڹ[Eg2B׿i19C֚p]9mPi<}[CG'?SyQ[Ύ7QCE#5 4ꆅ>qJƷf{LPNO׬su3D+IH;˩UeW<$üDwPUl" j[V?U/av$?iܷT\{LJu1Er! ݽ`l!%C`Y|* _| kpV>H1-&fuJ0o 'ɥ.!cDQin}tzla1LU?94fퟶl]ׅf,]."Edh>XDf7g !ȴ*K06(q=)m[">EwOnؿME+gz}NNgIcyZwC uo?ʻ"yKɴmʙIg섎NTR*Em:76M{`R513%"/G;V@s²_8nlɨȇ&xɹO6] FܗTь(7T]D$~N5G2 uӳtMa^VػIYGC,"vrMY'ܬvCCЗ;AXPXFrƴcǯ$4߄OU4/[t&"5(~ d:q:ؚEvOp&e©P'ؖ MW֧8>+tT 7۰@ӅoL~;V*& 7m/l,AwELȳaOyQb:>_;T G̑ldE瘋9ƚ_0=ZgoaFd{pӮ /ìgbwқ8'tl@(Le 9lytlRW +s?lםW@[k;re E  7Z3ܚpH U"ݩM h[/>buJ4JO "w<99~@P~P Tw,+ǃ!q,w Bdo㬙X]8=fS W<5.{Bϯ=B3.RI{&e"547+ }&A(̭SQTѪ1-'n I;98.x-wG@e}:HPG>ਓ0`/dTJϡQ_qA]?ˋv?wG2.ۯ:^B%u~5wGj%OSA~rb.F,@fR}do{jG!fGFY+_:2螏nɠ}`H̵(ZNt%ͦuwB%kNܸB79?[5V/-_= i9ϊc lJ $tgFowu܀:8QI`}1 Z&>Ѡ6O#5tv{.qp*lF[Hc!L .sA78+s~Dk}[+ /#`e_"\S앒|N킴<$}.d*j( .Z QG:8"8$brS)p< Jr,&XnJQ>sG\U@ݨGUa)W Կ/ مx){e7TS*hy<1;6pW>P3`h㓲lzqyB}X>m\)qA b%{hbdO"W"f"Fe4YIp4D`_[g;Nl C ǴV@D71.wp/;)pݖ8cTH)M(0XI/׾;vr#/a)2>|{4-"W8K_*d?1JkPd./91EΓEL/VΦV($p}3~/>\ODlӃ-oך2n w/z5wҰ9"ǖMbֳ]</~?deoJ2y\ ROu2A ,Ya\ߩ~Ҵk΢7@ja-?޲<뾵i~ m2Oo(|{)=[#$e߸Ly J?Y&j6 4;o=C7Si-n 4-!Yr gO1)pk8KC)ZMϔO ?nMH:{W.rL*FB!KJ}@iO:p~.Xff.Kw$Hp}vW93o!\ ^v{C?]RԄߩ=g}:K1+/Bka[ Gyi Ţ\i:ӑlIr[IۓjRO-ݢz0yɸeѦ݅$%MSw݌z +t c~:LR,e6YF$5Yz̀HtJ4M@GhYboox0 906ۭa%{u:Ty,E_>\󾗸< +ؔp LM `뺏Vy%۹D3+.*@>E{I6̬HP|e8o8>QYIp)ra^%q}XlOhoI]IE\f#ZHr󝕍,^#N>5U?r@/9`)FSFGdmTbk;J.3!ͯ^PX&sl_i̙ ִH3M: k܊Dq(ˬUK70(ב6 0m&Gu ؓ {ݼt_M5lRKiU?uzیRg.U j\]VA'p G-|TߟFBmBxhv8ZތvSB_RuG+Ulqߖ޶Aѣ~WE5pDr}pWZL_ʷܯooS}K?q/2!d[yݺZ+v"K`  &~u>o͉đ6MC& +A$sӄi.1X1^i)׍qP)>`FhOb|+ʱ6jpMgYz*oϔ Su^ 3䣘-Zy&UbMt ݙӮRVj݉[33ߢ\L'SxelxA;^+JxHn`XU+./ W}V[f8KCED[28u!!4 8NKITT/zso ZlCezYڛ [eu6TdUfd\O9O 9Eƅ!F'U`^ '3ߢf ngP5lŝ] >ejJ=͔@UO(~K};2…Շװ/u8b^paP*?.1.C=yS.}܄hO<;6a:IFn⳽HAZhlJ{m?2=i_C0F (ĩ)d4IYR~m1sxYA0<{sjtV2*\]qӨ@OKRK~p:pSNWқ9lLkVdF yA O Kt)}ܲm2>Odf\#IxC?Kcd.k/U򭜈Aw=1LA}tė-w%^JB00RI%cD8\~*0PrVWKMԵG;dC3ͥlQ7M.K̰EU5%8J,4ϗ\)Ό~q l-y1i.djsu0ϸA!3COE) nkNx~O,Is{{N=?dȺ&@{aE^7NJ斪fZ&K+`G)bߕ_`o#|u+kgX9>4}AݴAv.C譛C ؊EFⓁqg2 g}0ʕ ^zyUx? -%힕eg`>k/sTym".?Y"=DVR#%?-ӏ:p=^^UZػ~o6];xoz &:s>Y=e1ɽԇ!MEG7 $ `%ЙHI[r5F&PޔHӽ|ѕ eVV3(ƥJ"ɽlZ{37.xO n&ېG\&],Zj Gתyjvc1*p}u"΄?ի0;tVJ,qq/N8@D+0^8AMo0,uAjg+C/1ܬn_mȰ%|ŵ>u>nkRX9A٭_uNuFQP<,eϨҚ%#MW+^DS_ #?~Sj0po $f=ҋgFwZD\F:ˠ#l T u,M'*Vv.~jAx 8~E"քw翉1S7uX[ Sx (1hqOkeE( 9ֻT72W>;U.ǃԸ1>L^ PG'O,^pc0 G]LE9-+YRm^r+{E\مI'eDJ*DJ};*K{mv6G#ypOa$g `|oii< vj0>Rt+;K ~d+FߣHZ Y5׮,ICb:Tx]KgY`FGo|A~ם~P>93JAp@1K|I=^Nd9+>v/ڌm5G|6k^^1%˩gAMDً kv-7<iGߦvKI|od#k5*[wi ŎBM?e:+A!0)@Uqf_&vpb"23C '8/ MgQh X%. #AS!A щxR݊̒ybR }GOJ qc)q=5iiIC2vr!.;L@;ȥA(9\q4P)1ER%|.;_aX3զz5v60_^yL}ȫ>F;Jm6Y?93F7=0?53pTvK|బFdZ1#QǸsz&<->힮^iSv3QYg.j4ɫ"S تl`.: -5?KiM0>~Zg.XQ7b "5RH)uU|t4Hel7;:4QItQ3b1bE'CGC>}x( 1Vݥt&Y{K،Hc 8 YZ